Gelmap. Spot visualization by LUH

Peptidelist

ID	Accession	Protein	Complex	physiological function	compartment	Cmpd.	m/z meas.	Mr meas.	m/z calc.	Mr calc.	z	Î”m/z [ppm]	Rt [min]	Int.	Mascot Score	#Cmpds.	Range	Sequence	Modifications
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	301	722.42	1442.83	722.43	1442.85	2	-10.72	18.9	7173	37	3	493 - 506	R.KILDGISFVVPAGK.S
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	346	658.38	1314.74	658.38	1314.75	2	-10.44	20.4	7936	61	3	494 - 506	K.ILDGISFVVPAGK.S
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	350	555.79	1109.56	555.79	1109.57	2	-11.06	20.5	4529	57	3	126 - 134	R.TLAGYLWMR.D
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	51	531.79	1061.56	531.79	1061.57	2	-9.25	11.7	7971	61	3	507 - 518	K.SVAIVGTSGSGK.S
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	85	462.74	923.46	462.74	923.47	2	-10.59	12.6	9216	58	2	605 - 612	K.YSTIVGER.G
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	370	579.86	1157.70	579.87	1157.72	2	-12.18	22.6	40531	80	4	143 - 154	R.VIAALGFLVGAK.V
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	205	489.90	1466.68	489.90	1466.69	3	-6.93	15.8	4780	61	2	578 - 590	R.LSATEEEVYEAAR.R
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	354	555.79	1109.56	555.79	1109.57	2	-11.50	20.6	13890	34	3	126 - 134	R.TLAGYLWMR.D
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	248	570.78	1139.55	570.78	1139.55	2	-7.14	17.1	4990	40	4	452 - 460	K.SMFQLLEEK.S	Oxidation: 2
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	13	731.78	1461.55	731.79	1461.56	2	-9.08	9.5	25877	62	2	109 - 122	K.TTSSDSDSAMADMK.I	Oxidation: 13
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	41	661.83	1321.65	661.84	1321.66	2	-8.73	11	7172	37	2	371 - 381	K.KYEDAALQTQR.S
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	191	451.24	1350.69	451.24	1350.70	3	-10.92	15.4	4022	40	1	238 - 248	K.VFSHLHDLDLR.Y
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	157	541.26	1080.51	541.27	1080.52	2	-9.13	14.6	6108	69	3	210 - 219	R.TGSSAFNELR.T
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	272	534.76	2135.02	534.77	2135.04	4	-9.48	17.7	8283	24	1	476 - 493	K.GGNIEFENVHFSYLPERK.I
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	208	489.90	1466.68	489.90	1466.69	3	-7.98	15.8	11165	22	2	578 - 590	R.LSATEEEVYEAAR.R
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	59	586.81	1171.61	586.82	1171.62	2	-12.21	11.9	21855	36	2	538 - 547	R.IDGQDIKEVR.L
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	145	534.62	1600.85	534.63	1600.87	3	-9.72	14.3	5167	55	3	461 - 475	K.SDITNTSDAKPLVLK.G
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	310	669.98	2006.93	669.99	2006.95	3	-8.14	19.1	7643	34	2	476 - 492	K.GGNIEFENVHFSYLPER.K
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	332	562.78	1123.54	562.79	1123.56	2	-12.81	20.1	29343	40	3	452 - 460	K.SMFQLLEEK.S
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	62	597.79	1193.56	597.79	1193.57	2	-7.63	12	10085	73	3	372 - 381	K.YEDAALQTQR.S
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	359	708.11	2828.40	708.11	2828.42	4	-8.46	21.4	20978	44	3	553 - 577	R.SSIGVVPQDTVLFNDTIFHNIHYGR.L
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	249	570.78	1139.54	570.78	1139.55	2	-9.44	17.1	6774	33	4	452 - 460	K.SMFQLLEEK.S	Oxidation: 2
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	367	579.86	1157.70	579.87	1157.72	2	-12.33	22.5	32889	65	4	143 - 154	R.VIAALGFLVGAK.V
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	375	652.38	1302.75	652.39	1302.77	2	-11.93	22.7	4204	82	4	155 - 165	K.VLNVQVPFLFK.L
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	230	590.29	1178.57	590.30	1178.59	2	-9.35	16.6	7489	21	3	442 - 451	R.ETIQSLVDMK.S	Oxidation: 9
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	56	531.79	1061.56	531.79	1061.57	2	-10.04	11.8	27355	70	3	507 - 518	K.SVAIVGTSGSGK.S
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	342	658.38	1314.74	658.38	1314.75	2	-12.14	20.3	5274	83	3	494 - 506	K.ILDGISFVVPAGK.S
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	333	562.78	1123.54	562.79	1123.56	2	-13.79	20.1	10212	51	3	452 - 460	K.SMFQLLEEK.S
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	57	1062.57	1061.56	1062.58	1061.57	1	-10.05	11.8	8905	28	2	507 - 518	K.SVAIVGTSGSGK.S
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	373	652.38	1302.75	652.39	1302.77	2	-12.05	22.7	39703	59	4	155 - 165	K.VLNVQVPFLFK.L
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	287	582.30	1162.58	582.30	1162.59	2	-10.74	18.2	4436	78	2	442 - 451	R.ETIQSLVDMK.S
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	39	661.83	1321.65	661.84	1321.66	2	-8.76	11	3613	47	2	371 - 381	K.KYEDAALQTQR.S
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	233	587.80	2347.16	587.80	2347.18	4	-9.12	16.6	4302	40	2	592 - 612	R.AAIHETISNFPDKYSTIVGER.G
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	104	474.25	1419.72	474.25	1419.74	3	-9.91	13.2	6881	32	3	691 - 703	K.VVEQGPHDELLGK.S
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	343	658.38	1314.74	658.38	1314.75	2	-10.85	20.4	3779	80	3	494 - 506	K.ILDGISFVVPAGK.S
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	185	541.93	1622.78	541.94	1622.79	3	-8.60	15.2	7227	30	2	578 - 591	R.LSATEEEVYEAARR.A
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	40	441.56	1321.65	441.56	1321.66	3	-8.73	11	10619	48	3	371 - 381	K.KYEDAALQTQR.S
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	260	647.64	1939.91	647.65	1939.93	3	-7.98	17.4	10079	31	2	528 - 544	R.FFDTDSGNIRIDGQDIK.E
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	160	541.26	1080.51	541.27	1080.52	2	-9.92	14.6	10638	70	3	210 - 219	R.TGSSAFNELR.T
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	254	570.78	1139.54	570.78	1139.55	2	-11.89	17.2	4973	32	4	452 - 460	K.SMFQLLEEK.S	Oxidation: 2
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	372	652.38	1302.76	652.39	1302.77	2	-11.49	22.6	12767	60	4	155 - 165	K.VLNVQVPFLFK.L
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	147	493.94	1478.79	493.94	1478.80	3	-4.88	14.3	5511	27	3	237 - 248	R.KVFSHLHDLDLR.Y
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	300	722.42	1442.83	722.43	1442.85	2	-11.35	18.9	6986	39	3	493 - 506	R.KILDGISFVVPAGK.S
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	142	534.62	1600.85	534.63	1600.87	3	-12.58	14.2	3608	47	3	461 - 475	K.SDITNTSDAKPLVLK.G
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	376	652.39	1302.76	652.39	1302.77	2	-10.51	22.8	12142	53	4	155 - 165	K.VLNVQVPFLFK.L
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	13	731.78	1461.55	731.79	1461.56	2	-9.08	9.5	25877	94	2	109 - 122	K.TTSSDSDSAMADMK.I	Oxidation: 10
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	302	481.95	1442.83	481.96	1442.85	3	-10.72	19	4718	65	3	493 - 506	R.KILDGISFVVPAGK.S
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	103	710.87	1419.72	710.88	1419.74	2	-11.58	13.1	4648	19	1	691 - 703	K.VVEQGPHDELLGK.S
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	280	683.36	1364.71	683.37	1364.72	2	-8.78	18.1	12788	60	4	342 - 353	R.AIDSLINYETVK.Y
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	285	582.29	1162.57	582.30	1162.59	2	-13.25	18.1	14341	58	2	442 - 451	R.ETIQSLVDMK.S
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	38	441.56	1321.65	441.56	1321.66	3	-8.76	11	8350	40	3	371 - 381	K.KYEDAALQTQR.S
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	163	541.26	1080.51	541.27	1080.52	2	-9.79	14.7	6985	67	3	210 - 219	R.TGSSAFNELR.T
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	284	719.99	2156.95	720.00	2156.97	3	-9.01	18.1	5347	19	2	354 - 370	K.YFNNEGYEAEKYDQFLK.K
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	189	586.27	1170.52	586.27	1170.53	2	-9.85	15.3	5291	52	3	528 - 537	R.FFDTDSGNIR.I
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	366	579.86	1157.70	579.87	1157.72	2	-13.26	22.4	5229	77	4	143 - 154	R.VIAALGFLVGAK.V
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	98	474.25	1419.72	474.25	1419.74	3	-9.51	13	11482	28	3	691 - 703	K.VVEQGPHDELLGK.S
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	15	731.78	1461.55	731.79	1461.56	2	-7.52	9.5	40531	41	2	109 - 122	K.TTSSDSDSAMADMK.I	Oxidation: 13
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	335	562.78	1123.54	562.79	1123.56	2	-14.07	20.2	57809	44	3	452 - 460	K.SMFQLLEEK.S
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	368	579.86	1157.70	579.87	1157.72	2	-12.14	22.5	25877	85	4	143 - 154	R.VIAALGFLVGAK.V
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	309	563.78	1125.55	563.79	1125.56	2	-12.55	19.1	13050	64	2	126 - 134	R.TLAGYLWMR.D	Oxidation: 8
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	356	708.11	2828.40	708.11	2828.42	4	-8.63	21.3	3423	25	3	553 - 577	R.SSIGVVPQDTVLFNDTIFHNIHYGR.L
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	43	441.56	1321.65	441.56	1321.66	3	-9.00	11.1	25690	43	3	371 - 381	K.KYEDAALQTQR.S
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	64	597.79	1193.56	597.79	1193.57	2	-7.56	12	2820	79	3	372 - 381	K.YEDAALQTQR.S
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	306	563.78	1125.55	563.79	1125.56	2	-10.46	19.1	38630	66	2	126 - 134	R.TLAGYLWMR.D	Oxidation: 8
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	101	474.25	1419.72	474.25	1419.74	3	-11.58	13.1	8040	37	3	691 - 703	K.VVEQGPHDELLGK.S
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	279	683.36	1364.70	683.37	1364.72	2	-13.42	18	11970	46	4	342 - 353	R.AIDSLINYETVK.Y
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	146	801.43	1600.85	801.44	1600.87	2	-9.72	14.3	4515	40	1	461 - 475	K.SDITNTSDAKPLVLK.G
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	187	586.27	1170.52	586.27	1170.53	2	-9.49	15.3	21254	52	3	528 - 537	R.FFDTDSGNIR.I
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	227	590.29	1178.57	590.30	1178.59	2	-10.69	16.5	5200	57	3	442 - 451	R.ETIQSLVDMK.S	Oxidation: 9
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	206	734.35	1466.68	734.35	1466.69	2	-7.98	15.8	8175	115	3	578 - 590	R.LSATEEEVYEAAR.R
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	66	620.95	1859.81	620.95	1859.82	3	-5.61	12.1	5203	20	1	109 - 125	K.TTSSDSDSAMADMKILR.T	Oxidation: 10
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	186	541.93	1622.78	541.94	1622.79	3	-8.99	15.3	14651	28	2	578 - 591	R.LSATEEEVYEAARR.A
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	299	481.95	1442.83	481.96	1442.85	3	-11.34	18.9	5396	21	3	493 - 506	R.KILDGISFVVPAGK.S
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	61	597.79	1193.56	597.79	1193.57	2	-8.40	11.9	8027	79	3	372 - 381	K.YEDAALQTQR.S
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	352	555.79	1109.56	555.79	1109.57	2	-10.22	20.6	14209	38	3	126 - 134	R.TLAGYLWMR.D
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	283	683.36	1364.71	683.37	1364.72	2	-10.04	18.1	17403	56	4	342 - 353	R.AIDSLINYETVK.Y
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	226	590.29	1178.57	590.30	1178.59	2	-12.57	16.5	5638	50	3	442 - 451	R.ETIQSLVDMK.S	Oxidation: 9
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	281	719.99	2156.95	720.00	2156.97	3	-7.94	18.1	11072	32	2	354 - 370	K.YFNNEGYEAEKYDQFLK.K
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	288	683.36	1364.71	683.37	1364.72	2	-9.77	18.2	5582	35	4	342 - 353	R.AIDSLINYETVK.Y
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	252	570.78	1139.54	570.78	1139.55	2	-10.42	17.2	22656	39	4	452 - 460	K.SMFQLLEEK.S	Oxidation: 2
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	112	472.76	943.51	472.77	943.52	2	-9.65	13.6	33243	64	3	666 - 673	R.TSIFIAHR.L
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	111	472.76	943.51	472.77	943.52	2	-11.45	13.5	9690	50	3	666 - 673	R.TSIFIAHR.L
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	358	943.81	2828.40	943.82	2828.42	3	-8.62	21.3	6772	34	1	553 - 577	R.SSIGVVPQDTVLFNDTIFHNIHYGR.L
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	237	587.80	2347.16	587.80	2347.18	4	-9.85	16.7	109515	60	2	592 - 612	R.AAIHETISNFPDKYSTIVGER.G
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	304	481.95	1442.83	481.96	1442.85	3	-10.18	19	9067	44	3	493 - 506	R.KILDGISFVVPAGK.S
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	148	534.62	1600.85	534.63	1600.87	3	-10.28	14.4	4973	49	3	461 - 475	K.SDITNTSDAKPLVLK.G
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	184	586.27	1170.52	586.27	1170.53	2	-5.65	15.2	6945	52	3	528 - 537	R.FFDTDSGNIR.I
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	355	708.11	2828.40	708.11	2828.42	4	-8.56	21.3	6032	50	3	553 - 577	R.SSIGVVPQDTVLFNDTIFHNIHYGR.L
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	273	712.68	2135.02	712.69	2135.04	3	-9.48	17.8	5324	22	1	476 - 493	K.GGNIEFENVHFSYLPERK.I
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	58	586.81	1171.61	586.82	1171.62	2	-12.09	11.9	5856	18	2	538 - 547	R.IDGQDIKEVR.L
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	203	734.35	1466.68	734.35	1466.69	2	-6.93	15.7	9799	115	3	578 - 590	R.LSATEEEVYEAAR.R
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	149	493.94	1478.79	493.94	1478.80	3	-8.82	14.4	8037	39	3	237 - 248	R.KVFSHLHDLDLR.Y
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	55	1062.57	1061.56	1062.58	1061.57	1	-9.12	11.8	5948	31	2	507 - 518	K.SVAIVGTSGSGK.S
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	54	531.79	1061.56	531.79	1061.57	2	-9.10	11.7	8086	64	3	507 - 518	K.SVAIVGTSGSGK.S
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	308	669.99	2006.93	669.99	2006.95	3	-6.86	19.1	4619	39	2	476 - 492	K.GGNIEFENVHFSYLPER.K
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	15	731.78	1461.55	731.79	1461.56	2	-7.52	9.5	40531	41	2	109 - 122	K.TTSSDSDSAMADMK.I	Oxidation: 10
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	305	722.42	1442.83	722.43	1442.85	2	-10.18	19	3557	19	3	493 - 506	R.KILDGISFVVPAGK.S
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	88	462.74	923.46	462.74	923.47	2	-11.32	12.7	12867	24	2	605 - 612	K.YSTIVGER.G
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	152	493.94	1478.79	493.94	1478.80	3	-9.65	14.5	4493	20	3	237 - 248	R.KVFSHLHDLDLR.Y
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	114	472.76	943.51	472.77	943.52	2	-10.77	13.6	27984	64	3	666 - 673	R.TSIFIAHR.L
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	202	734.35	1466.68	734.35	1466.69	2	-7.43	15.7	5371	103	3	578 - 590	R.LSATEEEVYEAAR.R
880	AT5G58270.1	ATM3 (mitochondrial ABC transporter 3)	other transporters	d) transport	mitochondrion	263	647.65	1939.91	647.65	1939.93	3	-7.36	17.5	5454	24	2	528 - 544	R.FFDTDSGNIRIDGQDIK.E
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	226	447.24	1338.70	447.24	1338.69	3	11.51	15	5732	63	2	72 - 83	R.MEIAADSLYKAK.L
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	228	648.84	1295.68	648.83	1295.65	2	16.03	15.1	42591	66	3	71 - 81	R.RMEIAADSLYK.A
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	154	656.84	1311.67	656.83	1311.65	2	14.57	13.4	3961	31	2	71 - 81	R.RMEIAADSLYK.A	Oxidation: 2
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	145	743.44	742.43	743.43	742.42	1	13.58	13.2	16810	27	1	383 - 389	K.EVKASLP.-
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	425	548.61	1642.81	548.60	1642.78	3	14.38	23.4	4309	61	3	51 - 64	R.SVESSSQELLDFFR.T
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	167	613.35	1224.69	613.34	1224.67	2	13.70	13.7	69193	59	1	322 - 332	K.LVLSHDLATEK.E
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	218	461.76	921.50	461.75	921.49	2	13.15	14.9	16149	47	2	110 - 117	K.DAIITAYR.D
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	403	506.93	1517.75	506.92	1517.73	3	15.93	20.8	4705	49	3	126 - 139	R.GGSLHEVFSELMGR.Q
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	59	860.45	859.44	860.44	859.43	1	13.08	10.5	19639	34	1	344 - 351	K.EVDDAIAK.A
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	169	433.22	1296.63	433.21	1296.61	3	17.02	13.7	20498	44	3	371 - 382	K.GFGTESFGPDRK.E
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	159	452.57	1354.70	452.57	1354.68	3	14.60	13.5	5091	44	2	72 - 83	R.MEIAADSLYKAK.L	Oxidation: 1
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	240	585.28	1168.54	585.26	1168.51	2	19.50	15.5	77320	68	2	371 - 381	K.GFGTESFGPDR.K
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	9	450.74	899.46	450.73	899.45	2	12.79	9.1	12242	55	3	239 - 245	K.SPSYYKR.G
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	6	537.57	1609.68	537.56	1609.66	3	15.83	8.8	5638	41	4	288 - 301	R.YHGHSMSDPGSTYR.T	Oxidation: 6
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	375	884.12	2649.34	884.11	2649.30	3	16.16	19.5	7307	34	3	157 - 182	K.ESSFYGGHGIVGAQVPLGCGIAFAQK.Y	Carbamidomethyl: 19
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	372	654.35	1306.68	654.34	1306.66	2	16.45	19.4	10106	53	3	277 - 287	K.GPIILEMDTYR.Y
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	43	744.36	743.36	744.36	743.35	1	10.05	10	27603	25	3	239 - 244	K.SPSYYK.R
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	227	447.24	1338.70	447.24	1338.69	3	11.76	15.1	61561	59	2	72 - 83	R.MEIAADSLYKAK.L
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	177	534.76	1067.51	534.76	1067.50	2	15.63	13.9	23442	44	3	254 - 263	K.VDGMDAFAVK.Q	Oxidation: 4
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	257	1140.58	1139.57	1140.56	1139.55	1	16.08	16.3	14575	42	3	72 - 81	R.MEIAADSLYK.A
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	137	502.79	1003.56	502.78	1003.55	2	13.39	13	5299	33	2	245 - 253	K.RGDYVPGLK.V
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	254	570.79	1139.57	570.78	1139.55	2	14.98	16.2	11253	70	3	72 - 81	R.MEIAADSLYK.A
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	207	1156.58	1155.57	1156.56	1155.55	1	18.48	14.6	14291	16	3	72 - 81	R.MEIAADSLYK.A	Oxidation: 1
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	274	662.35	1322.68	662.33	1322.65	2	18.56	16.7	3639	66	3	277 - 287	K.GPIILEMDTYR.Y	Oxidation: 7
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	124	677.40	1352.78	677.39	1352.77	2	11.43	12.7	7862	30	1	321 - 332	K.KLVLSHDLATEK.E
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	206	578.79	1155.57	578.78	1155.55	2	18.46	14.6	15924	60	2	72 - 81	R.MEIAADSLYK.A	Oxidation: 1
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	253	570.79	1139.57	570.78	1139.55	2	15.95	16.2	36355	72	3	72 - 81	R.MEIAADSLYK.A
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	259	1140.58	1139.57	1140.56	1139.55	1	15.81	16.3	14065	16	3	72 - 81	R.MEIAADSLYK.A
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	221	432.90	1295.67	432.89	1295.65	3	15.76	14.9	34862	48	2	71 - 81	R.RMEIAADSLYK.A
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	429	548.61	1642.81	548.60	1642.78	3	16.08	23.4	10000	72	3	51 - 64	R.SVESSSQELLDFFR.T
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	306	632.07	2524.26	632.06	2524.21	4	18.81	17.4	7584	56	3	87 - 109	R.GFCHLYDGQEAVAIGMEAAITKK.D	Oxidation: 16
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	366	628.00	1880.97	627.99	1880.93	3	16.82	19.3	4206	36	2	246 - 263	R.GDYVPGLKVDGMDAFAVK.Q
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	303	504.27	2013.07	504.27	2013.04	4	15.92	17.3	6864	18	3	271 - 287	K.QHALEKGPIILEMDTYR.Y
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	380	742.37	2224.09	742.36	2224.05	3	17.20	19.6	4257	34	4	352 - 370	K.AKDCPMPEPSELFTNVYVK.G	Carbamidomethyl: 4
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	225	648.84	1295.67	648.83	1295.65	2	15.16	15	52732	49	3	71 - 81	R.RMEIAADSLYK.A
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	422	548.61	1642.81	548.60	1642.78	3	13.98	23.3	4534	67	3	51 - 64	R.SVESSSQELLDFFR.T
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	346	747.70	2240.09	747.69	2240.05	3	19.35	18.5	26363	54	3	352 - 370	K.AKDCPMPEPSELFTNVYVK.G	Oxidation: 6
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	237	677.36	2029.07	677.35	2029.03	3	17.40	15.4	25452	25	3	271 - 287	K.QHALEKGPIILEMDTYR.Y	Oxidation: 13
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	333	641.00	1919.99	641.00	1919.97	3	12.69	18.2	9191	50	2	110 - 125	K.DAIITAYRDHCIFLGR.G	Carbamidomethyl: 11
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	335	641.01	1920.00	641.00	1919.97	3	15.59	18.3	3923	30	2	110 - 125	K.DAIITAYRDHCIFLGR.G	Carbamidomethyl: 11
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	382	884.12	2649.35	884.11	2649.30	3	19.43	19.7	12187	18	3	157 - 182	K.ESSFYGGHGIVGAQVPLGCGIAFAQK.Y	Carbamidomethyl: 19
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	196	424.74	847.46	424.73	847.44	2	16.53	14.3	5839	20	3	246 - 253	R.GDYVPGLK.V
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	210	1156.58	1155.57	1156.56	1155.55	1	17.39	14.7	31357	21	3	72 - 81	R.MEIAADSLYK.A	Oxidation: 1
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	320	949.49	1896.96	949.47	1896.93	2	17.42	17.8	4197	24	3	246 - 263	R.GDYVPGLKVDGMDAFAVK.Q	Oxidation: 12
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	51	532.24	1593.69	532.23	1593.66	3	16.05	10.3	16511	35	2	288 - 301	R.YHGHSMSDPGSTYR.T
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	399	759.88	1517.75	759.87	1517.73	2	14.36	20.7	19765	40	3	126 - 139	R.GGSLHEVFSELMGR.Q
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	368	654.35	1306.68	654.34	1306.66	2	16.92	19.3	7534	63	3	277 - 287	K.GPIILEMDTYR.Y
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	342	767.88	1533.75	767.87	1533.72	2	16.96	18.4	42786	66	3	126 - 139	R.GGSLHEVFSELMGR.Q	Oxidation: 12
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	153	438.23	1311.67	438.22	1311.65	3	14.57	13.4	5280	66	3	71 - 81	R.RMEIAADSLYK.A	Oxidation: 2
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	168	433.22	1296.63	433.21	1296.61	3	17.23	13.7	42420	41	3	371 - 382	K.GFGTESFGPDRK.E
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	238	508.27	2029.07	508.26	2029.03	4	17.39	15.4	9401	38	3	271 - 287	K.QHALEKGPIILEMDTYR.Y	Oxidation: 13
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	16	494.78	987.54	494.77	987.52	2	14.24	9.3	4391	65	3	343 - 351	R.KEVDDAIAK.A
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	216	461.76	921.51	461.75	921.49	2	14.30	14.8	5836	41	2	110 - 117	K.DAIITAYR.D
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	343	747.70	2240.09	747.69	2240.05	3	19.46	18.4	38095	69	3	352 - 370	K.AKDCPMPEPSELFTNVYVK.G	Oxidation: 6
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	339	767.88	1533.75	767.87	1533.72	2	17.01	18.4	14326	65	3	126 - 139	R.GGSLHEVFSELMGR.Q	Oxidation: 12
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	318	949.49	1896.97	949.47	1896.93	2	19.20	17.7	6546	24	3	246 - 263	R.GDYVPGLKVDGMDAFAVK.Q	Oxidation: 12
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	345	512.26	1533.75	512.25	1533.72	3	17.37	18.5	57508	40	3	126 - 139	R.GGSLHEVFSELMGR.Q	Oxidation: 12
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	134	502.79	1003.56	502.78	1003.55	2	13.27	12.9	6274	49	2	245 - 253	K.RGDYVPGLK.V
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	224	432.90	1295.67	432.89	1295.65	3	15.16	15	77647	46	2	71 - 81	R.RMEIAADSLYK.A
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	256	570.79	1139.57	570.78	1139.55	2	16.07	16.3	16448	68	3	72 - 81	R.MEIAADSLYK.A
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	37	516.78	1031.55	516.78	1031.54	2	11.57	9.9	21316	17	1	302 - 310	R.TRDEISGVR.Q
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	162	678.36	1354.70	678.35	1354.68	2	15.39	13.6	7485	28	1	72 - 83	R.MEIAADSLYKAK.L	Oxidation: 1
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	45	744.37	743.36	744.36	743.35	1	14.68	10.1	4495	31	3	239 - 244	K.SPSYYK.R
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	5	537.57	1609.68	537.56	1609.66	3	15.03	8.8	3325	24	4	288 - 301	R.YHGHSMSDPGSTYR.T	Oxidation: 6
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	234	508.27	2029.06	508.26	2029.03	4	16.78	15.4	18406	55	3	271 - 287	K.QHALEKGPIILEMDTYR.Y	Oxidation: 13
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	160	452.57	1354.70	452.57	1354.68	3	15.38	13.5	6038	52	2	72 - 83	R.MEIAADSLYKAK.L	Oxidation: 1
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	199	848.46	847.46	848.45	847.44	1	14.79	14.4	3593	37	1	246 - 253	R.GDYVPGLK.V
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	255	1140.58	1139.57	1140.56	1139.55	1	14.99	16.2	36555	18	3	72 - 81	R.MEIAADSLYK.A
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	173	649.32	1296.63	649.31	1296.61	2	16.10	13.8	6709	67	3	371 - 382	K.GFGTESFGPDRK.E
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	271	662.35	1322.68	662.33	1322.65	2	17.60	16.6	10188	81	3	277 - 287	K.GPIILEMDTYR.Y	Oxidation: 7
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	319	633.33	1896.96	633.32	1896.93	3	17.41	17.7	10197	29	2	246 - 263	R.GDYVPGLKVDGMDAFAVK.Q	Oxidation: 12
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	10	450.74	899.46	450.73	899.45	2	13.06	9.1	5115	55	3	239 - 245	K.SPSYYKR.G
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	310	632.07	2524.25	632.06	2524.21	4	17.30	17.5	9650	58	3	87 - 109	R.GFCHLYDGQEAVAIGMEAAITKK.D	Oxidation: 16
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	57	430.73	859.44	430.72	859.43	2	13.07	10.5	43093	37	3	344 - 351	K.EVDDAIAK.A
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	401	506.93	1517.75	506.92	1517.73	3	15.62	20.8	19468	40	3	126 - 139	R.GGSLHEVFSELMGR.Q
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	334	481.01	1919.99	481.00	1919.97	4	12.67	18.2	4853	38	2	110 - 125	K.DAIITAYRDHCIFLGR.G	Carbamidomethyl: 11
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	427	822.41	1642.81	822.40	1642.78	2	16.09	23.4	4272	121	3	51 - 64	R.SVESSSQELLDFFR.T
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	62	430.73	859.44	430.72	859.43	2	14.20	10.7	25697	38	3	344 - 351	K.EVDDAIAK.A
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	307	632.07	2524.25	632.06	2524.21	4	18.08	17.5	9265	59	3	87 - 109	R.GFCHLYDGQEAVAIGMEAAITKK.D	Oxidation: 16
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	179	534.76	1067.51	534.76	1067.50	2	16.18	13.9	6610	45	3	254 - 263	K.VDGMDAFAVK.Q	Oxidation: 4
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	166	409.24	1224.69	409.23	1224.67	3	13.69	13.7	7483	41	2	322 - 332	K.LVLSHDLATEK.E
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	400	759.88	1517.75	759.87	1517.73	2	15.64	20.7	4495	60	3	126 - 139	R.GGSLHEVFSELMGR.Q
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	270	662.35	1322.68	662.33	1322.65	2	16.80	16.6	11842	71	3	277 - 287	K.GPIILEMDTYR.Y	Oxidation: 7
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	317	633.33	1896.97	633.32	1896.93	3	19.20	17.7	3137	29	2	246 - 263	R.GDYVPGLKVDGMDAFAVK.Q	Oxidation: 12
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	231	508.27	2029.06	508.26	2029.03	4	16.42	15.3	4352	39	3	271 - 287	K.QHALEKGPIILEMDTYR.Y	Oxidation: 13
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	279	526.77	1051.52	526.76	1051.50	2	15.68	16.8	5747	59	2	254 - 263	K.VDGMDAFAVK.Q
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	13	494.78	987.54	494.77	987.52	2	14.24	9.2	7534	74	3	343 - 351	R.KEVDDAIAK.A
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	402	759.88	1517.75	759.87	1517.73	2	15.95	20.8	15027	44	3	126 - 139	R.GGSLHEVFSELMGR.Q
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	222	648.84	1295.67	648.83	1295.65	2	15.78	15	11656	39	3	71 - 81	R.RMEIAADSLYK.A
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	163	409.24	1224.69	409.23	1224.67	3	14.23	13.6	3734	48	2	322 - 332	K.LVLSHDLATEK.E
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	363	628.00	1880.97	627.99	1880.93	3	17.83	19.2	3387	42	2	246 - 263	R.GDYVPGLKVDGMDAFAVK.Q
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	232	677.36	2029.06	677.35	2029.03	3	16.42	15.3	11212	37	3	271 - 287	K.QHALEKGPIILEMDTYR.Y	Oxidation: 13
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	424	822.41	1642.81	822.40	1642.78	2	14.40	23.4	4776	127	3	51 - 64	R.SVESSSQELLDFFR.T
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	390	1021.49	2040.96	1021.47	2040.92	2	18.90	20.2	3176	29	2	354 - 370	K.DCPMPEPSELFTNVYVK.G	Oxidation: 4
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	398	506.92	1517.75	506.92	1517.73	3	14.35	20.7	27603	45	3	126 - 139	R.GGSLHEVFSELMGR.Q
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	209	1156.58	1155.57	1156.56	1155.55	1	17.39	14.7	34430	30	3	72 - 81	R.MEIAADSLYK.A	Oxidation: 1
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	149	438.23	1311.67	438.22	1311.65	3	14.20	13.2	3999	68	3	71 - 81	R.RMEIAADSLYK.A	Oxidation: 2
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	122	451.93	1352.78	451.93	1352.77	3	11.07	12.6	3660	32	2	321 - 332	K.KLVLSHDLATEK.E
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	8	450.74	899.46	450.73	899.45	2	12.50	9	3387	38	3	239 - 245	K.SPSYYKR.G
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	208	578.79	1155.57	578.78	1155.55	2	17.37	14.6	12534	77	2	72 - 81	R.MEIAADSLYK.A	Oxidation: 1
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	338	512.26	1533.75	512.25	1533.72	3	17.00	18.4	5193	47	3	126 - 139	R.GGSLHEVFSELMGR.Q	Oxidation: 12
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	381	742.37	2224.10	742.36	2224.05	3	19.38	19.7	12746	50	4	352 - 370	K.AKDCPMPEPSELFTNVYVK.G	Carbamidomethyl: 4
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	172	433.22	1296.63	433.21	1296.61	3	16.08	13.8	5696	55	3	371 - 382	K.GFGTESFGPDRK.E
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	19	521.77	1041.53	521.77	1041.52	2	11.81	9.4	66416	30	2	311 - 318	R.QERDPIER.I
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	52	532.24	1593.69	532.23	1593.66	3	16.61	10.3	9463	29	2	288 - 301	R.YHGHSMSDPGSTYR.T
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	170	649.32	1296.63	649.31	1296.61	2	17.05	13.7	18746	70	3	371 - 382	K.GFGTESFGPDRK.E
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	151	656.84	1311.67	656.83	1311.65	2	15.70	13.3	5978	35	2	71 - 81	R.RMEIAADSLYK.A	Oxidation: 2
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	44	744.37	743.36	744.36	743.35	1	12.88	10.1	19765	36	3	239 - 244	K.SPSYYK.R
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	277	526.77	1051.52	526.76	1051.50	2	16.64	16.8	5270	51	2	254 - 263	K.VDGMDAFAVK.Q
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	309	504.27	2013.07	504.27	2013.04	4	17.29	17.5	28799	40	3	271 - 287	K.QHALEKGPIILEMDTYR.Y
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	11	494.78	987.54	494.77	987.52	2	13.27	9.1	4206	48	3	343 - 351	R.KEVDDAIAK.A
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	123	451.93	1352.78	451.93	1352.77	3	11.42	12.7	9826	24	2	321 - 332	K.KLVLSHDLATEK.E
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	316	949.49	1896.96	949.47	1896.93	2	18.42	17.6	7248	60	3	246 - 263	R.GDYVPGLKVDGMDAFAVK.Q	Oxidation: 12
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	150	438.23	1311.67	438.22	1311.65	3	15.69	13.3	6260	70	3	71 - 81	R.RMEIAADSLYK.A	Oxidation: 2
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	4	537.57	1609.68	537.56	1609.66	3	16.47	8.7	4357	28	4	288 - 301	R.YHGHSMSDPGSTYR.T	Oxidation: 6
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	22	521.77	1041.53	521.77	1041.52	2	12.06	9.5	3850	36	2	311 - 318	R.QERDPIER.I
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	378	884.12	2649.35	884.11	2649.30	3	18.22	19.6	10211	43	3	157 - 182	K.ESSFYGGHGIVGAQVPLGCGIAFAQK.Y	Carbamidomethyl: 19
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	241	585.28	1168.54	585.26	1168.51	2	19.31	15.5	28501	53	2	371 - 381	K.GFGTESFGPDR.K
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	198	424.74	847.46	424.73	847.44	2	14.76	14.4	4127	21	3	246 - 253	R.GDYVPGLK.V
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	365	654.35	1306.68	654.34	1306.66	2	15.18	19.3	5115	65	3	277 - 287	K.GPIILEMDTYR.Y
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	304	504.27	2013.07	504.27	2013.04	4	16.51	17.4	2899	41	3	271 - 287	K.QHALEKGPIILEMDTYR.Y
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	341	512.26	1533.75	512.25	1533.72	3	16.94	18.4	8178	43	3	126 - 139	R.GGSLHEVFSELMGR.Q	Oxidation: 12
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	385	742.37	2224.10	742.36	2224.05	3	18.53	19.8	11298	31	4	352 - 370	K.AKDCPMPEPSELFTNVYVK.G	Carbamidomethyl: 4
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	389	1021.48	2040.95	1021.47	2040.92	2	17.62	20.2	5891	20	2	354 - 370	K.DCPMPEPSELFTNVYVK.G	Oxidation: 4
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	336	481.01	1920.00	481.00	1919.97	4	15.58	18.3	7091	37	2	110 - 125	K.DAIITAYRDHCIFLGR.G	Carbamidomethyl: 11
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	235	677.36	2029.06	677.35	2029.03	3	16.78	15.4	7541	31	3	271 - 287	K.QHALEKGPIILEMDTYR.Y	Oxidation: 13
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	340	747.71	2240.09	747.69	2240.05	3	19.67	18.4	11339	67	3	352 - 370	K.AKDCPMPEPSELFTNVYVK.G	Oxidation: 6
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	55	430.73	859.44	430.72	859.43	2	11.25	10.5	35031	33	3	344 - 351	K.EVDDAIAK.A
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	344	767.88	1533.75	767.87	1533.72	2	17.38	18.5	30421	50	3	126 - 139	R.GGSLHEVFSELMGR.Q	Oxidation: 12
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	384	742.37	2224.10	742.36	2224.05	3	18.24	19.7	14923	48	4	352 - 370	K.AKDCPMPEPSELFTNVYVK.G	Carbamidomethyl: 4
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	181	534.76	1067.51	534.76	1067.50	2	16.87	14	3731	51	3	254 - 263	K.VDGMDAFAVK.Q	Oxidation: 4
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	201	424.74	847.46	424.73	847.44	2	14.67	14.5	23445	22	3	246 - 253	R.GDYVPGLK.V
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	7	537.57	1609.68	537.56	1609.66	3	15.28	8.8	3899	25	4	288 - 301	R.YHGHSMSDPGSTYR.T	Oxidation: 6
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	421	822.41	1642.81	822.40	1642.78	2	13.98	23.3	5218	117	3	51 - 64	R.SVESSSQELLDFFR.T
1053	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	176	649.32	1296.63	649.31	1296.61	2	15.74	13.9	11326	67	3	371 - 382	K.GFGTESFGPDRK.E
1279	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	214	578.79	1155.56	578.78	1155.55	2	8.32	14.6	16889	33	1	72 - 81	R.MEIAADSLYK.A	Oxidation: 1
1279	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	418	822.40	1642.79	822.40	1642.78	2	3.60	23.2	5376	79	1	51 - 64	R.SVESSSQELLDFFR.T
1279	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	6	537.56	1609.67	537.56	1609.66	3	7.61	8.6	9028	23	3	288 - 301	R.YHGHSMSDPGSTYR.T	Oxidation: 6
1279	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	7	537.56	1609.67	537.56	1609.66	3	4.38	8.6	4303	38	3	288 - 301	R.YHGHSMSDPGSTYR.T	Oxidation: 6
1279	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	28	516.78	1031.54	516.78	1031.54	2	3.32	9.8	4833	18	1	302 - 310	R.TRDEISGVR.Q
1279	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	180	433.21	1296.62	433.21	1296.61	3	6.91	13.8	21715	44	2	371 - 382	K.GFGTESFGPDRK.E
1279	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	178	433.21	1296.62	433.21	1296.61	3	8.90	13.8	32084	39	2	371 - 382	K.GFGTESFGPDRK.E
1279	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	8	537.56	1609.66	537.56	1609.66	3	3.46	8.7	6420	19	3	288 - 301	R.YHGHSMSDPGSTYR.T	Oxidation: 6
1279	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	181	649.32	1296.62	649.31	1296.61	2	6.92	13.8	9059	22	1	371 - 382	K.GFGTESFGPDRK.E
1337	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	342	526.75	1051.50	526.76	1051.50	2	-5.38	17	11688	40	1	254 - 263	K.VDGMDAFAVK.Q
1337	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	414	767.87	1533.72	767.87	1533.72	2	-3.51	18.7	15773	40	1	126 - 139	R.GGSLHEVFSELMGR.Q	Oxidation: 12
1337	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	131	463.71	925.41	463.71	925.41	2	-5.69	12.3	13827	33	1	148 - 155	K.GGSMHFYK.K
1337	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	290	585.26	1168.51	585.26	1168.51	2	-4.95	15.9	8625	46	1	371 - 381	K.GFGTESFGPDR.K
1337	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	212	409.23	1224.66	409.23	1224.67	3	-5.56	14.1	26674	33	2	322 - 332	K.LVLSHDLATEK.E
1337	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	593	548.60	1642.77	548.60	1642.78	3	-7.98	23.5	3948	64	2	51 - 64	R.SVESSSQELLDFFR.T
1337	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	335	662.33	1322.65	662.33	1322.65	2	-1.44	16.9	6408	67	2	277 - 287	K.GPIILEMDTYR.Y	Oxidation: 7
1337	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	250	578.78	1155.54	578.78	1155.55	2	-7.39	15	52782	53	2	72 - 81	R.MEIAADSLYK.A	Oxidation: 1
1337	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	461	884.10	2649.29	884.11	2649.30	3	-4.15	19.8	13629	18	2	157 - 182	K.ESSFYGGHGIVGAQVPLGCGIAFAQK.Y	Carbamidomethyl: 19
1337	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	260	461.75	921.48	461.75	921.49	2	-8.48	15.2	34257	36	1	110 - 117	K.DAIITAYR.D
1337	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	506	759.87	1517.72	759.87	1517.73	2	-5.79	21	16754	29	1	126 - 139	R.GGSLHEVFSELMGR.Q
1337	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	370	632.06	2524.20	632.06	2524.21	4	-2.30	17.7	23970	42	3	87 - 109	R.GFCHLYDGQEAVAIGMEAAITKK.D	Oxidation: 16
1337	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	208	409.23	1224.66	409.23	1224.67	3	-6.93	14.1	39064	42	2	322 - 332	K.LVLSHDLATEK.E
1337	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	8	537.56	1609.65	537.56	1609.66	3	-5.69	9	12402	27	4	288 - 301	R.YHGHSMSDPGSTYR.T	Oxidation: 6
1337	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	450	654.33	1306.65	654.34	1306.66	2	-8.97	19.5	5241	58	2	277 - 287	K.GPIILEMDTYR.Y
1337	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	507	506.91	1517.72	506.92	1517.73	3	-5.79	21	277803	47	3	126 - 139	R.GGSLHEVFSELMGR.Q
1337	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	319	570.78	1139.55	570.78	1139.55	2	-6.55	16.5	14414	52	2	72 - 81	R.MEIAADSLYK.A
1337	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	217	433.21	1296.60	433.21	1296.61	3	-5.27	14.3	43075	36	2	371 - 382	K.GFGTESFGPDRK.E
1337	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	43	516.77	1031.53	516.78	1031.54	2	-5.09	10.2	26950	19	2	302 - 310	R.TRDEISGVR.Q
1337	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	591	822.39	1642.77	822.40	1642.78	2	-6.58	23.5	24848	121	3	51 - 64	R.SVESSSQELLDFFR.T
1337	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	596	548.60	1642.77	548.60	1642.78	3	-6.63	23.6	6161	44	2	51 - 64	R.SVESSSQELLDFFR.T
1337	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	9	537.56	1609.65	537.56	1609.66	3	-5.35	9	14573	32	4	288 - 301	R.YHGHSMSDPGSTYR.T	Oxidation: 6
1337	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	66	430.72	859.42	430.72	859.43	2	-8.76	10.8	10417	31	3	344 - 351	K.EVDDAIAK.A
1337	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	592	822.39	1642.77	822.40	1642.78	2	-7.99	23.5	9885	127	3	51 - 64	R.SVESSSQELLDFFR.T
1337	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	210	613.34	1224.66	613.34	1224.67	2	-6.94	14.1	12358	38	1	322 - 332	K.LVLSHDLATEK.E
1337	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	7	537.56	1609.65	537.56	1609.66	3	-3.85	9	6448	26	4	288 - 301	R.YHGHSMSDPGSTYR.T	Oxidation: 6
1337	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	373	632.06	2524.20	632.06	2524.21	4	-2.93	17.8	28580	43	3	87 - 109	R.GFCHLYDGQEAVAIGMEAAITKK.D	Oxidation: 16
1337	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	503	506.91	1517.72	506.92	1517.73	3	-7.07	20.9	11848	29	3	126 - 139	R.GGSLHEVFSELMGR.Q
1337	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	71	430.72	859.42	430.72	859.43	2	-7.16	10.9	26243	37	3	344 - 351	K.EVDDAIAK.A
1337	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	322	570.78	1139.54	570.78	1139.55	2	-7.72	16.6	5306	61	2	72 - 81	R.MEIAADSLYK.A
1337	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	221	534.75	1067.49	534.76	1067.50	2	-6.86	14.3	22215	47	2	254 - 263	K.VDGMDAFAVK.Q	Oxidation: 4
1337	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	595	822.39	1642.77	822.40	1642.78	2	-6.64	23.6	8625	108	3	51 - 64	R.SVESSSQELLDFFR.T
1337	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	267	432.89	1295.65	432.89	1295.65	3	-5.72	15.3	15987	39	1	71 - 81	R.RMEIAADSLYK.A
1337	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	459	884.10	2649.29	884.11	2649.30	3	-4.79	19.7	7963	29	2	157 - 182	K.ESSFYGGHGIVGAQVPLGCGIAFAQK.Y	Carbamidomethyl: 19
1337	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	249	578.78	1155.54	578.78	1155.55	2	-7.14	14.9	18027	50	2	72 - 81	R.MEIAADSLYK.A	Oxidation: 1
1337	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	239	424.73	847.44	424.73	847.44	2	-7.89	14.7	32699	20	1	246 - 253	R.GDYVPGLK.V
1337	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	41	516.77	1031.53	516.78	1031.54	2	-5.75	10.2	10141	17	2	302 - 310	R.TRDEISGVR.Q
1337	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	68	430.72	859.42	430.72	859.43	2	-7.85	10.8	28580	36	3	344 - 351	K.EVDDAIAK.A
1337	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	417	512.25	1533.72	512.25	1533.72	3	-4.49	18.8	6080	38	2	126 - 139	R.GGSLHEVFSELMGR.Q	Oxidation: 12
1337	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	190	438.22	1311.64	438.22	1311.65	3	-6.40	13.6	27931	47	1	71 - 81	R.RMEIAADSLYK.A	Oxidation: 2
1337	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	504	506.91	1517.72	506.92	1517.73	3	-6.40	20.9	57841	32	3	126 - 139	R.GGSLHEVFSELMGR.Q
1337	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	219	649.31	1296.60	649.31	1296.61	2	-5.27	14.3	21904	46	2	371 - 382	K.GFGTESFGPDRK.E
1337	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	216	649.31	1296.60	649.31	1296.61	2	-4.90	14.2	18543	57	2	371 - 382	K.GFGTESFGPDRK.E
1337	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	409	640.99	1919.96	641.00	1919.97	3	-4.49	18.6	18720	33	1	110 - 125	K.DAIITAYRDHCIFLGR.G	Carbamidomethyl: 11
1337	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	19	494.77	987.52	494.77	987.52	2	-6.66	9.5	9596	50	1	343 - 351	R.KEVDDAIAK.A
1337	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	225	534.75	1067.49	534.76	1067.50	2	-6.15	14.4	23549	33	2	254 - 263	K.VDGMDAFAVK.Q	Oxidation: 4
1337	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	10	537.56	1609.65	537.56	1609.66	3	-4.46	9.1	9791	25	4	288 - 301	R.YHGHSMSDPGSTYR.T	Oxidation: 6
1337	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	413	512.25	1533.72	512.25	1533.72	3	-3.50	18.7	26968	44	2	126 - 139	R.GGSLHEVFSELMGR.Q	Oxidation: 12
1337	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	215	433.21	1296.60	433.21	1296.61	3	-4.90	14.2	38249	35	2	371 - 382	K.GFGTESFGPDRK.E
1337	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	337	662.33	1322.65	662.33	1322.65	2	-4.25	16.9	4920	66	2	277 - 287	K.GPIILEMDTYR.Y	Oxidation: 7
1337	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	411	481.00	1919.96	481.00	1919.97	4	-4.09	18.6	22487	30	1	110 - 125	K.DAIITAYRDHCIFLGR.G	Carbamidomethyl: 11
1337	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	175	502.78	1003.54	502.78	1003.55	2	-7.63	13.3	22622	48	1	245 - 253	K.RGDYVPGLK.V
1337	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	369	632.06	2524.20	632.06	2524.21	4	-3.69	17.7	20702	54	3	87 - 109	R.GFCHLYDGQEAVAIGMEAAITKK.D	Oxidation: 16
1337	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	192	656.83	1311.64	656.83	1311.65	2	-6.41	13.7	18145	24	1	71 - 81	R.RMEIAADSLYK.A	Oxidation: 2
1337	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	453	654.33	1306.65	654.34	1306.66	2	-9.07	19.6	3862	50	2	277 - 287	K.GPIILEMDTYR.Y
1393	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	139	438.22	1311.65	438.22	1311.65	3	2.50	13.5	9256	42	1	71 - 81	R.RMEIAADSLYK.A	Oxidation: 2
1393	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	159	409.23	1224.67	409.23	1224.67	3	1.03	13.9	8032	37	2	322 - 332	K.LVLSHDLATEK.E
1393	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	362	512.25	1533.73	512.25	1533.72	3	3.53	18.6	8398	40	2	126 - 139	R.GGSLHEVFSELMGR.Q	Oxidation: 12
1393	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	204	578.78	1155.55	578.78	1155.55	2	1.58	14.9	138835	24	2	72 - 81	R.MEIAADSLYK.A	Oxidation: 1
1393	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	164	433.21	1296.62	433.21	1296.61	3	5.60	14	5443	43	1	371 - 382	K.GFGTESFGPDRK.E
1393	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	364	767.87	1533.73	767.87	1533.72	2	3.54	18.6	11306	24	1	126 - 139	R.GGSLHEVFSELMGR.Q	Oxidation: 12
1393	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	237	585.27	1168.52	585.26	1168.51	2	5.59	15.7	119318	26	1	371 - 381	K.GFGTESFGPDR.K
1393	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	161	409.23	1224.67	409.23	1224.67	3	1.84	14	4138	30	2	322 - 332	K.LVLSHDLATEK.E
1393	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	322	632.06	2524.22	632.06	2524.21	4	4.99	17.6	6318	50	2	87 - 109	R.GFCHLYDGQEAVAIGMEAAITKK.D	Oxidation: 16
1393	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	200	578.78	1155.55	578.78	1155.55	2	1.06	14.8	12742	51	2	72 - 81	R.MEIAADSLYK.A	Oxidation: 1
1393	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	403	654.34	1306.66	654.34	1306.66	2	-0.93	19.5	4736	57	1	277 - 287	K.GPIILEMDTYR.Y
1393	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	324	632.06	2524.22	632.06	2524.21	4	5.97	17.7	16241	42	2	87 - 109	R.GFCHLYDGQEAVAIGMEAAITKK.D	Oxidation: 16
1393	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	366	512.25	1533.73	512.25	1533.72	3	2.30	18.7	16454	39	2	126 - 139	R.GGSLHEVFSELMGR.Q	Oxidation: 12
1393	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	496	822.40	1642.79	822.40	1642.78	2	0.74	23.5	2294	72	1	51 - 64	R.SVESSSQELLDFFR.T
1393	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	287	662.34	1322.66	662.33	1322.65	2	4.37	16.8	3733	56	1	277 - 287	K.GPIILEMDTYR.Y	Oxidation: 7
1393	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	19	516.78	1031.54	516.78	1031.54	2	0.87	10.2	16241	27	1	302 - 310	R.TRDEISGVR.Q
1448	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	286	432.89	1295.65	432.89	1295.65	3	-2.05	14.9	37597	48	1	71 - 81	R.RMEIAADSLYK.A
1448	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	440	512.25	1533.73	512.25	1533.72	3	1.50	18.4	28560	41	2	126 - 139	R.GGSLHEVFSELMGR.Q	Oxidation: 12
1448	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	475	654.33	1306.66	654.34	1306.66	2	-2.87	19.2	389435	57	2	277 - 287	K.GPIILEMDTYR.Y
1448	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	84	430.72	859.43	430.72	859.43	2	-3.16	10.4	21835	39	3	344 - 351	K.EVDDAIAK.A
1448	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	277	461.75	921.49	461.75	921.49	2	-4.02	14.7	85427	46	2	110 - 117	K.DAIITAYR.D
1448	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	11	537.56	1609.66	537.56	1609.66	3	0.95	8.7	4620	31	3	288 - 301	R.YHGHSMSDPGSTYR.T	Oxidation: 6
1448	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	233	433.21	1296.61	433.21	1296.61	3	-0.61	13.7	66757	42	2	371 - 382	K.GFGTESFGPDRK.E
1448	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	473	654.33	1306.65	654.34	1306.66	2	-5.39	19.1	31394	50	2	277 - 287	K.GPIILEMDTYR.Y
1448	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	637	548.60	1642.78	548.60	1642.78	3	-0.47	23.3	3715	37	2	51 - 64	R.SVESSSQELLDFFR.T
1448	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	241	534.75	1067.49	534.76	1067.50	2	-2.77	13.9	75021	44	2	254 - 263	K.VDGMDAFAVK.Q	Oxidation: 4
1448	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	81	430.72	859.43	430.72	859.43	2	-3.81	10.3	86415	39	3	344 - 351	K.EVDDAIAK.A
1448	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	236	433.21	1296.61	433.21	1296.61	3	0.31	13.8	249877	34	2	371 - 382	K.GFGTESFGPDRK.E
1448	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	352	662.33	1322.65	662.33	1322.65	2	-0.84	16.4	58984	56	2	277 - 287	K.GPIILEMDTYR.Y	Oxidation: 7
1448	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	212	438.22	1311.65	438.22	1311.65	3	-1.66	13.3	187577	31	1	71 - 81	R.RMEIAADSLYK.A	Oxidation: 2
1448	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	150	463.71	925.41	463.71	925.41	2	0.50	11.9	58468	40	1	148 - 155	K.GGSMHFYK.K
1448	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	28	494.77	987.52	494.77	987.52	2	-3.38	9.1	31458	50	1	343 - 351	R.KEVDDAIAK.A
1448	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	281	461.75	921.49	461.75	921.49	2	-4.30	14.8	137154	18	2	110 - 117	K.DAIITAYR.D
1448	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	633	822.40	1642.78	822.40	1642.78	2	-0.11	23.3	3381	112	3	51 - 64	R.SVESSSQELLDFFR.T
1448	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	634	548.60	1642.78	548.60	1642.78	3	-0.11	23.3	5448	67	2	51 - 64	R.SVESSSQELLDFFR.T
1448	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	9	537.56	1609.66	537.56	1609.66	3	1.62	8.6	5842	34	3	288 - 301	R.YHGHSMSDPGSTYR.T	Oxidation: 6
1448	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	80	430.72	859.42	430.72	859.43	2	-5.14	10.3	309201	39	3	344 - 351	K.EVDDAIAK.A
1448	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	225	409.23	1224.67	409.23	1224.67	3	-0.85	13.6	913759	41	2	322 - 332	K.LVLSHDLATEK.E
1448	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	636	822.40	1642.78	822.40	1642.78	2	-0.47	23.3	4762	67	3	51 - 64	R.SVESSSQELLDFFR.T
1448	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	437	512.25	1533.72	512.25	1533.72	3	-0.69	18.3	157524	40	2	126 - 139	R.GGSLHEVFSELMGR.Q	Oxidation: 12
1448	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	434	640.99	1919.96	641.00	1919.97	3	-2.88	18.2	56944	20	1	110 - 125	K.DAIITAYRDHCIFLGR.G	Carbamidomethyl: 11
1448	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	37	521.77	1041.52	521.77	1041.52	2	0.48	9.3	3975	18	1	311 - 318	R.QERDPIER.I
1448	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	238	534.75	1067.49	534.76	1067.50	2	-1.87	13.8	74532	44	2	254 - 263	K.VDGMDAFAVK.Q	Oxidation: 4
1448	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	12	403.42	1609.66	403.42	1609.66	4	0.95	8.7	7845	30	1	288 - 301	R.YHGHSMSDPGSTYR.T	Oxidation: 6
1448	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	355	662.33	1322.65	662.33	1322.65	2	-1.84	16.5	298878	46	2	277 - 287	K.GPIILEMDTYR.Y	Oxidation: 7
1448	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	8	537.56	1609.66	537.56	1609.66	3	0.97	8.6	7447	27	3	288 - 301	R.YHGHSMSDPGSTYR.T	Oxidation: 6
1448	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	540	506.92	1517.73	506.92	1517.73	3	-2.06	20.6	22285	37	2	126 - 139	R.GGSLHEVFSELMGR.Q
1448	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	228	409.23	1224.67	409.23	1224.67	3	-1.56	13.6	208660	47	2	322 - 332	K.LVLSHDLATEK.E
1448	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	52	516.77	1031.53	516.78	1031.54	2	-3.64	9.7	45467	30	1	302 - 310	R.TRDEISGVR.Q
1448	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	543	506.92	1517.73	506.92	1517.73	3	-1.03	20.7	74532	39	2	126 - 139	R.GGSLHEVFSELMGR.Q
1448	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	268	578.78	1155.55	578.78	1155.55	2	-1.22	14.5	16741	65	1	72 - 81	R.MEIAADSLYK.A	Oxidation: 1
1448	AT1G59900.1	E1 alpha-1 (pyruvate dehydrogenase)	pyruvate dehydrogenase complex	c) pyruvate metabolism & TCA cycle	mitochondria	631	822.40	1642.78	822.40	1642.78	2	-0.84	23.2	7602	93	3	51 - 64	R.SVESSSQELLDFFR.T
1220	AT4G36400.1	(D)-2-hydroxyglutarate dehydrogenase	amino acid metabolism	g) other metabolic pathways	mitochondrion	294	554.29	1106.56	554.29	1106.56	2	0.05	17.4	4111	25	1	89 - 98	R.NPLFSSLDSK.D
1220	AT4G36400.1	(D)-2-hydroxyglutarate dehydrogenase	amino acid metabolism	g) other metabolic pathways	mitochondrion	156	443.27	884.53	443.27	884.53	2	0.44	13.8	15073	44	3	302 - 309	K.VSILTQPK.L
1220	AT4G36400.1	(D)-2-hydroxyglutarate dehydrogenase	amino acid metabolism	g) other metabolic pathways	mitochondrion	192	402.73	803.45	402.73	803.45	2	0.71	14.6	4428	29	1	544 - 550	K.GILNPYK.V
1220	AT4G36400.1	(D)-2-hydroxyglutarate dehydrogenase	amino acid metabolism	g) other metabolic pathways	mitochondrion	306	519.96	1556.86	519.96	1556.86	3	4.04	17.7	4300	78	1	287 - 301	K.HLFIGSEGSLGIVTK.V
1220	AT4G36400.1	(D)-2-hydroxyglutarate dehydrogenase	amino acid metabolism	g) other metabolic pathways	mitochondrion	146	419.91	1256.71	419.91	1256.71	3	1.65	13.6	11270	36	2	421 - 431	R.IREGITEALQK.A
1220	AT4G36400.1	(D)-2-hydroxyglutarate dehydrogenase	amino acid metabolism	g) other metabolic pathways	mitochondrion	153	443.28	884.54	443.27	884.53	2	3.82	13.7	7142	42	3	302 - 309	K.VSILTQPK.L
1220	AT4G36400.1	(D)-2-hydroxyglutarate dehydrogenase	amino acid metabolism	g) other metabolic pathways	mitochondrion	150	443.28	884.54	443.27	884.53	2	4.07	13.7	5451	38	3	302 - 309	K.VSILTQPK.L
1220	AT4G36400.1	(D)-2-hydroxyglutarate dehydrogenase	amino acid metabolism	g) other metabolic pathways	mitochondrion	93	552.94	1655.79	552.93	1655.78	3	7.51	12.2	5005	41	1	230 - 246	K.GSCHIGGNVSTNAGGLR.L	Carbamidomethyl: 3
1220	AT4G36400.1	(D)-2-hydroxyglutarate dehydrogenase	amino acid metabolism	g) other metabolic pathways	mitochondrion	143	419.91	1256.71	419.91	1256.71	3	4.15	13.5	29623	37	2	421 - 431	R.IREGITEALQK.A
1220	AT4G36400.1	(D)-2-hydroxyglutarate dehydrogenase	amino acid metabolism	g) other metabolic pathways	mitochondrion	145	629.36	1256.71	629.36	1256.71	2	4.16	13.5	26905	23	1	421 - 431	R.IREGITEALQK.A
1220	AT4G36400.1	(D)-2-hydroxyglutarate dehydrogenase	amino acid metabolism	g) other metabolic pathways	mitochondrion	81	434.56	1300.65	434.56	1300.64	3	5.67	11.9	4065	21	2	505 - 517	R.GSISAEHGLGVMK.A	Oxidation: 12
1220	AT4G36400.1	(D)-2-hydroxyglutarate dehydrogenase	amino acid metabolism	g) other metabolic pathways	mitochondrion	170	486.25	970.48	486.25	970.48	2	6.59	14.1	8161	31	1	518 - 525	K.ANEIFYSK.S
1220	AT4G36400.1	(D)-2-hydroxyglutarate dehydrogenase	amino acid metabolism	g) other metabolic pathways	mitochondrion	243	631.83	1261.65	631.84	1261.66	2	-7.11	16.1	3641	22	1	526 - 537	K.SPETVALMASIK.K	Oxidation: 8
1220	AT4G36400.1	(D)-2-hydroxyglutarate dehydrogenase	amino acid metabolism	g) other metabolic pathways	mitochondrion	83	651.33	1300.65	651.33	1300.64	2	5.67	12	7123	25	1	505 - 517	R.GSISAEHGLGVMK.A	Oxidation: 12
1220	AT4G36400.1	(D)-2-hydroxyglutarate dehydrogenase	amino acid metabolism	g) other metabolic pathways	mitochondrion	79	434.56	1300.65	434.56	1300.64	3	3.37	11.9	15489	35	2	505 - 517	R.GSISAEHGLGVMK.A	Oxidation: 12
361	AT5G67590.1	18 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	67	523.81	1045.61	523.82	1045.63	2	-14.90	14.4	8009	23	1	53 - 61	R.KVIIYSPAR.T
361	AT5G67590.1	18 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	71	612.32	1222.63	612.32	1222.63	2	-1.17	14.6	6103	24	2	42 - 52	K.VSGIPEEHLSR.K
361	AT5G67590.1	18 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	73	612.32	1222.63	612.32	1222.63	2	-4.35	14.6	7436	18	2	42 - 52	K.VSGIPEEHLSR.K
208	AT4G02580.1	24 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	192	688.83	1375.65	688.84	1375.67	2	-9.53	16.86608333	4410	33	1	59 - 69	K.EILSYYPSNYK.Q
208	AT4G02580.1	24 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	170	535.28	1602.81	535.28	1602.83	3	-10.89	16.017775	5352	40	1	57 - 69	K.VKEILSYYPSNYK.Q
208	AT4G02580.1	24 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	68	408.24	814.47	408.25	814.48	2	-13.19	12.34278333	9419	47	1	206 - 212	K.VVEIVEK.L
208	AT4G02580.1	24 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	165	461.59	1381.76	461.60	1381.77	3	-11.64	15.81565	5342	15	1	239 - 250	K.TLLGEPKPPQFR.D
740	AT4G02580.1	24 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	27	408.24	814.47	408.25	814.48	2	-7.98	12.4	4249	26	1	206 - 212	K.VVEIVEK.L
740	AT4G02580.1	24 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	111	535.28	1602.82	535.28	1602.83	3	-8.37	16	4046	23	1	57 - 69	K.VKEILSYYPSNYK.Q
740	AT4G02580.1	24 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	206	705.38	1408.75	705.39	1408.76	2	-4.94	21.6	3546	18	1	142 - 154	R.DIESALLDHLGVK.R
740	AT4G02580.1	24 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	86	448.78	895.54	448.78	895.55	2	-11.05	15.1	3238	15	1	99 - 106	K.VIEVAPIR.V
795	AT4G02580.1	24 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	107	448.78	895.54	448.78	895.55	2	-10.40	15.5	5527	49	2	99 - 106	K.VIEVAPIR.V
795	AT4G02580.1	24 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	108	448.78	895.54	448.78	895.55	2	-11.87	15.6	7139	33	2	99 - 106	K.VIEVAPIR.V
795	AT4G02580.1	24 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	128	461.59	1381.76	461.60	1381.77	3	-6.31	16.2	5501	16	1	239 - 250	K.TLLGEPKPPQFR.D
893	AT4G02580.1	24 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	81	535.28	1602.82	535.28	1602.83	3	-7.19	16.2	3977	44	3	57 - 69	K.VKEILSYYPSNYK.Q
893	AT4G02580.1	24 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	82	535.28	1602.82	535.28	1602.83	3	-7.70	16.3	9752	38	3	57 - 69	K.VKEILSYYPSNYK.Q
893	AT4G02580.1	24 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	65	448.78	895.54	448.78	895.55	2	-10.33	15.1	13138	50	3	99 - 106	K.VIEVAPIR.V
893	AT4G02580.1	24 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	84	802.42	1602.82	802.42	1602.83	2	-7.70	16.3	3547	35	1	57 - 69	K.VKEILSYYPSNYK.Q
893	AT4G02580.1	24 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	160	522.62	1564.84	522.63	1564.86	3	-8.49	20.6	4451	29	2	142 - 155	R.DIESALLDHLGVKR.G
893	AT4G02580.1	24 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	172	470.59	1408.74	470.59	1408.76	3	-10.53	21.9	11048	53	2	142 - 154	R.DIESALLDHLGVK.R
893	AT4G02580.1	24 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	171	705.38	1408.74	705.39	1408.76	2	-9.96	21.9	7626	62	2	142 - 154	R.DIESALLDHLGVK.R
893	AT4G02580.1	24 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	103	688.84	1375.66	688.84	1375.67	2	-7.17	17	4484	55	2	59 - 69	K.EILSYYPSNYK.Q
893	AT4G02580.1	24 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	170	470.59	1408.74	470.59	1408.76	3	-9.95	21.8	8390	43	2	142 - 154	R.DIESALLDHLGVK.R
893	AT4G02580.1	24 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	173	705.38	1408.74	705.39	1408.76	2	-10.54	21.9	10687	34	2	142 - 154	R.DIESALLDHLGVK.R
893	AT4G02580.1	24 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	64	448.78	895.54	448.78	895.55	2	-13.34	15.1	4189	42	3	99 - 106	K.VIEVAPIR.V
893	AT4G02580.1	24 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	10	408.24	814.47	408.25	814.48	2	-11.65	12.5	21228	42	2	206 - 212	K.VVEIVEK.L
893	AT4G02580.1	24 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	69	448.78	895.54	448.78	895.55	2	-11.02	15.2	14694	55	3	99 - 106	K.VIEVAPIR.V
893	AT4G02580.1	24 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	161	522.62	1564.84	522.63	1564.86	3	-11.13	20.6	4966	17	2	142 - 155	R.DIESALLDHLGVKR.G
893	AT4G02580.1	24 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	9	408.24	814.47	408.25	814.48	2	-11.04	12.4	11613	38	2	206 - 212	K.VVEIVEK.L
893	AT4G02580.1	24 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	104	688.84	1375.66	688.84	1375.67	2	-7.36	17.1	6131	46	2	59 - 69	K.EILSYYPSNYK.Q
893	AT4G02580.1	24 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	85	535.28	1602.82	535.28	1602.83	3	-7.42	16.3	12702	32	3	57 - 69	K.VKEILSYYPSNYK.Q
893	AT4G02580.1	24 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	74	461.59	1381.76	461.60	1381.77	3	-11.20	15.9	5668	27	1	239 - 250	K.TLLGEPKPPQFR.D
949	AT4G02580.1	24 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	22	408.25	814.48	408.25	814.48	2	1.92	12.6	11651	42	3	206 - 212	K.VVEIVEK.L
949	AT4G02580.1	24 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	120	535.29	1602.84	535.28	1602.83	3	8.35	16.5	14450	54	3	57 - 69	K.VKEILSYYPSNYK.Q
949	AT4G02580.1	24 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	236	705.39	1408.77	705.39	1408.76	2	6.45	22.2	14263	48	3	142 - 154	R.DIESALLDHLGVK.R
949	AT4G02580.1	24 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	119	535.29	1602.84	535.28	1602.83	3	9.42	16.4	4687	46	3	57 - 69	K.VKEILSYYPSNYK.Q
949	AT4G02580.1	24 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	138	688.85	1375.68	688.84	1375.67	2	8.34	17.2	7258	42	3	59 - 69	K.EILSYYPSNYK.Q
949	AT4G02580.1	24 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	94	448.78	895.55	448.78	895.55	2	3.59	15.4	28600	54	4	99 - 106	K.VIEVAPIR.V
949	AT4G02580.1	24 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	92	448.78	895.55	448.78	895.55	2	5.78	15.4	52896	41	4	99 - 106	K.VIEVAPIR.V
949	AT4G02580.1	24 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	24	408.25	814.48	408.25	814.48	2	3.24	12.6	39667	42	3	206 - 212	K.VVEIVEK.L
949	AT4G02580.1	24 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	219	522.63	1564.87	522.63	1564.86	3	7.64	20.8	4287	51	2	142 - 155	R.DIESALLDHLGVKR.G
949	AT4G02580.1	24 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	139	688.85	1375.68	688.84	1375.67	2	11.70	17.2	6925	32	3	59 - 69	K.EILSYYPSNYK.Q
949	AT4G02580.1	24 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	122	579.62	1735.84	579.61	1735.82	3	8.38	16.5	4193	29	1	125 - 138	K.YHLLVCGTTPCMIR.G	Oxidation: 12
949	AT4G02580.1	24 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	232	470.59	1408.76	470.59	1408.76	3	4.88	22.1	9579	56	3	142 - 154	R.DIESALLDHLGVK.R
949	AT4G02580.1	24 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	121	802.43	1602.84	802.42	1602.83	2	8.35	16.5	5203	16	1	57 - 69	K.VKEILSYYPSNYK.Q
949	AT4G02580.1	24 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	216	821.89	1641.77	821.88	1641.75	2	11.31	20.4	4581	41	3	107 - 119	R.VYEVATFYSMFNR.A	Oxidation: 10
949	AT4G02580.1	24 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	112	461.60	1381.78	461.60	1381.77	3	7.75	16.2	20785	42	3	239 - 250	K.TLLGEPKPPQFR.D
949	AT4G02580.1	24 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	233	705.39	1408.77	705.39	1408.76	2	6.29	22.1	22388	76	3	142 - 154	R.DIESALLDHLGVK.R
949	AT4G02580.1	24 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	90	448.78	895.55	448.78	895.55	2	3.30	15.3	8915	46	4	99 - 106	K.VIEVAPIR.V
949	AT4G02580.1	24 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	110	461.60	1381.78	461.60	1381.77	3	8.99	16.1	12116	54	3	239 - 250	K.TLLGEPKPPQFR.D
949	AT4G02580.1	24 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	91	448.79	895.56	448.78	895.55	2	7.18	15.3	47701	47	4	99 - 106	K.VIEVAPIR.V
949	AT4G02580.1	24 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	123	535.29	1602.84	535.28	1602.83	3	8.50	16.5	8406	38	3	57 - 69	K.VKEILSYYPSNYK.Q
949	AT4G02580.1	24 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	234	470.60	1408.77	470.59	1408.76	3	6.28	22.1	20964	58	3	142 - 154	R.DIESALLDHLGVK.R
949	AT4G02580.1	24 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	235	470.60	1408.77	470.59	1408.76	3	6.43	22.2	14978	66	3	142 - 154	R.DIESALLDHLGVK.R
949	AT4G02580.1	24 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	115	461.60	1381.78	461.60	1381.77	3	5.33	16.2	11568	36	3	239 - 250	K.TLLGEPKPPQFR.D
949	AT4G02580.1	24 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	217	821.89	1641.77	821.88	1641.75	2	10.86	20.4	6599	65	3	107 - 119	R.VYEVATFYSMFNR.A	Oxidation: 10
949	AT4G02580.1	24 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	218	821.89	1641.76	821.88	1641.75	2	8.39	20.5	7964	84	3	107 - 119	R.VYEVATFYSMFNR.A	Oxidation: 10
949	AT4G02580.1	24 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	137	688.85	1375.68	688.84	1375.67	2	10.92	17.1	4146	50	3	59 - 69	K.EILSYYPSNYK.Q
949	AT4G02580.1	24 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	231	705.39	1408.76	705.39	1408.76	2	4.89	22.1	10913	83	3	142 - 154	R.DIESALLDHLGVK.R
949	AT4G02580.1	24 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	220	522.63	1564.87	522.63	1564.86	3	5.17	20.8	5914	19	2	142 - 155	R.DIESALLDHLGVKR.G
949	AT4G02580.1	24 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	26	408.25	814.48	408.25	814.48	2	3.83	12.7	30697	37	3	206 - 212	K.VVEIVEK.L
1010	AT4G02580.1	24 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	165	470.60	1408.78	470.59	1408.76	3	16.12	21.4	8357	17	1	142 - 154	R.DIESALLDHLGVK.R
1010	AT4G02580.1	24 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	72	448.79	895.56	448.78	895.55	2	15.38	14.8	3411	20	1	99 - 106	K.VIEVAPIR.V
1010	AT4G02580.1	24 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	164	705.40	1408.78	705.39	1408.76	2	16.13	21.4	15224	50	1	142 - 154	R.DIESALLDHLGVK.R
111	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	201	991.82	2972.44	991.83	2972.46	3	-7.48	18.9	15821	31	2	201 - 228	K.AAAEEAVLNALPEATIMRPATMIGTEDR.I	Oxidation: 17
111	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	142	652.33	1302.65	652.34	1302.67	2	-10.95	16.5	7800	27	1	111 - 122	K.LMGDLGQVVPMK.F	Oxidation: 2
111	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	192	534.82	1067.63	534.83	1067.65	2	-12.45	18.6	31941	52	2	138 - 147	K.ANVVINLIGR.E
111	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	230	662.36	1322.71	662.37	1322.72	2	-7.80	21.4	68622	59	3	240 - 252	K.YGFLPLIGGGTTK.F
111	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	143	570.95	1709.83	570.95	1709.84	3	-7.72	16.6	5932	85	2	180 - 195	R.YIQVSCLGASVSSPSR.M	Carbamidomethyl: 6
111	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	176	567.30	1132.59	567.31	1132.61	2	-12.14	17.9	21554	78	3	91 - 100	K.MGSQVLVPFR.G
111	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	102	626.64	1876.89	626.64	1876.91	3	-8.33	15.2	7785	40	3	91 - 107	K.MGSQVLVPFRGSEDSPR.H	Oxidation: 1
111	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	220	625.83	1249.64	625.83	1249.65	2	-9.90	21	3803	22	2	229 - 238	R.ILNPWSMFVK.K	Oxidation: 7
111	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	98	481.78	961.55	481.79	961.56	2	-12.41	15.1	107057	41	2	83 - 90	R.YLVQQLAK.M
111	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	147	612.31	1833.89	612.31	1833.91	3	-9.63	16.7	4019	30	2	111 - 126	K.LMGDLGQVVPMKFDPR.D	Oxidation: 2
111	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	95	481.78	961.54	481.79	961.56	2	-16.75	15	8266	25	2	83 - 90	R.YLVQQLAK.M
111	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	203	852.41	851.40	852.41	851.41	1	-9.73	19	10343	20	1	396 - 402	K.IPTDFYP.-
111	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	227	692.86	1383.71	692.87	1383.72	2	-8.39	21.2	4152	50	3	372 - 382	K.GYPVEFLIQYR.K
111	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	144	855.92	1709.83	855.93	1709.84	2	-7.76	16.6	20125	124	2	180 - 195	R.YIQVSCLGASVSSPSR.M	Carbamidomethyl: 6
111	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	200	582.98	1745.93	582.99	1745.94	3	-9.48	18.9	35469	41	1	138 - 152	K.ANVVINLIGREYETR.N
111	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	229	692.86	1383.71	692.87	1383.72	2	-8.20	21.3	15645	54	3	372 - 382	K.GYPVEFLIQYR.K
111	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	44	590.28	1178.55	590.29	1178.56	2	-9.28	12.9	13840	49	2	384 - 395	K.GGPNFGSTVSEK.I
111	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	217	542.63	1624.88	542.64	1624.90	3	-10.54	20.1	5101	38	2	370 - 382	K.LKGYPVEFLIQYR.K
111	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	64	553.58	1657.73	553.59	1657.75	3	-9.94	13.9	26449	34	1	153 - 166	R.NFSFEDANHHIAEK.L
111	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	231	692.86	1383.71	692.87	1383.72	2	-7.50	21.4	38870	58	3	372 - 382	K.GYPVEFLIQYR.K
111	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	22	436.55	1306.64	436.56	1306.65	3	-9.63	11.4	4548	32	1	383 - 395	R.KGGPNFGSTVSEK.I
111	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	219	813.45	1624.88	813.46	1624.90	2	-8.62	20.2	7052	37	1	370 - 382	K.LKGYPVEFLIQYR.K
111	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	189	534.82	1067.63	534.83	1067.65	2	-9.95	18.5	36516	52	2	138 - 147	K.ANVVINLIGR.E
111	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	175	567.30	1132.59	567.31	1132.61	2	-10.41	17.9	18022	72	3	91 - 100	K.MGSQVLVPFR.G
111	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	20	654.33	1306.64	654.33	1306.65	2	-9.65	11.3	5902	21	1	383 - 395	R.KGGPNFGSTVSEK.I
111	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	202	744.12	2972.44	744.12	2972.46	4	-7.48	18.9	12832	28	2	201 - 228	K.AAAEEAVLNALPEATIMRPATMIGTEDR.I	Oxidation: 17
111	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	184	644.34	1286.66	644.34	1286.67	2	-13.10	18.3	4882	35	1	111 - 122	K.LMGDLGQVVPMK.F
111	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	221	625.83	1249.64	625.83	1249.65	2	-8.76	21	8865	24	2	229 - 238	R.ILNPWSMFVK.K	Oxidation: 7
111	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	174	567.30	1132.59	567.31	1132.61	2	-14.96	17.9	4643	78	3	91 - 100	K.MGSQVLVPFR.G
111	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	37	614.41	613.41	614.42	613.42	1	-17.34	12.7	6746	35	1	167 - 172	K.LALVAK.E
111	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	156	575.30	1148.59	575.31	1148.60	2	-11.58	17	5029	68	2	91 - 100	K.MGSQVLVPFR.G	Oxidation: 1
111	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	65	415.44	1657.73	415.44	1657.75	4	-9.93	13.9	13757	37	1	153 - 166	R.NFSFEDANHHIAEK.L
111	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	12	553.75	1105.49	553.76	1105.51	2	-11.18	10.4	4658	65	2	219 - 228	R.PATMIGTEDR.I	Oxidation: 4
111	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	11	553.75	1105.49	553.76	1105.51	2	-12.99	10.4	4034	46	2	219 - 228	R.PATMIGTEDR.I	Oxidation: 4
111	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	97	660.33	1318.65	660.34	1318.66	2	-10.97	15	7324	22	3	111 - 122	K.LMGDLGQVVPMK.F	Oxidation: 2
111	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	133	606.32	1210.62	606.32	1210.63	2	-12.65	16.3	12871	33	1	360 - 369	K.FQDLDLVPHK.L
111	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	145	570.95	1709.83	570.95	1709.84	3	-7.75	16.6	10288	48	2	180 - 195	R.YIQVSCLGASVSSPSR.M	Carbamidomethyl: 6
111	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	157	575.30	1148.59	575.31	1148.60	2	-9.93	17	49773	65	2	91 - 100	K.MGSQVLVPFR.G	Oxidation: 1
111	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	141	855.92	1709.83	855.93	1709.84	2	-7.72	16.5	13718	124	2	180 - 195	R.YIQVSCLGASVSSPSR.M	Carbamidomethyl: 6
111	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	197	991.82	2972.44	991.83	2972.46	3	-7.36	18.8	6594	32	2	201 - 228	K.AAAEEAVLNALPEATIMRPATMIGTEDR.I	Oxidation: 17
111	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	198	744.12	2972.44	744.12	2972.46	4	-7.36	18.8	6339	38	2	201 - 228	K.AAAEEAVLNALPEATIMRPATMIGTEDR.I	Oxidation: 17
111	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	106	626.64	1876.89	626.64	1876.91	3	-9.59	15.3	10002	37	3	91 - 107	K.MGSQVLVPFRGSEDSPR.H	Oxidation: 1
111	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	90	660.33	1318.65	660.34	1318.66	2	-10.32	14.8	4882	55	3	111 - 122	K.LMGDLGQVVPMK.F	Oxidation: 2
111	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	42	590.28	1178.54	590.29	1178.56	2	-10.91	12.9	10666	55	2	384 - 395	K.GGPNFGSTVSEK.I
111	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	226	662.36	1322.71	662.37	1322.72	2	-8.84	21.2	4726	52	3	240 - 252	K.YGFLPLIGGGTTK.F
111	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	218	542.64	1624.88	542.64	1624.90	3	-8.62	20.2	8599	36	2	370 - 382	K.LKGYPVEFLIQYR.K
111	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	93	660.33	1318.65	660.34	1318.66	2	-9.91	14.9	9433	56	3	111 - 122	K.LMGDLGQVVPMK.F	Oxidation: 2
111	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	127	621.31	1860.90	621.31	1860.92	3	-8.81	16.1	6942	31	1	91 - 107	K.MGSQVLVPFRGSEDSPR.H
111	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	103	626.64	1876.89	626.64	1876.91	3	-9.83	15.2	17782	48	3	91 - 107	K.MGSQVLVPFRGSEDSPR.H	Oxidation: 1
111	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	150	612.30	1833.89	612.31	1833.91	3	-10.54	16.8	8704	21	2	111 - 126	K.LMGDLGQVVPMKFDPR.D	Oxidation: 2
111	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	228	662.36	1322.71	662.37	1322.72	2	-7.84	21.3	61964	66	3	240 - 252	K.YGFLPLIGGGTTK.F
189	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	117	575.30	1148.59	575.31	1148.60	2	-6.49	17.5	8248	78	3	91 - 100	K.MGSQVLVPFR.G	Oxidation: 1
189	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	116	575.30	1148.59	575.31	1148.60	2	-6.56	17.5	4074	86	3	91 - 100	K.MGSQVLVPFR.G	Oxidation: 1
189	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	143	534.82	1067.63	534.83	1067.65	2	-9.85	19	14886	48	3	138 - 147	K.ANVVINLIGR.E
189	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	141	534.82	1067.64	534.83	1067.65	2	-9.31	19	4425	53	3	138 - 147	K.ANVVINLIGR.E
189	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	150	991.82	2972.45	991.83	2972.46	3	-3.75	19.3	2199	32	1	201 - 228	K.AAAEEAVLNALPEATIMRPATMIGTEDR.I	Oxidation: 17
189	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	118	575.30	1148.59	575.31	1148.60	2	-6.68	17.5	7248	58	3	91 - 100	K.MGSQVLVPFR.G	Oxidation: 1
189	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	87	481.78	961.55	481.79	961.56	2	-12.68	15.6	16095	28	1	83 - 90	R.YLVQQLAK.M
189	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	149	744.12	2972.45	744.12	2972.46	4	-3.75	19.3	2964	27	1	201 - 228	K.AAAEEAVLNALPEATIMRPATMIGTEDR.I	Oxidation: 17
189	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	158	662.36	1322.71	662.37	1322.72	2	-7.01	21.6	4218	56	2	240 - 252	K.YGFLPLIGGGTTK.F
189	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	160	692.86	1383.71	692.87	1383.72	2	-4.49	21.7	6427	52	1	372 - 382	K.GYPVEFLIQYR.K
189	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	142	534.83	1067.64	534.83	1067.65	2	-7.12	19	16392	67	3	138 - 147	K.ANVVINLIGR.E
189	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	159	662.36	1322.72	662.37	1322.72	2	-6.14	21.6	10455	71	2	240 - 252	K.YGFLPLIGGGTTK.F
262	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	284	625.83	1249.64	625.83	1249.65	2	-10.76	21.33998333	30424	40	4	229 - 238	R.ILNPWSMFVK.K	Oxidation: 7
262	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	281	625.83	1249.64	625.83	1249.65	2	-10.76	21.21858333	14674	35	4	229 - 238	R.ILNPWSMFVK.K	Oxidation: 7
262	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	167	606.32	1210.62	606.32	1210.63	2	-14.49	16.64785	5415	36	1	360 - 369	K.FQDLDLVPHK.L
262	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	257	986.49	2956.44	986.50	2956.46	3	-8.59	20.097425	5947	33	5	201 - 228	K.AAAEEAVLNALPEATIMRPATMIGTEDR.I	Oxidation: 22
262	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	140	626.64	1876.90	626.64	1876.91	3	-7.97	15.80125	27742	41	2	91 - 107	K.MGSQVLVPFRGSEDSPR.H	Oxidation: 1
262	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	187	575.30	1148.59	575.31	1148.60	2	-11.44	17.4017	56597	94	5	91 - 100	K.MGSQVLVPFR.G	Oxidation: 1
262	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	180	612.30	1833.89	612.31	1833.91	3	-11.41	17.13230833	6768	31	2	111 - 126	K.LMGDLGQVVPMKFDPR.D	Oxidation: 2
262	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	265	542.63	1624.87	542.64	1624.90	3	-14.65	20.40738333	5506	51	4	370 - 382	K.LKGYPVEFLIQYR.K
262	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	258	740.12	2956.44	740.12	2956.46	4	-8.55	20.11080833	3806	28	2	201 - 228	K.AAAEEAVLNALPEATIMRPATMIGTEDR.I	Oxidation: 22
262	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	272	986.49	2956.44	986.50	2956.46	3	-8.19	20.70515	5310	34	5	201 - 228	K.AAAEEAVLNALPEATIMRPATMIGTEDR.I	Oxidation: 17
262	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	176	855.92	1709.82	855.93	1709.84	2	-9.36	17.02490833	31936	121	3	180 - 195	R.YIQVSCLGASVSSPSR.M	Carbamidomethyl: 6
262	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	25	408.20	1221.57	408.20	1221.59	3	-14.97	11.51961667	11579	52	2	127 - 137	R.DEDSIKAVMAK.A	Oxidation: 9
262	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	20	553.75	1105.49	553.76	1105.51	2	-14.02	10.92293333	17614	75	2	219 - 228	R.PATMIGTEDR.I	Oxidation: 4
262	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	185	575.31	1148.60	575.31	1148.60	2	-4.84	17.32078333	5998	66	5	91 - 100	K.MGSQVLVPFR.G	Oxidation: 1
262	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	19	553.75	1105.49	553.76	1105.51	2	-14.56	10.88245	13541	101	2	219 - 228	R.PATMIGTEDR.I	Oxidation: 4
262	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	271	986.49	2956.44	986.50	2956.46	3	-7.58	20.66469167	4028	22	5	201 - 228	K.AAAEEAVLNALPEATIMRPATMIGTEDR.I	Oxidation: 17
262	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	226	534.82	1067.63	534.83	1067.65	2	-9.80	19.03494167	42405	48	2	138 - 147	K.ANVVINLIGR.E
262	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	206	567.30	1132.59	567.31	1132.61	2	-11.33	18.348225	22456	71	2	91 - 100	K.MGSQVLVPFR.G
262	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	69	590.28	1178.54	590.29	1178.56	2	-11.45	13.4622	50722	85	3	384 - 395	K.GGPNFGSTVSEK.I
262	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	272	986.49	2956.44	986.50	2956.46	3	-8.19	20.70515	5310	34	5	201 - 228	K.AAAEEAVLNALPEATIMRPATMIGTEDR.I	Oxidation: 22
262	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	255	986.49	2956.44	986.50	2956.46	3	-7.99	20.03019167	4400	25	5	201 - 228	K.AAAEEAVLNALPEATIMRPATMIGTEDR.I	Oxidation: 22
262	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	298	617.83	1233.64	617.84	1233.66	2	-11.13	23.42928333	11126	38	4	229 - 238	R.ILNPWSMFVK.K
262	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	174	652.33	1302.65	652.34	1302.67	2	-10.53	16.94429167	9964	51	1	111 - 122	K.LMGDLGQVVPMK.F	Oxidation: 2
262	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	127	660.33	1318.65	660.34	1318.66	2	-12.61	15.38476667	17121	53	2	111 - 122	K.LMGDLGQVVPMK.F	Oxidation: 2
262	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	189	575.30	1148.59	575.31	1148.60	2	-10.75	17.48265	26079	76	5	91 - 100	K.MGSQVLVPFR.G	Oxidation: 1
262	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	177	570.95	1709.82	570.95	1709.84	3	-9.40	17.03829167	13479	79	1	180 - 195	R.YIQVSCLGASVSSPSR.M	Carbamidomethyl: 6
262	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	286	662.36	1322.71	662.37	1322.72	2	-8.45	21.51604167	29806	59	4	240 - 252	K.YGFLPLIGGGTTK.F
262	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	288	662.36	1322.71	662.37	1322.72	2	-9.20	21.58326667	98277	64	4	240 - 252	K.YGFLPLIGGGTTK.F
262	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	67	407.86	1220.55	407.86	1220.57	3	-14.60	13.38155833	5298	25	1	123 - 132	K.FDPRDEDSIK.A
262	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	66	590.28	1178.54	590.29	1178.56	2	-12.64	13.368175	17394	86	3	384 - 395	K.GGPNFGSTVSEK.I
262	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	255	986.49	2956.44	986.50	2956.46	3	-7.99	20.03019167	4400	26	5	201 - 228	K.AAAEEAVLNALPEATIMRPATMIGTEDR.I	Oxidation: 17
262	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	282	625.83	1249.64	625.83	1249.65	2	-8.68	21.25906667	46077	36	4	229 - 238	R.ILNPWSMFVK.K	Oxidation: 7
262	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	173	855.92	1709.83	855.93	1709.84	2	-8.31	16.93090833	12435	120	3	180 - 195	R.YIQVSCLGASVSSPSR.M	Carbamidomethyl: 6
262	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	268	542.63	1624.88	542.64	1624.90	3	-13.36	20.51529167	15328	40	4	370 - 382	K.LKGYPVEFLIQYR.K
262	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	261	1006.98	2011.94	1006.98	2011.95	2	-7.88	20.259325	9220	17	2	384 - 402	K.GGPNFGSTVSEKIPTDFYP.-
262	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	271	986.49	2956.44	986.50	2956.46	3	-7.58	20.66469167	4028	22	5	201 - 228	K.AAAEEAVLNALPEATIMRPATMIGTEDR.I	Oxidation: 22
262	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	234	582.98	1745.92	582.99	1745.94	3	-11.64	19.24976667	14565	42	3	138 - 152	K.ANVVINLIGREYETR.N
262	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	256	740.12	2956.44	740.12	2956.46	4	-8.01	20.043575	2997	42	2	201 - 228	K.AAAEEAVLNALPEATIMRPATMIGTEDR.I	Oxidation: 22
262	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	280	945.10	2832.27	945.11	2832.30	3	-8.59	21.17808333	5759	17	1	279 - 302	K.TYELGGPDVFTTHELAEIMYDMIR.E	Oxidation: 19
262	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	183	612.30	1833.89	612.31	1833.91	3	-11.57	17.2263	11717	20	2	111 - 126	K.LMGDLGQVVPMKFDPR.D	Oxidation: 2
262	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	56	545.76	1089.50	545.76	1089.51	2	-13.20	12.93685	9906	67	3	219 - 228	R.PATMIGTEDR.I
262	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	258	740.12	2956.44	740.12	2956.46	4	-8.55	20.11080833	3806	28	2	201 - 228	K.AAAEEAVLNALPEATIMRPATMIGTEDR.I	Oxidation: 17
262	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	299	617.83	1233.65	617.84	1233.66	2	-8.06	23.48333333	8851	31	4	229 - 238	R.ILNPWSMFVK.K
262	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	233	744.12	2972.43	744.12	2972.46	4	-8.81	19.23636667	13061	44	2	201 - 228	K.AAAEEAVLNALPEATIMRPATMIGTEDR.I	Oxidation: 17
262	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	181	855.92	1709.82	855.93	1709.84	2	-9.36	17.14569167	10663	70	3	180 - 195	R.YIQVSCLGASVSSPSR.M	Carbamidomethyl: 6
262	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	211	588.35	1174.69	588.36	1174.71	2	-14.42	18.469	14348	43	1	307 - 316	R.YVKLPFPIAK.A
262	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	292	662.36	1322.71	662.37	1322.72	2	-9.81	21.70435833	34542	64	4	240 - 252	K.YGFLPLIGGGTTK.F
262	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	38	436.55	1306.63	436.56	1306.65	3	-13.18	11.96438333	13158	41	2	383 - 395	R.KGGPNFGSTVSEK.I
262	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	188	575.30	1148.59	575.31	1148.60	2	-11.62	17.44218333	39003	82	5	91 - 100	K.MGSQVLVPFR.G	Oxidation: 1
262	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	257	986.49	2956.44	986.50	2956.46	3	-8.59	20.097425	5947	33	5	201 - 228	K.AAAEEAVLNALPEATIMRPATMIGTEDR.I	Oxidation: 17
262	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	137	626.64	1876.89	626.64	1876.91	3	-11.32	15.70725	5799	48	2	91 - 107	K.MGSQVLVPFRGSEDSPR.H	Oxidation: 1
262	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	263	1006.97	2011.93	1006.98	2011.95	2	-9.27	20.32655	21823	16	2	384 - 402	K.GGPNFGSTVSEKIPTDFYP.-
262	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	55	545.76	1089.50	545.76	1089.51	2	-13.94	12.89638333	11258	79	3	219 - 228	R.PATMIGTEDR.I
262	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	232	991.82	2972.43	991.83	2972.46	3	-8.89	19.22298333	15839	46	2	201 - 228	K.AAAEEAVLNALPEATIMRPATMIGTEDR.I	Oxidation: 17
262	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	216	644.34	1286.66	644.34	1286.67	2	-8.86	18.6843	3606	48	3	111 - 122	K.LMGDLGQVVPMK.F
262	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	266	542.63	1624.88	542.64	1624.90	3	-11.70	20.44784167	15484	44	4	370 - 382	K.LKGYPVEFLIQYR.K
262	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	135	481.78	961.55	481.79	961.56	2	-13.93	15.64001667	81788	47	1	83 - 90	R.YLVQQLAK.M
262	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	285	662.36	1322.71	662.37	1322.72	2	-11.01	21.47558333	4646	58	4	240 - 252	K.YGFLPLIGGGTTK.F
262	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	204	567.30	1132.59	567.31	1132.61	2	-12.91	18.28099167	22625	71	2	91 - 100	K.MGSQVLVPFR.G
262	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	35	436.55	1306.63	436.56	1306.65	3	-13.41	11.870375	5846	47	2	383 - 395	R.KGGPNFGSTVSEK.I
262	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	237	744.12	2972.43	744.12	2972.46	4	-8.14	19.34376667	15243	52	2	201 - 228	K.AAAEEAVLNALPEATIMRPATMIGTEDR.I	Oxidation: 17
262	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	297	617.83	1233.65	617.84	1233.66	2	-9.35	23.38881667	9191	45	4	229 - 238	R.ILNPWSMFVK.K
262	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	54	545.76	1089.50	545.76	1089.51	2	-13.57	12.85590833	5593	94	3	219 - 228	R.PATMIGTEDR.I
262	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	37	654.32	1306.63	654.33	1306.65	2	-13.21	11.95098333	13541	26	1	383 - 395	R.KGGPNFGSTVSEK.I
262	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	289	692.86	1383.71	692.87	1383.72	2	-9.12	21.59665833	28076	57	4	372 - 382	K.GYPVEFLIQYR.K
262	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	290	692.86	1383.71	692.87	1383.72	2	-8.98	21.65051667	34072	55	4	372 - 382	K.GYPVEFLIQYR.K
262	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	256	740.12	2956.44	740.12	2956.46	4	-8.01	20.043575	2997	42	2	201 - 228	K.AAAEEAVLNALPEATIMRPATMIGTEDR.I	Oxidation: 17
262	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	283	625.83	1249.64	625.83	1249.65	2	-9.96	21.29953333	49903	28	4	229 - 238	R.ILNPWSMFVK.K	Oxidation: 7
262	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	161	621.31	1860.89	621.31	1860.92	3	-11.67	16.45980833	6962	41	2	91 - 107	K.MGSQVLVPFRGSEDSPR.H
262	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	240	582.98	1745.92	582.99	1745.94	3	-11.13	19.43776667	11671	52	3	138 - 152	K.ANVVINLIGREYETR.N
262	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	235	582.98	1745.93	582.99	1745.94	3	-9.93	19.317	30139	48	3	138 - 152	K.ANVVINLIGREYETR.N
262	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	218	644.34	1286.66	644.34	1286.67	2	-9.17	18.765375	7632	52	3	111 - 122	K.LMGDLGQVVPMK.F
262	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	130	660.33	1318.65	660.34	1318.66	2	-11.85	15.47878333	14410	55	2	111 - 122	K.LMGDLGQVVPMK.F	Oxidation: 2
262	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	72	590.28	1178.54	590.29	1178.56	2	-12.13	13.5562	15582	75	3	384 - 395	K.GGPNFGSTVSEK.I
262	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	296	617.83	1233.64	617.84	1233.66	2	-12.59	23.34834167	4882	45	4	229 - 238	R.ILNPWSMFVK.K
262	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	23	408.20	1221.58	408.20	1221.59	3	-10.07	11.438375	3810	18	2	127 - 137	R.DEDSIKAVMAK.A	Oxidation: 9
262	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	270	542.63	1624.88	542.64	1624.90	3	-12.62	20.58338333	8682	38	4	370 - 382	K.LKGYPVEFLIQYR.K
262	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	273	986.49	2956.44	986.50	2956.46	3	-8.90	20.74563333	7704	39	5	201 - 228	K.AAAEEAVLNALPEATIMRPATMIGTEDR.I	Oxidation: 17
262	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	186	575.30	1148.59	575.31	1148.60	2	-10.57	17.36124167	36686	76	5	91 - 100	K.MGSQVLVPFR.G	Oxidation: 1
262	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	99	553.58	1657.73	553.59	1657.75	3	-13.56	14.470775	100893	36	1	153 - 166	R.NFSFEDANHHIAEK.L
262	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	287	692.86	1383.71	692.87	1383.72	2	-9.12	21.529425	7409	58	4	372 - 382	K.GYPVEFLIQYR.K
262	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	291	692.86	1383.70	692.87	1383.72	2	-10.42	21.690975	29188	57	4	372 - 382	K.GYPVEFLIQYR.K
262	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	273	986.49	2956.44	986.50	2956.46	3	-8.90	20.74563333	7704	43	5	201 - 228	K.AAAEEAVLNALPEATIMRPATMIGTEDR.I	Oxidation: 22
262	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	238	852.41	851.40	852.41	851.41	1	-9.03	19.41099167	10875	23	1	396 - 402	K.IPTDFYP.-
262	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	164	621.31	1860.90	621.31	1860.92	3	-9.42	16.55381667	5078	41	2	91 - 107	K.MGSQVLVPFRGSEDSPR.H
262	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	236	991.82	2972.43	991.83	2972.46	3	-8.18	19.33038333	17458	34	2	201 - 228	K.AAAEEAVLNALPEATIMRPATMIGTEDR.I	Oxidation: 17
262	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	223	534.82	1067.63	534.83	1067.65	2	-12.98	18.94045	56435	65	2	138 - 147	K.ANVVINLIGR.E
262	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	217	644.34	1286.66	644.34	1286.67	2	-12.43	18.72476667	8653	72	3	111 - 122	K.LMGDLGQVVPMK.F
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	102	753.36	752.35	753.36	752.35	1	-0.25	15.1	23834	47	4	323 - 328	R.DFMVNK.V
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	144	553.92	1658.73	553.59	1657.75	3	591.64	16.5	20795	36	3	153 - 166	R.NFSFEDANHHIAEK.L
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	91	614.42	613.42	614.42	613.42	1	-1.50	14.6	66328	37	3	167 - 172	K.LALVAK.E
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	347	623.99	1868.96	624.00	1868.97	3	-3.10	22.9	12893	47	1	201 - 218	K.AAAEEAVLNALPEATIMR.P
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	100	753.36	752.35	753.36	752.35	1	-2.49	15	14857	47	4	323 - 328	R.DFMVNK.V
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	221	575.31	1148.60	575.31	1148.60	2	-2.47	18.9	191359	78	2	91 - 100	K.MGSQVLVPFR.G	Oxidation: 1
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	197	404.55	1210.63	404.55	1210.63	3	-2.20	18.2	95943	43	3	360 - 369	K.FQDLDLVPHK.L
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	312	740.12	2956.45	740.12	2956.46	4	-2.98	21.7	5202	55	4	201 - 228	K.AAAEEAVLNALPEATIMRPATMIGTEDR.I	Oxidation: 22
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	166	626.64	1876.91	626.64	1876.91	3	-1.26	17.1	3559	46	2	91 - 107	K.MGSQVLVPFRGSEDSPR.H	Oxidation: 1
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	97	590.28	1178.55	590.29	1178.56	2	-1.86	14.8	44922	75	3	384 - 395	K.GGPNFGSTVSEK.I
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	313	986.49	2956.46	986.50	2956.46	3	-2.52	21.8	56299	66	3	201 - 228	K.AAAEEAVLNALPEATIMRPATMIGTEDR.I	Oxidation: 17
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	263	606.98	1817.91	606.98	1817.92	3	-3.32	20.2	25124	16	1	111 - 126	K.LMGDLGQVVPMKFDPR.D	Oxidation: 11
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	78	545.76	1089.51	545.76	1089.51	2	-2.52	14.1	25981	82	2	219 - 228	R.PATMIGTEDR.I
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	99	753.36	752.35	753.36	752.35	1	-1.26	15	3644	43	4	323 - 328	R.DFMVNK.V
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	33	553.76	1105.51	553.76	1105.51	2	-0.87	12.1	29872	97	3	219 - 228	R.PATMIGTEDR.I	Oxidation: 4
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	123	829.88	1657.74	829.88	1657.75	2	-2.25	15.8	38100	73	1	153 - 166	R.NFSFEDANHHIAEK.L
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	161	481.79	961.56	481.79	961.56	2	-3.11	17	242912	42	3	83 - 90	R.YLVQQLAK.M
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	32	553.76	1105.50	553.76	1105.51	2	-2.43	12	20164	66	3	219 - 228	R.PATMIGTEDR.I	Oxidation: 4
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	281	534.83	1067.64	534.83	1067.65	2	-4.30	20.8	64575	58	3	138 - 147	K.ANVVINLIGR.E
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	290	744.12	2972.45	744.12	2972.46	4	-2.12	21.1	71961	61	2	201 - 228	K.AAAEEAVLNALPEATIMRPATMIGTEDR.I	Oxidation: 17
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	333	740.12	2956.46	740.12	2956.46	4	-1.69	22.4	14015	62	4	201 - 228	K.AAAEEAVLNALPEATIMRPATMIGTEDR.I	Oxidation: 22
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	192	621.31	1860.91	621.31	1860.92	3	-1.70	18	21433	39	2	91 - 107	K.MGSQVLVPFRGSEDSPR.H
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	216	612.31	1833.90	612.31	1833.91	3	-3.73	18.7	55486	35	2	111 - 126	K.LMGDLGQVVPMKFDPR.D	Oxidation: 2
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	106	753.36	752.35	753.36	752.35	1	-1.70	15.2	10267	29	4	323 - 328	R.DFMVNK.V
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	329	542.64	1624.90	542.64	1624.90	3	-0.97	22.3	30563	50	2	370 - 382	K.LKGYPVEFLIQYR.K
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	364	981.16	2940.46	981.16	2940.47	3	-2.12	23.4	7728	45	2	201 - 228	K.AAAEEAVLNALPEATIMRPATMIGTEDR.I
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	314	740.12	2956.46	740.12	2956.46	4	-2.52	21.8	34406	48	4	201 - 228	K.AAAEEAVLNALPEATIMRPATMIGTEDR.I	Oxidation: 17
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	313	986.49	2956.46	986.50	2956.46	3	-2.52	21.8	56299	68	3	201 - 228	K.AAAEEAVLNALPEATIMRPATMIGTEDR.I	Oxidation: 22
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	291	852.41	851.41	852.41	851.41	1	-0.82	21.1	68054	32	2	396 - 402	K.IPTDFYP.-
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	318	671.66	2011.95	671.66	2011.95	3	-0.68	21.9	12346	40	2	384 - 402	K.GGPNFGSTVSEKIPTDFYP.-
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	278	534.83	1067.64	534.83	1067.65	2	-1.27	20.7	125680	61	3	138 - 147	K.ANVVINLIGR.E
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	151	660.34	1318.66	660.34	1318.66	2	-2.67	16.7	6232	83	3	111 - 122	K.LMGDLGQVVPMK.F	Oxidation: 2
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	8	400.20	798.38	400.20	798.38	2	-2.64	9.9	7326	32	3	173 - 179	K.EHGGIMR.Y
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	265	644.34	1286.67	644.34	1286.67	2	-1.86	20.3	47455	91	2	111 - 122	K.LMGDLGQVVPMK.F
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	55	769.35	768.34	769.35	768.35	1	-4.50	13.1	14339	31	2	323 - 328	R.DFMVNK.V	Oxidation: 3
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	289	991.82	2972.45	991.83	2972.46	3	-2.12	21	83991	64	2	201 - 228	K.AAAEEAVLNALPEATIMRPATMIGTEDR.I	Oxidation: 17
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	336	740.12	2956.46	740.12	2956.46	4	-2.25	22.5	31934	59	4	201 - 228	K.AAAEEAVLNALPEATIMRPATMIGTEDR.I	Oxidation: 22
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	358	662.37	1322.73	662.37	1322.72	2	1.82	23.2	491774	79	2	240 - 252	K.YGFLPLIGGGTTK.F
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	352	625.83	1249.65	625.83	1249.65	2	-0.04	23	433684	51	2	229 - 238	R.ILNPWSMFVK.K	Oxidation: 7
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	163	962.56	961.56	962.57	961.56	1	-3.12	17.1	31232	36	2	83 - 90	R.YLVQQLAK.M
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	210	652.34	1302.67	652.34	1302.67	2	-0.96	18.5	48927	70	2	111 - 122	K.LMGDLGQVVPMK.F	Oxidation: 2
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	316	986.49	2956.46	986.50	2956.46	3	-2.34	21.9	23212	43	3	201 - 228	K.AAAEEAVLNALPEATIMRPATMIGTEDR.I	Oxidation: 17
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	155	660.34	1318.66	660.34	1318.66	2	-1.28	16.8	103358	94	3	111 - 122	K.LMGDLGQVVPMK.F	Oxidation: 2
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	220	652.34	1302.66	652.34	1302.67	2	-3.34	18.8	32017	29	1	111 - 122	K.LMGDLGQVVPMK.F	Oxidation: 11
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	284	726.41	1450.81	726.42	1450.82	2	-2.87	20.9	18353	73	1	239 - 252	K.KYGFLPLIGGGTTK.F
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	362	692.87	1383.72	692.87	1383.72	2	-0.01	23.3	108056	61	3	372 - 382	K.GYPVEFLIQYR.K
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	212	855.93	1709.84	855.93	1709.84	2	-1.66	18.6	70025	109	3	180 - 195	R.YIQVSCLGASVSSPSR.M	Carbamidomethyl: 6
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	328	813.46	1624.90	813.46	1624.90	2	-0.98	22.3	39691	37	2	370 - 382	K.LKGYPVEFLIQYR.K
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	228	785.49	784.48	785.49	784.48	1	-4.03	19.1	22075	50	2	310 - 316	K.LPFPIAK.A
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	319	1006.98	2011.95	1006.98	2011.95	2	-0.94	22	98734	105	3	384 - 402	K.GGPNFGSTVSEKIPTDFYP.-
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	209	855.93	1709.84	855.93	1709.84	2	-0.08	18.5	189544	104	3	180 - 195	R.YIQVSCLGASVSSPSR.M	Carbamidomethyl: 6
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	208	570.95	1709.84	570.95	1709.84	3	-1.45	18.5	9864	84	2	180 - 195	R.YIQVSCLGASVSSPSR.M	Carbamidomethyl: 6
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	152	660.34	1318.66	660.34	1318.66	2	-2.55	16.7	70964	88	3	111 - 122	K.LMGDLGQVVPMK.F	Oxidation: 2
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	325	813.46	1624.90	813.46	1624.90	2	-0.70	22.2	45610	53	2	370 - 382	K.LKGYPVEFLIQYR.K
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	350	945.11	2832.29	945.11	2832.30	3	-1.72	23	11047	38	2	279 - 302	K.TYELGGPDVFTTHELAEIMYDMIR.E	Oxidation: 19
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	167	626.64	1876.91	626.64	1876.91	3	-1.95	17.2	66437	35	2	91 - 107	K.MGSQVLVPFRGSEDSPR.H	Oxidation: 1
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	287	744.12	2972.45	744.12	2972.46	4	-2.70	21	47489	55	2	201 - 228	K.AAAEEAVLNALPEATIMRPATMIGTEDR.I	Oxidation: 17
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	85	614.42	613.41	614.42	613.42	1	-3.57	14.4	17872	49	3	167 - 172	K.LALVAK.E
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	196	621.31	1860.91	621.31	1860.92	3	-2.00	18.1	17830	28	2	91 - 107	K.MGSQVLVPFRGSEDSPR.H
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	159	962.57	961.56	962.57	961.56	1	-1.70	16.9	89197	46	2	83 - 90	R.YLVQQLAK.M
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	317	1006.98	2011.95	1006.98	2011.95	2	-0.67	21.9	17923	82	3	384 - 402	K.GGPNFGSTVSEKIPTDFYP.-
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	275	534.83	1067.65	534.83	1067.65	2	0.17	20.6	145887	59	3	138 - 147	K.ANVVINLIGR.E
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	57	769.35	768.35	769.35	768.35	1	-3.11	13.2	12925	33	2	323 - 328	R.DFMVNK.V	Oxidation: 3
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	336	740.12	2956.46	740.12	2956.46	4	-2.25	22.5	31934	59	4	201 - 228	K.AAAEEAVLNALPEATIMRPATMIGTEDR.I	Oxidation: 17
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	51	654.33	1306.65	654.33	1306.65	2	-2.00	13	18325	87	2	383 - 395	R.KGGPNFGSTVSEK.I
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	323	1006.98	2011.95	1006.98	2011.95	2	-0.30	22.1	33337	19	3	384 - 402	K.GGPNFGSTVSEKIPTDFYP.-
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	359	692.87	1383.72	692.87	1383.72	2	-0.01	23.2	58820	61	3	372 - 382	K.GYPVEFLIQYR.K
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	326	542.64	1624.90	542.64	1624.90	3	-0.71	22.2	32979	61	2	370 - 382	K.LKGYPVEFLIQYR.K
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	316	986.49	2956.46	986.50	2956.46	3	-2.34	21.9	23212	45	3	201 - 228	K.AAAEEAVLNALPEATIMRPATMIGTEDR.I	Oxidation: 22
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	194	606.32	1210.63	606.32	1210.63	2	-2.55	18.1	18030	62	3	360 - 369	K.FQDLDLVPHK.L
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	361	662.37	1322.72	662.37	1322.72	2	1.15	23.3	327191	69	2	240 - 252	K.YGFLPLIGGGTTK.F
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	308	690.37	2068.09	690.37	2068.10	3	-2.68	21.6	3554	21	1	199 - 218	R.AKAAAEEAVLNALPEATIMR.P
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	348	945.11	2832.29	945.11	2832.30	3	-1.32	22.9	2891	33	2	279 - 302	K.TYELGGPDVFTTHELAEIMYDMIR.E	Oxidation: 19
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	211	570.95	1709.84	570.95	1709.84	3	-0.08	18.6	24901	87	2	180 - 195	R.YIQVSCLGASVSSPSR.M	Carbamidomethyl: 6
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	363	981.16	2940.47	981.16	2940.47	3	-1.07	23.4	10769	50	2	201 - 228	K.AAAEEAVLNALPEATIMRPATMIGTEDR.I
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	312	740.12	2956.45	740.12	2956.46	4	-2.98	21.7	5202	59	4	201 - 228	K.AAAEEAVLNALPEATIMRPATMIGTEDR.I	Oxidation: 17
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	10	400.20	798.38	400.20	798.38	2	-2.89	10	8081	29	3	173 - 179	K.EHGGIMR.Y
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	88	614.42	613.42	614.42	613.42	1	-0.82	14.5	103274	49	3	167 - 172	K.LALVAK.E
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	250	567.31	1132.60	567.31	1132.61	2	-4.21	19.8	20664	70	2	91 - 100	K.MGSQVLVPFR.G
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	195	404.55	1210.63	404.55	1210.63	3	-2.55	18.1	16639	29	3	360 - 369	K.FQDLDLVPHK.L
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	268	644.34	1286.67	644.34	1286.67	2	-2.36	20.4	57720	87	2	111 - 122	K.LMGDLGQVVPMK.F
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	320	671.66	2011.95	671.66	2011.95	3	-0.94	22	53622	51	2	384 - 402	K.GGPNFGSTVSEKIPTDFYP.-
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	349	625.83	1249.65	625.83	1249.65	2	-0.79	22.9	130603	53	2	229 - 238	R.ILNPWSMFVK.K	Oxidation: 7
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	224	575.31	1148.60	575.31	1148.60	2	-0.86	19	200794	87	2	91 - 100	K.MGSQVLVPFR.G	Oxidation: 1
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	126	553.59	1657.75	553.59	1657.75	3	-1.04	15.9	99375	55	3	153 - 166	R.NFSFEDANHHIAEK.L
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	262	588.36	1174.70	588.36	1174.71	2	-6.35	20.2	29534	50	2	307 - 316	R.YVKLPFPIAK.A
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	43	408.20	1221.59	408.20	1221.59	3	-1.37	12.7	4562	23	2	127 - 137	R.DEDSIKAVMAK.A	Oxidation: 9
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	201	606.32	1210.63	606.32	1210.63	2	-3.06	18.3	93712	58	3	360 - 369	K.FQDLDLVPHK.L
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	94	590.29	1178.56	590.29	1178.56	2	1.02	14.7	127883	71	3	384 - 395	K.GGPNFGSTVSEK.I
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	207	652.34	1302.66	652.34	1302.67	2	-2.31	18.4	44650	95	2	111 - 122	K.LMGDLGQVVPMK.F	Oxidation: 2
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	266	588.36	1174.70	588.36	1174.71	2	-7.96	20.3	19843	38	2	307 - 316	R.YVKLPFPIAK.A
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	206	855.93	1709.84	855.93	1709.84	2	-1.45	18.4	51058	128	3	180 - 195	R.YIQVSCLGASVSSPSR.M	Carbamidomethyl: 6
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	293	852.41	851.40	852.41	851.41	1	-1.94	21.1	37464	15	2	396 - 402	K.IPTDFYP.-
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	333	740.12	2956.46	740.12	2956.46	4	-1.69	22.4	14015	62	4	201 - 228	K.AAAEEAVLNALPEATIMRPATMIGTEDR.I	Oxidation: 17
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	357	692.86	1383.71	692.87	1383.72	2	-3.95	23.2	5043	62	3	372 - 382	K.GYPVEFLIQYR.K
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	93	590.28	1178.56	590.29	1178.56	2	-1.44	14.6	13250	80	3	384 - 395	K.GGPNFGSTVSEK.I
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	198	606.32	1210.63	606.32	1210.63	2	-2.21	18.2	94802	58	3	360 - 369	K.FQDLDLVPHK.L
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	121	553.59	1657.74	553.59	1657.75	3	-2.25	15.8	97742	60	3	153 - 166	R.NFSFEDANHHIAEK.L
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	158	481.79	961.56	481.79	961.56	2	-1.70	16.9	481137	35	3	83 - 90	R.YLVQQLAK.M
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	218	612.31	1833.91	612.31	1833.91	3	-2.93	18.8	47149	32	2	111 - 126	K.LMGDLGQVVPMKFDPR.D	Oxidation: 2
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	9	400.20	798.38	400.20	798.38	2	-4.18	9.9	7981	32	3	173 - 179	K.EHGGIMR.Y
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	311	986.49	2956.45	986.50	2956.46	3	-2.99	21.7	6874	46	3	201 - 228	K.AAAEEAVLNALPEATIMRPATMIGTEDR.I	Oxidation: 22
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	286	991.82	2972.45	991.83	2972.46	3	-2.70	20.9	54688	72	2	201 - 228	K.AAAEEAVLNALPEATIMRPATMIGTEDR.I	Oxidation: 17
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	81	545.76	1089.51	545.76	1089.51	2	-3.00	14.2	12585	82	2	219 - 228	R.PATMIGTEDR.I
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	231	785.49	784.48	785.49	784.48	1	-4.17	19.2	23699	37	2	310 - 316	K.LPFPIAK.A
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	200	404.55	1210.63	404.55	1210.63	3	-3.07	18.2	96572	27	3	360 - 369	K.FQDLDLVPHK.L
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	42	408.20	1221.59	408.20	1221.59	3	-4.53	12.7	3805	28	2	127 - 137	R.DEDSIKAVMAK.A	Oxidation: 9
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	302	943.48	1884.96	943.49	1884.96	2	-3.30	21.4	11807	42	1	201 - 218	K.AAAEEAVLNALPEATIMR.P	Oxidation: 17
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	54	654.33	1306.65	654.33	1306.65	2	-3.21	13.1	40314	107	2	383 - 395	R.KGGPNFGSTVSEK.I
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	253	567.31	1132.60	567.31	1132.61	2	-2.36	19.9	221659	71	2	91 - 100	K.MGSQVLVPFR.G
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	156	481.78	961.56	481.79	961.56	2	-4.42	16.8	76433	37	3	83 - 90	R.YLVQQLAK.M
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	314	740.12	2956.46	740.12	2956.46	4	-2.52	21.8	34406	48	4	201 - 228	K.AAAEEAVLNALPEATIMRPATMIGTEDR.I	Oxidation: 22
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	346	935.49	1868.96	935.49	1868.97	2	-3.10	22.9	16016	85	1	201 - 218	K.AAAEEAVLNALPEATIMR.P
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	31	553.76	1105.50	553.76	1105.51	2	-2.34	12	5417	74	3	219 - 228	R.PATMIGTEDR.I	Oxidation: 4
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	311	986.49	2956.45	986.50	2956.46	3	-2.99	21.7	6874	46	3	201 - 228	K.AAAEEAVLNALPEATIMRPATMIGTEDR.I	Oxidation: 17
332	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	288	582.99	1745.94	582.99	1745.94	3	-2.77	21	61108	62	1	138 - 152	K.ANVVINLIGREYETR.N
390	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	275	740.11	2956.42	740.12	2956.46	4	-14.83	22.5	4571	29	1	201 - 228	K.AAAEEAVLNALPEATIMRPATMIGTEDR.I	Oxidation: 17
390	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	245	629.32	1884.93	629.33	1884.96	3	-14.89	21.5	3530	17	1	201 - 218	K.AAAEEAVLNALPEATIMR.P	Oxidation: 17
390	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	159	652.33	1302.65	652.34	1302.67	2	-13.10	18.5	13839	22	1	111 - 122	K.LMGDLGQVVPMK.F	Oxidation: 2
390	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	275	740.11	2956.42	740.12	2956.46	4	-14.83	22.5	4571	28	1	201 - 228	K.AAAEEAVLNALPEATIMRPATMIGTEDR.I	Oxidation: 22
390	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	232	582.98	1745.92	582.99	1745.94	3	-12.77	21.1	39485	37	1	138 - 152	K.ANVVINLIGREYETR.N
390	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	44	614.41	613.41	614.42	613.42	1	-13.99	14.6	49161	43	2	167 - 172	K.LALVAK.E
390	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	193	567.30	1132.59	567.31	1132.61	2	-13.90	19.8	6246	62	3	91 - 100	K.MGSQVLVPFR.G
390	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	109	962.55	961.55	962.57	961.56	1	-13.47	17	20874	28	1	83 - 90	R.YLVQQLAK.M
390	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	282	945.09	2832.26	945.11	2832.30	3	-12.62	22.9	2639	26	3	279 - 302	K.TYELGGPDVFTTHELAEIMYDMIR.E	Oxidation: 19
390	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	147	606.32	1210.62	606.32	1210.63	2	-14.25	18.1	10088	18	1	360 - 369	K.FQDLDLVPHK.L
390	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	299	692.86	1383.70	692.87	1383.72	2	-11.81	23.5	45833	50	3	372 - 382	K.GYPVEFLIQYR.K
390	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	267	542.63	1624.87	542.64	1624.90	3	-14.79	22.3	22509	39	1	370 - 382	K.LKGYPVEFLIQYR.K
390	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	52	753.35	752.34	753.36	752.35	1	-13.54	15	4898	38	2	323 - 328	R.DFMVNK.V
390	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	273	986.48	2956.42	986.50	2956.46	3	-14.83	22.5	8243	36	1	201 - 228	K.AAAEEAVLNALPEATIMRPATMIGTEDR.I	Oxidation: 17
390	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	227	726.41	1450.80	726.42	1450.82	2	-13.89	20.9	26142	62	1	239 - 252	K.KYGFLPLIGGGTTK.F
390	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	294	692.86	1383.70	692.87	1383.72	2	-13.81	23.3	19696	61	3	372 - 382	K.GYPVEFLIQYR.K
390	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	116	626.64	1876.88	626.64	1876.91	3	-14.05	17.2	18587	34	1	91 - 107	K.MGSQVLVPFRGSEDSPR.H	Oxidation: 1
390	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	230	991.81	2972.42	991.83	2972.46	3	-13.07	21	38347	44	2	201 - 228	K.AAAEEAVLNALPEATIMRPATMIGTEDR.I	Oxidation: 17
390	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	74	553.58	1657.73	553.59	1657.75	3	-13.43	15.8	37265	46	1	153 - 166	R.NFSFEDANHHIAEK.L
390	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	285	625.83	1249.64	625.83	1249.65	2	-13.17	23	45784	47	3	229 - 238	R.ILNPWSMFVK.K	Oxidation: 7
390	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	261	1006.97	2011.93	1006.98	2011.95	2	-12.52	22.1	30319	35	2	384 - 402	K.GGPNFGSTVSEKIPTDFYP.-
390	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	218	534.82	1067.63	534.83	1067.65	2	-14.55	20.6	69573	51	2	138 - 147	K.ANVVINLIGR.E
390	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	103	660.33	1318.65	660.34	1318.66	2	-10.94	16.8	8723	56	2	111 - 122	K.LMGDLGQVVPMK.F	Oxidation: 2
390	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	46	590.28	1178.54	590.29	1178.56	2	-13.33	14.6	25918	76	2	384 - 395	K.GGPNFGSTVSEK.I
390	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	41	614.41	613.41	614.42	613.42	1	-14.56	14.5	52577	49	2	167 - 172	K.LALVAK.E
390	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	288	625.83	1249.64	625.83	1249.65	2	-12.74	23.1	124812	40	3	229 - 238	R.ILNPWSMFVK.K	Oxidation: 7
390	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	198	567.30	1132.59	567.31	1132.61	2	-13.72	20	43614	56	3	91 - 100	K.MGSQVLVPFR.G
390	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	174	575.30	1148.59	575.31	1148.60	2	-13.72	19	73394	65	3	91 - 100	K.MGSQVLVPFR.G	Oxidation: 1
390	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	172	575.30	1148.59	575.31	1148.60	2	-13.44	19	83535	69	3	91 - 100	K.MGSQVLVPFR.G	Oxidation: 1
390	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	268	813.44	1624.87	813.46	1624.90	2	-14.81	22.3	18109	30	1	370 - 382	K.LKGYPVEFLIQYR.K
390	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	231	744.11	2972.42	744.12	2972.46	4	-13.07	21	32781	50	2	201 - 228	K.AAAEEAVLNALPEATIMRPATMIGTEDR.I	Oxidation: 17
390	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	170	575.31	1148.60	575.31	1148.60	2	-3.76	18.9	4529	54	3	91 - 100	K.MGSQVLVPFR.G	Oxidation: 1
390	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	234	991.81	2972.42	991.83	2972.46	3	-13.96	21.1	15047	22	2	201 - 228	K.AAAEEAVLNALPEATIMRPATMIGTEDR.I	Oxidation: 17
390	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	105	660.33	1318.65	660.34	1318.66	2	-12.33	16.8	29972	72	2	111 - 122	K.LMGDLGQVVPMK.F	Oxidation: 2
390	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	296	662.36	1322.71	662.37	1322.72	2	-11.03	23.4	190252	64	2	240 - 252	K.YGFLPLIGGGTTK.F
390	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	262	671.65	2011.93	671.66	2011.95	3	-12.51	22.1	18715	24	2	384 - 402	K.GGPNFGSTVSEKIPTDFYP.-
390	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	259	1006.97	2011.92	1006.98	2011.95	2	-13.78	22	14363	33	2	384 - 402	K.GGPNFGSTVSEKIPTDFYP.-
390	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	49	590.28	1178.54	590.29	1178.56	2	-12.91	14.7	29833	48	2	384 - 395	K.GGPNFGSTVSEK.I
390	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	160	570.95	1709.82	570.95	1709.84	3	-12.22	18.5	10343	42	1	180 - 195	R.YIQVSCLGASVSSPSR.M	Carbamidomethyl: 6
390	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	195	567.30	1132.59	567.31	1132.61	2	-13.48	19.9	54394	74	3	91 - 100	K.MGSQVLVPFR.G
390	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	161	855.92	1709.82	855.93	1709.84	2	-10.77	18.6	22902	113	2	180 - 195	R.YIQVSCLGASVSSPSR.M	Carbamidomethyl: 6
390	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	169	652.33	1302.65	652.34	1302.67	2	-11.57	18.8	6970	20	1	111 - 122	K.LMGDLGQVVPMK.F	Oxidation: 11
390	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	7	553.75	1105.49	553.76	1105.51	2	-14.54	12.1	11200	46	3	219 - 228	R.PATMIGTEDR.I	Oxidation: 4
390	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	260	671.65	2011.92	671.66	2011.95	3	-13.78	22	9061	23	2	384 - 402	K.GGPNFGSTVSEKIPTDFYP.-
390	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	229	852.40	851.40	852.41	851.41	1	-12.95	21	12204	25	1	396 - 402	K.IPTDFYP.-
390	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	297	692.86	1383.70	692.87	1383.72	2	-11.24	23.4	75977	49	3	372 - 382	K.GYPVEFLIQYR.K
390	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	222	534.82	1067.63	534.83	1067.65	2	-14.70	20.8	27837	48	2	138 - 147	K.ANVVINLIGR.E
390	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	108	481.78	961.55	481.79	961.56	2	-13.45	16.9	197475	46	1	83 - 90	R.YLVQQLAK.M
390	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	273	986.48	2956.42	986.50	2956.46	3	-14.83	22.5	8243	36	1	201 - 228	K.AAAEEAVLNALPEATIMRPATMIGTEDR.I	Oxidation: 22
390	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	283	945.09	2832.26	945.11	2832.30	3	-13.21	23	10949	28	3	279 - 302	K.TYELGGPDVFTTHELAEIMYDMIR.E	Oxidation: 19
390	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	6	553.75	1105.49	553.76	1105.51	2	-13.69	12.1	11116	83	3	219 - 228	R.PATMIGTEDR.I	Oxidation: 4
390	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	286	945.09	2832.26	945.11	2832.30	3	-13.12	23	16726	24	3	279 - 302	K.TYELGGPDVFTTHELAEIMYDMIR.E	Oxidation: 19
390	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	143	621.30	1860.89	621.31	1860.92	3	-13.14	18	8022	27	1	91 - 107	K.MGSQVLVPFRGSEDSPR.H
390	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	235	744.11	2972.42	744.12	2972.46	4	-13.96	21.1	13480	23	2	201 - 228	K.AAAEEAVLNALPEATIMRPATMIGTEDR.I	Oxidation: 17
390	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	291	625.82	1249.63	625.83	1249.65	2	-14.52	23.2	32115	21	3	229 - 238	R.ILNPWSMFVK.K	Oxidation: 7
390	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	54	753.35	752.34	753.36	752.35	1	-13.26	15.1	6213	16	2	323 - 328	R.DFMVNK.V
390	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	158	855.92	1709.82	855.93	1709.84	2	-12.22	18.5	52342	111	2	180 - 195	R.YIQVSCLGASVSSPSR.M	Carbamidomethyl: 6
390	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	293	662.36	1322.71	662.37	1322.72	2	-13.41	23.3	112113	76	2	240 - 252	K.YGFLPLIGGGTTK.F
390	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	33	545.76	1089.50	545.76	1089.51	2	-14.82	14.1	7067	75	1	219 - 228	R.PATMIGTEDR.I
390	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	5	553.75	1105.49	553.76	1105.51	2	-14.11	12	3873	63	3	219 - 228	R.PATMIGTEDR.I	Oxidation: 4
390	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	167	612.30	1833.89	612.31	1833.91	3	-13.65	18.8	19587	17	1	111 - 126	K.LMGDLGQVVPMKFDPR.D	Oxidation: 2
457	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	127	625.83	1249.65	625.83	1249.65	2	-1.89	23.1	11686	24	3	229 - 238	R.ILNPWSMFVK.K	Oxidation: 7
457	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	84	575.31	1148.60	575.31	1148.60	2	-2.87	18.9	3174	73	4	91 - 100	K.MGSQVLVPFR.G	Oxidation: 1
457	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	130	662.37	1322.72	662.37	1322.72	2	0.08	23.2	5581	64	3	240 - 252	K.YGFLPLIGGGTTK.F
457	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	131	662.37	1322.72	662.37	1322.72	2	1.11	23.3	12463	48	3	240 - 252	K.YGFLPLIGGGTTK.F
457	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	116	582.99	1745.95	582.99	1745.94	3	1.70	21	11798	37	3	138 - 152	K.ANVVINLIGREYETR.N
457	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	119	582.99	1745.94	582.99	1745.94	3	-0.58	21.1	7928	55	3	138 - 152	K.ANVVINLIGREYETR.N
457	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	125	625.83	1249.65	625.83	1249.65	2	-1.38	23	4014	22	3	229 - 238	R.ILNPWSMFVK.K	Oxidation: 7
457	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	28	553.59	1657.75	553.59	1657.75	3	0.46	15.8	6927	17	1	153 - 166	R.NFSFEDANHHIAEK.L
457	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	75	570.95	1709.84	570.95	1709.84	3	0.92	18.6	4911	47	2	180 - 195	R.YIQVSCLGASVSSPSR.M	Carbamidomethyl: 6
457	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	132	662.37	1322.73	662.37	1322.72	2	1.95	23.3	17633	59	3	240 - 252	K.YGFLPLIGGGTTK.F
457	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	72	570.96	1709.84	570.95	1709.84	3	2.16	18.5	3838	50	2	180 - 195	R.YIQVSCLGASVSSPSR.M	Carbamidomethyl: 6
457	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	87	575.31	1148.60	575.31	1148.60	2	0.46	19	10155	59	4	91 - 100	K.MGSQVLVPFR.G	Oxidation: 1
457	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	67	404.55	1210.63	404.55	1210.63	3	-2.03	18.1	5050	16	1	360 - 369	K.FQDLDLVPHK.L
457	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	55	626.64	1876.91	626.64	1876.91	3	0.19	17.2	6075	19	2	91 - 107	K.MGSQVLVPFRGSEDSPR.H	Oxidation: 1
457	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	74	855.93	1709.84	855.93	1709.84	2	0.91	18.5	5288	63	2	180 - 195	R.YIQVSCLGASVSSPSR.M	Carbamidomethyl: 6
457	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	49	481.79	961.56	481.79	961.56	2	-3.49	16.8	30929	40	4	83 - 90	R.YLVQQLAK.M
457	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	86	575.31	1148.60	575.31	1148.60	2	2.15	18.9	11649	72	4	91 - 100	K.MGSQVLVPFR.G	Oxidation: 1
457	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	47	481.79	961.56	481.79	961.56	2	-1.35	16.7	4845	21	4	83 - 90	R.YLVQQLAK.M
457	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	126	625.83	1249.65	625.83	1249.65	2	0.26	23	10499	21	3	229 - 238	R.ILNPWSMFVK.K	Oxidation: 7
457	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	105	534.83	1067.64	534.83	1067.65	2	-0.36	20.6	15796	53	3	138 - 147	K.ANVVINLIGR.E
457	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	106	534.83	1067.65	534.83	1067.65	2	-0.02	20.6	20377	48	3	138 - 147	K.ANVVINLIGR.E
457	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	121	744.12	2972.46	744.12	2972.46	4	1.39	21.1	3473	27	1	201 - 228	K.AAAEEAVLNALPEATIMRPATMIGTEDR.I	Oxidation: 17
457	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	53	626.64	1876.91	626.64	1876.91	3	1.59	17.1	4516	46	2	91 - 107	K.MGSQVLVPFRGSEDSPR.H	Oxidation: 1
457	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	133	692.87	1383.72	692.87	1383.72	2	1.54	23.3	6376	58	2	372 - 382	K.GYPVEFLIQYR.K
457	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	50	481.79	961.56	481.79	961.56	2	-1.27	16.8	27347	27	4	83 - 90	R.YLVQQLAK.M
457	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	115	582.99	1745.94	582.99	1745.94	3	-0.27	21	4543	34	3	138 - 152	K.ANVVINLIGREYETR.N
457	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	48	481.79	961.56	481.79	961.56	2	-2.47	16.8	18469	37	4	83 - 90	R.YLVQQLAK.M
457	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	85	575.31	1148.60	575.31	1148.60	2	0.53	18.9	8371	78	4	91 - 100	K.MGSQVLVPFR.G	Oxidation: 1
457	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	134	692.87	1383.72	692.87	1383.72	2	1.69	23.4	8980	41	2	372 - 382	K.GYPVEFLIQYR.K
457	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	73	855.93	1709.84	855.93	1709.84	2	2.17	18.5	4024	63	2	180 - 195	R.YIQVSCLGASVSSPSR.M	Carbamidomethyl: 6
457	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	104	534.83	1067.65	534.83	1067.65	2	1.33	20.5	4960	54	3	138 - 147	K.ANVVINLIGR.E
457	AT2G20360.1	39 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	92	567.31	1132.60	567.31	1132.61	2	-1.32	19.8	5080	42	1	91 - 100	K.MGSQVLVPFR.G
181	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	59	523.77	1045.53	523.78	1045.54	2	-13.58	15.1	5300	43	1	383 - 392	K.STDVVDAIAR.L
181	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	57	715.39	714.39	715.40	714.39	1	-8.36	15	3909	30	1	480 - 486	R.ELLQAAA.-
254	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	332	724.36	1446.71	724.37	1446.73	2	-9.63	19.69104167	7697	100	2	429 - 440	K.LEEIDMLQEVTK.Q
254	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	376	770.84	1539.67	770.85	1539.69	2	-7.51	21.08889167	4665	58	2	410 - 421	R.EGTGWLWMIMER.M	Oxidation: 8
254	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	246	525.95	1574.82	525.95	1574.83	3	-8.13	16.8962	10466	42	2	367 - 382	K.AVQSGLGTAAVIVMDK.S	Oxidation: 14
254	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	303	639.66	1915.97	639.67	1915.99	3	-10.53	18.75036667	8924	62	2	424 - 440	K.VGNAKLEEIDMLQEVTK.Q
254	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	195	715.39	714.39	715.40	714.39	1	-6.96	15.29745833	4126	21	2	480 - 486	R.ELLQAAA.-
254	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	145	587.37	586.36	587.38	586.37	1	-11.73	13.76473333	6997	37	2	90 - 94	K.DLVLK.G
254	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	193	523.77	1045.53	523.78	1045.54	2	-11.02	15.27060833	5594	66	2	383 - 392	K.STDVVDAIAR.L
254	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	286	702.86	1403.71	702.87	1403.73	2	-11.13	18.19971667	3531	94	2	161 - 173	K.LLEGCLIAGVGMR.A	Oxidation: 12
254	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	67	616.36	615.35	616.37	615.36	1	-13.71	11.237675	10249	41	1	190 - 194	R.LNLEK.A
254	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	421	762.85	1523.68	762.85	1523.69	2	-9.48	23.438675	6571	68	4	410 - 421	R.EGTGWLWMIMER.M	Oxidation: 8
254	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	32	433.70	865.38	433.70	865.39	2	-11.47	9.91718333	12495	30	2	183 - 189	R.GEYVNER.L
254	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	300	780.42	1558.82	780.43	1558.84	2	-10.53	18.656375	8611	105	2	367 - 382	K.AVQSGLGTAAVIVMDK.S
254	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	57	425.54	1273.59	425.54	1273.61	3	-13.19	10.94211667	13836	78	3	53 - 63	K.THFGGLKDEDR.I
254	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	306	639.66	1915.97	639.67	1915.99	3	-10.84	18.831	102797	25	2	424 - 440	K.VGNAKLEEIDMLQEVTK.Q
254	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	241	645.00	1931.97	645.00	1931.99	3	-7.40	16.77541667	15832	81	1	424 - 440	K.VGNAKLEEIDMLQEVTK.Q	Oxidation: 11
254	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	173	445.74	889.46	445.74	889.47	2	-11.35	14.62498333	8585	54	3	112 - 121	R.GGAGFPSGLK.W
254	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	373	559.97	1676.87	559.97	1676.89	3	-10.69	20.994825	58209	45	2	64 - 77	R.IFTNLYGLHDPFLK.G
254	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	244	788.42	1574.82	788.42	1574.83	2	-8.21	16.86943333	19164	116	2	367 - 382	K.AVQSGLGTAAVIVMDK.S	Oxidation: 14
254	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	174	574.82	1147.62	574.82	1147.63	2	-9.32	14.63836667	11531	51	2	197 - 207	R.REAYAAGLLGK.N
254	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	54	425.54	1273.59	425.54	1273.61	3	-12.96	10.83443333	7258	78	3	53 - 63	K.THFGGLKDEDR.I
254	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	69	408.76	815.50	408.76	815.51	2	-14.44	11.31829167	12104	42	2	88 - 94	R.TKDLVLK.G
254	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	243	525.95	1574.82	525.95	1574.83	3	-7.94	16.80219167	6516	83	2	367 - 382	K.AVQSGLGTAAVIVMDK.S	Oxidation: 14
254	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	344	585.27	1168.52	585.27	1168.53	2	-9.49	20.053825	4358	42	2	281 - 290	R.GPEWFSSFGR.K
254	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	411	762.85	1523.68	762.85	1523.69	2	-8.82	22.78928333	10026	31	4	410 - 421	R.EGTGWLWMIMER.M	Oxidation: 8
254	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	55	425.54	1273.59	425.54	1273.61	3	-13.66	10.8749	4318	75	3	53 - 63	K.THFGGLKDEDR.I
254	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	410	762.85	1523.68	762.85	1523.69	2	-9.21	22.748825	19792	71	4	410 - 421	R.EGTGWLWMIMER.M	Oxidation: 10
254	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	384	826.09	2475.25	826.10	2475.27	3	-7.54	21.33075	25292	22	1	441 - 463	K.QIEGHTICALGDAAAWPVQGLIR.H	Carbamidomethyl: 8
254	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	252	488.58	1462.71	488.58	1462.72	3	-7.87	17.084225	24307	27	1	429 - 440	K.LEEIDMLQEVTK.Q	Oxidation: 6
254	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	420	566.92	1697.75	566.93	1697.76	3	-9.05	23.35764167	8141	32	1	353 - 366	K.NICEDVLMDFDALK.A	Oxidation: 8
254	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	242	788.42	1574.82	788.42	1574.83	2	-7.96	16.7888	12906	133	2	367 - 382	K.AVQSGLGTAAVIVMDK.S	Oxidation: 14
254	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	419	849.88	1697.75	849.89	1697.76	2	-8.95	23.34425	23367	72	2	353 - 366	K.NICEDVLMDFDALK.A	Oxidation: 8
254	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	421	762.85	1523.68	762.85	1523.69	2	-9.48	23.438675	6571	45	4	410 - 421	R.EGTGWLWMIMER.M	Oxidation: 10
254	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	58	637.80	1273.59	637.81	1273.61	2	-13.22	10.9555	11730	16	2	53 - 63	K.THFGGLKDEDR.I
254	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	176	574.82	1147.63	574.82	1147.63	2	-8.45	14.719	7305	22	2	197 - 207	R.REAYAAGLLGK.N
254	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	374	770.84	1539.67	770.85	1539.69	2	-7.25	21.00821667	16496	62	2	410 - 421	R.EGTGWLWMIMER.M	Oxidation: 8
254	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	437	1052.58	2103.15	1052.59	2103.17	2	-8.64	24.88010833	12495	21	1	332 - 352	R.GGWDNLLAIIPGGSSVPLIPK.N
254	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	226	496.77	991.52	496.77	991.53	2	-12.08	16.305325	16307	50	2	198 - 207	R.EAYAAGLLGK.N
254	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	196	523.77	1045.53	523.78	1045.54	2	-10.83	15.36479167	821	66	2	383 - 392	K.STDVVDAIAR.L
254	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	255	732.36	1462.71	732.37	1462.72	2	-7.96	17.17828333	8187	64	2	429 - 440	K.LEEIDMLQEVTK.Q	Oxidation: 6
254	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	301	520.61	1558.82	520.62	1558.84	3	-10.44	18.66975833	7605	88	2	367 - 382	K.AVQSGLGTAAVIVMDK.S
254	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	73	542.28	1082.55	542.29	1082.56	2	-12.61	11.4257	3032	30	1	464 - 471	R.HFRPELER.R
254	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	422	863.12	2586.35	863.13	2586.37	3	-8.66	23.47913333	4083	32	2	367 - 392	K.AVQSGLGTAAVIVMDKSTDVVDAIAR.L
254	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	387	549.02	2192.07	549.03	2192.09	4	-9.16	21.424775	14936	29	1	60 - 77	K.DEDRIFTNLYGLHDPFLK.G
254	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	409	762.85	1523.68	762.85	1523.69	2	-8.30	22.70835833	11735	34	4	410 - 421	R.EGTGWLWMIMER.M	Oxidation: 8
254	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	223	496.77	991.52	496.77	991.53	2	-11.67	16.21131667	4343	52	2	198 - 207	R.EAYAAGLLGK.N
254	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	409	762.85	1523.68	762.85	1523.69	2	-8.30	22.70835833	11735	62	4	410 - 421	R.EGTGWLWMIMER.M	Oxidation: 10
254	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	229	514.28	1026.54	514.28	1026.55	2	-11.65	16.39933333	30631	61	2	174 - 182	R.ASAAYIYIR.G
254	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	170	536.29	1070.56	536.29	1070.57	2	-10.61	14.530975	3993	46	1	477 - 486	R.AERELLQAAA.-
254	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	29	433.70	865.38	433.70	865.39	2	-13.31	9.82318333	20459	29	2	183 - 189	R.GEYVNER.L
254	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	211	410.71	819.41	410.72	819.42	2	-8.58	15.835275	6481	24	1	393 - 398	R.LSYFYK.H
254	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	66	408.76	815.50	408.76	815.51	2	-13.71	11.22429167	14719	41	2	88 - 94	R.TKDLVLK.G
254	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	281	433.21	1296.61	433.22	1296.63	3	-13.97	18.05186667	25724	18	1	281 - 291	R.GPEWFSSFGRK.N
254	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	227	514.28	1026.54	514.28	1026.55	2	-13.21	16.31870833	73654	60	2	174 - 182	R.ASAAYIYIR.G
254	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	168	445.73	889.45	445.74	889.47	2	-14.72	14.450325	11005	45	3	112 - 121	R.GGAGFPSGLK.W
254	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	346	585.27	1168.52	585.27	1168.53	2	-9.66	20.13446667	6410	41	2	281 - 290	R.GPEWFSSFGR.K
254	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	435	754.85	1507.68	754.85	1507.70	2	-8.18	24.45903333	10692	57	1	410 - 421	R.EGTGWLWMIMER.M
254	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	142	587.37	586.36	587.38	586.37	1	-11.39	13.67073333	5861	38	2	90 - 94	K.DLVLK.G
254	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	247	660.83	1319.64	660.83	1319.65	2	-8.11	16.96343333	93596	63	1	95 - 105	K.GTDWIVNEMKK.S
254	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	337	483.25	1446.72	483.25	1446.73	3	-8.50	19.81181667	6821	27	1	429 - 440	K.LEEIDMLQEVTK.Q
254	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	417	849.88	1697.75	849.89	1697.76	2	-9.77	23.263	19419	93	2	353 - 366	K.NICEDVLMDFDALK.A	Oxidation: 8
254	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	231	625.65	1873.91	625.65	1873.93	3	-9.69	16.42610833	5156	29	1	174 - 189	R.ASAAYIYIRGEYVNER.L
254	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	298	780.42	1558.82	780.43	1558.84	2	-12.06	18.575725	3661	132	2	367 - 382	K.AVQSGLGTAAVIVMDK.S
254	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	290	702.86	1403.71	702.87	1403.73	2	-9.71	18.30711667	7872	77	2	161 - 173	K.LLEGCLIAGVGMR.A	Oxidation: 12
254	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	297	596.78	1191.55	596.79	1191.56	2	-12.03	18.56234167	19543	44	1	95 - 104	K.GTDWIVNEMK.K
254	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	299	520.61	1558.82	520.62	1558.84	3	-11.98	18.58911667	3323	101	2	367 - 382	K.AVQSGLGTAAVIVMDK.S
254	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	436	702.06	2103.15	702.06	2103.17	3	-8.67	24.866725	4028	38	1	332 - 352	R.GGWDNLLAIIPGGSSVPLIPK.N
254	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	423	863.12	2586.35	863.13	2586.37	3	-8.55	23.51960833	8297	38	2	367 - 392	K.AVQSGLGTAAVIVMDKSTDVVDAIAR.L
254	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	250	732.36	1462.71	732.37	1462.72	2	-7.96	17.05745833	11509	105	2	429 - 440	K.LEEIDMLQEVTK.Q	Oxidation: 6
254	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	335	724.36	1446.72	724.37	1446.73	2	-8.52	19.78505	3688	99	2	429 - 440	K.LEEIDMLQEVTK.Q
254	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	56	637.80	1273.59	637.81	1273.61	2	-13.69	10.88828333	91940	27	2	53 - 63	K.THFGGLKDEDR.I
254	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	224	505.51	2017.99	505.51	2018.02	4	-12.11	16.2247	152494	22	1	156 - 173	R.HDPHKLLEGCLIAGVGMR.A	Oxidation: 17
254	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	370	559.97	1676.87	559.97	1676.89	3	-11.23	20.900775	36438	61	2	64 - 77	R.IFTNLYGLHDPFLK.G
254	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	171	445.73	889.45	445.74	889.47	2	-13.82	14.54435833	11070	45	3	112 - 121	R.GGAGFPSGLK.W
254	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	428	841.88	1681.75	841.89	1681.77	2	-10.04	23.69465	6383	55	1	353 - 366	K.NICEDVLMDFDALK.A	Carbamidomethyl: 3
254	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	190	715.39	714.39	715.40	714.39	1	-7.24	15.17583333	7461	35	2	480 - 486	R.ELLQAAA.-
254	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	410	762.85	1523.68	762.85	1523.69	2	-9.21	22.748825	19792	47	4	410 - 421	R.EGTGWLWMIMER.M	Oxidation: 8
254	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	411	762.85	1523.68	762.85	1523.69	2	-8.82	22.78928333	10026	60	4	410 - 421	R.EGTGWLWMIMER.M	Oxidation: 10
254	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	216	406.19	810.36	406.19	810.37	2	-14.03	15.95605833	2889	22	1	122 - 127	K.WSFMPK.V	Oxidation: 4
254	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	291	663.32	1324.62	663.32	1324.63	2	-9.97	18.37434167	27128	42	1	280 - 290	R.RGPEWFSSFGR.K
713	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	83	425.54	1273.60	425.54	1273.61	3	-2.50	10.7	14486	30	1	53 - 63	K.THFGGLKDEDR.I
713	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	377	585.27	1168.53	585.27	1168.53	2	3.61	19.9	25146	28	1	281 - 290	R.GPEWFSSFGR.K
781	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	232	514.28	1026.54	514.28	1026.55	2	-7.61	16.6	8965	24	1	174 - 182	R.ASAAYIYIR.G
781	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	344	585.27	1168.52	585.27	1168.53	2	-6.31	20.2	12275	39	1	281 - 290	R.GPEWFSSFGR.K
781	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	419	762.85	1523.68	762.85	1523.69	2	-7.59	22.9	2987	16	2	410 - 421	R.EGTGWLWMIMER.M	Oxidation: 8
781	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	70	408.76	815.50	408.76	815.51	2	-8.55	11.3	3880	26	1	88 - 94	R.TKDLVLK.G
781	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	419	762.85	1523.68	762.85	1523.69	2	-7.59	22.9	2987	35	2	410 - 421	R.EGTGWLWMIMER.M	Oxidation: 10
781	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	372	559.97	1676.88	559.97	1676.89	3	-8.49	21	19097	47	2	64 - 77	R.IFTNLYGLHDPFLK.G
781	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	369	559.97	1676.88	559.97	1676.89	3	-9.23	21	11407	42	2	64 - 77	R.IFTNLYGLHDPFLK.G
781	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	199	523.77	1045.53	523.78	1045.54	2	-7.77	15.6	3434	72	1	383 - 392	K.STDVVDAIAR.L
781	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	420	762.85	1523.68	762.85	1523.69	2	-7.69	22.9	3480	17	2	410 - 421	R.EGTGWLWMIMER.M	Oxidation: 8
781	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	337	724.37	1446.72	724.37	1446.73	2	-6.65	19.9	16818	60	1	429 - 440	K.LEEIDMLQEVTK.Q
781	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	37	433.71	865.41	433.70	865.39	2	14.40	10	8469	23	2	183 - 189	R.GEYVNER.L
781	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	420	762.85	1523.68	762.85	1523.69	2	-7.69	22.9	3480	17	2	410 - 421	R.EGTGWLWMIMER.M	Oxidation: 10
781	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	62	425.54	1273.59	425.54	1273.61	3	-10.28	10.8	18403	33	1	53 - 63	K.THFGGLKDEDR.I
781	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	35	433.70	865.39	433.70	865.39	2	-8.01	9.9	20021	24	2	183 - 189	R.GEYVNER.L
781	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	384	826.09	2475.25	826.10	2475.27	3	-9.68	21.4	21465	20	1	441 - 463	K.QIEGHTICALGDAAAWPVQGLIR.H	Carbamidomethyl: 8
840	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	163	523.77	1045.53	523.78	1045.54	2	-11.40	15.2	12044	60	2	383 - 392	K.STDVVDAIAR.L
840	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	29	408.76	815.50	408.76	815.51	2	-17.82	11.1	8975	33	2	88 - 94	R.TKDLVLK.G
840	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	234	440.89	1319.64	440.89	1319.65	3	-14.46	16.9	17096	21	1	95 - 105	K.GTDWIVNEMKK.S
840	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	288	702.86	1403.70	702.87	1403.73	2	-17.10	18.3	7840	81	2	161 - 173	K.LLEGCLIAGVGMR.A	Oxidation: 12
840	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	160	715.39	714.38	715.40	714.39	1	-12.18	15.2	7641	39	2	480 - 486	R.ELLQAAA.-
840	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	425	762.84	1523.67	762.85	1523.69	2	-13.25	22.9	17303	28	2	410 - 421	R.EGTGWLWMIMER.M	Oxidation: 8
840	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	408	826.09	2475.24	826.10	2475.27	3	-12.81	21.4	8403	45	3	441 - 463	K.QIEGHTICALGDAAAWPVQGLIR.H	Carbamidomethyl: 8
840	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	232	525.94	1574.81	525.95	1574.83	3	-13.93	16.8	9654	61	2	367 - 382	K.AVQSGLGTAAVIVMDK.S	Oxidation: 14
840	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	304	780.42	1558.82	780.43	1558.84	2	-14.91	18.7	3980	114	3	367 - 382	K.AVQSGLGTAAVIVMDK.S
840	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	398	559.96	1676.87	559.97	1676.89	3	-14.55	21.1	15339	35	3	64 - 77	R.IFTNLYGLHDPFLK.G
840	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	393	559.96	1676.87	559.97	1676.89	3	-14.65	20.9	7882	27	3	64 - 77	R.IFTNLYGLHDPFLK.G
840	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	354	724.36	1446.70	724.37	1446.73	2	-16.14	19.9	34883	50	3	429 - 440	K.LEEIDMLQEVTK.Q
840	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	191	410.71	819.41	410.72	819.42	2	-13.83	15.9	5343	36	3	393 - 398	R.LSYFYK.H
840	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	203	496.77	991.52	496.77	991.53	2	-14.05	16.2	6192	75	3	198 - 207	R.EAYAAGLLGK.N
840	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	22	425.54	1273.59	425.54	1273.61	3	-13.29	10.8	14874	52	3	53 - 63	K.THFGGLKDEDR.I
840	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	427	762.84	1523.67	762.85	1523.69	2	-11.67	23	42998	36	2	410 - 421	R.EGTGWLWMIMER.M	Oxidation: 8
840	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	386	1128.59	3382.75	1128.61	3382.80	3	-13.10	20.8	21018	71	3	248 - 279	R.LKPPFPANAGLYGCPTTVTNVETVAVSPTILR.R	Carbamidomethyl: 14
840	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	189	820.41	819.41	820.42	819.42	1	-13.26	15.8	9629	34	1	393 - 398	R.LSYFYK.H
840	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	362	585.26	1168.51	585.27	1168.53	2	-13.71	20.1	9206	53	3	281 - 290	R.GPEWFSSFGR.K
840	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	427	762.84	1523.67	762.85	1523.69	2	-11.67	23	42998	62	2	410 - 421	R.EGTGWLWMIMER.M	Oxidation: 10
840	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	211	514.27	1026.54	514.28	1026.55	2	-13.98	16.3	11905	61	3	174 - 182	R.ASAAYIYIR.G
840	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	367	585.26	1168.51	585.27	1168.53	2	-14.29	20.2	4341	51	3	281 - 290	R.GPEWFSSFGR.K
840	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	365	585.26	1168.51	585.27	1168.53	2	-14.19	20.2	5196	43	3	281 - 290	R.GPEWFSSFGR.K
840	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	206	496.77	991.52	496.77	991.53	2	-15.82	16.2	16151	62	3	198 - 207	R.EAYAAGLLGK.N
840	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	194	406.19	810.36	406.19	810.37	2	-12.97	15.9	7131	15	1	122 - 127	K.WSFMPK.V	Oxidation: 4
840	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	208	992.53	991.52	992.54	991.53	1	-15.84	16.2	6973	47	1	198 - 207	R.EAYAAGLLGK.N
840	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	27	408.76	815.50	408.76	815.51	2	-15.96	11	25162	37	2	88 - 94	R.TKDLVLK.G
840	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	235	660.82	1319.64	660.83	1319.65	2	-14.47	16.9	32482	38	1	95 - 105	K.GTDWIVNEMKK.S
840	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	23	425.54	1273.59	425.54	1273.61	3	-14.37	10.8	82683	60	3	53 - 63	K.THFGGLKDEDR.I
840	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	403	770.84	1539.66	770.85	1539.69	2	-13.32	21.2	27644	33	3	410 - 421	R.EGTGWLWMIMER.M	Oxidation: 8
840	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	401	770.84	1539.67	770.85	1539.69	2	-12.74	21.1	13100	57	3	410 - 421	R.EGTGWLWMIMER.M	Oxidation: 8
840	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	122	446.22	1335.63	446.22	1335.65	3	-12.16	14.3	4076	29	2	95 - 105	K.GTDWIVNEMKK.S	Oxidation: 9
840	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	5	433.70	865.38	433.70	865.39	2	-14.21	9.7	5286	38	3	183 - 189	R.GEYVNER.L
840	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	309	639.66	1915.96	639.67	1915.99	3	-16.36	18.8	6797	50	1	424 - 440	K.VGNAKLEEIDMLQEVTK.Q
840	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	241	732.36	1462.70	732.37	1462.72	2	-12.82	17.1	16347	84	2	429 - 440	K.LEEIDMLQEVTK.Q	Oxidation: 6
840	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	186	410.71	819.41	410.72	819.42	2	-13.98	15.7	8919	33	3	393 - 398	R.LSYFYK.H
840	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	25	637.80	1273.59	637.81	1273.61	2	-14.73	10.9	28289	24	2	53 - 63	K.THFGGLKDEDR.I
840	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	228	788.41	1574.81	788.42	1574.83	2	-13.02	16.8	5448	117	3	367 - 382	K.AVQSGLGTAAVIVMDK.S	Oxidation: 14
840	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	387	1128.59	3382.75	1128.61	3382.80	3	-13.06	20.8	4048	75	3	248 - 279	R.LKPPFPANAGLYGCPTTVTNVETVAVSPTILR.R	Carbamidomethyl: 14
840	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	308	780.41	1558.81	780.43	1558.84	2	-16.25	18.8	16239	89	3	367 - 382	K.AVQSGLGTAAVIVMDK.S
840	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	406	826.08	2475.23	826.10	2475.27	3	-15.11	21.3	19740	38	3	441 - 463	K.QIEGHTICALGDAAAWPVQGLIR.H	Carbamidomethyl: 8
840	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	188	410.71	819.41	410.72	819.42	2	-13.25	15.8	3845	37	3	393 - 398	R.LSYFYK.H
840	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	389	1128.59	3382.75	1128.61	3382.80	3	-13.43	20.8	13759	78	3	248 - 279	R.LKPPFPANAGLYGCPTTVTNVETVAVSPTILR.R	Carbamidomethyl: 14
840	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	6	433.70	865.38	433.70	865.39	2	-16.73	9.8	11565	36	3	183 - 189	R.GEYVNER.L
840	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	432	849.88	1697.74	849.89	1697.76	2	-14.46	23.4	7773	71	3	353 - 366	K.NICEDVLMDFDALK.A	Oxidation: 8
840	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	295	442.54	1324.61	442.55	1324.63	3	-15.98	18.5	6101	40	2	280 - 290	R.RGPEWFSSFGR.K
840	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	434	849.88	1697.74	849.89	1697.76	2	-14.77	23.5	8431	59	3	353 - 366	K.NICEDVLMDFDALK.A	Oxidation: 8
840	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	32	616.36	615.35	616.37	615.36	1	-13.49	11.1	4048	26	2	190 - 194	R.LNLEK.A
840	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	395	559.96	1676.87	559.97	1676.89	3	-14.55	21	45190	43	3	64 - 77	R.IFTNLYGLHDPFLK.G
840	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	212	514.27	1026.54	514.28	1026.55	2	-14.06	16.4	18637	61	3	174 - 182	R.ASAAYIYIR.G
840	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	433	566.92	1697.74	566.93	1697.76	3	-14.45	23.4	3202	23	2	353 - 366	K.NICEDVLMDFDALK.A	Oxidation: 8
840	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	293	442.54	1324.61	442.55	1324.63	3	-15.44	18.4	13945	45	2	280 - 290	R.RGPEWFSSFGR.K
840	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	21	425.54	1273.59	425.54	1273.61	3	-14.13	10.8	13407	27	3	53 - 63	K.THFGGLKDEDR.I
840	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	131	445.73	889.45	445.74	889.47	2	-16.87	14.5	10756	41	1	112 - 121	R.GGAGFPSGLK.W
840	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	225	788.41	1574.81	788.42	1574.83	2	-14.36	16.7	4589	110	3	367 - 382	K.AVQSGLGTAAVIVMDK.S	Oxidation: 14
840	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	349	724.36	1446.71	724.37	1446.73	2	-14.68	19.8	31358	86	3	429 - 440	K.LEEIDMLQEVTK.Q
840	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	215	514.27	1026.53	514.28	1026.55	2	-15.19	16.4	4986	53	3	174 - 182	R.ASAAYIYIR.G
840	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	425	762.84	1523.67	762.85	1523.69	2	-13.25	22.9	17303	47	2	410 - 421	R.EGTGWLWMIMER.M	Oxidation: 10
840	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	435	566.92	1697.74	566.93	1697.76	3	-14.76	23.5	7795	46	2	353 - 366	K.NICEDVLMDFDALK.A	Oxidation: 8
840	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	436	849.88	1697.74	849.89	1697.76	2	-14.31	23.5	3908	17	3	353 - 366	K.NICEDVLMDFDALK.A	Oxidation: 8
840	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	210	496.77	991.52	496.77	991.53	2	-14.41	16.3	29551	42	3	198 - 207	R.EAYAAGLLGK.N
840	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	230	525.95	1574.81	525.95	1574.83	3	-13.01	16.8	8981	81	2	367 - 382	K.AVQSGLGTAAVIVMDK.S	Oxidation: 14
840	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	402	770.84	1539.67	770.85	1539.69	2	-11.76	21.2	3394	51	3	410 - 421	R.EGTGWLWMIMER.M	Oxidation: 8
840	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	231	788.41	1574.81	788.42	1574.83	2	-13.93	16.8	9403	120	3	367 - 382	K.AVQSGLGTAAVIVMDK.S	Oxidation: 14
840	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	157	715.39	714.38	715.40	714.39	1	-13.02	15.1	3809	21	2	480 - 486	R.ELLQAAA.-
840	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	167	523.77	1045.53	523.78	1045.54	2	-11.67	15.3	14496	61	2	383 - 392	K.STDVVDAIAR.L
840	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	244	732.36	1462.70	732.37	1462.72	2	-14.12	17.1	8345	67	2	429 - 440	K.LEEIDMLQEVTK.Q	Oxidation: 6
840	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	4	433.70	865.38	433.70	865.39	2	-14.70	9.7	15289	24	3	183 - 189	R.GEYVNER.L
840	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	347	724.36	1446.71	724.37	1446.73	2	-11.37	19.7	91938	80	3	429 - 440	K.LEEIDMLQEVTK.Q
840	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	30	616.36	615.35	616.37	615.36	1	-14.30	11.1	4374	18	2	190 - 194	R.LNLEK.A
840	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	302	780.41	1558.81	780.43	1558.84	2	-15.91	18.6	4704	114	3	367 - 382	K.AVQSGLGTAAVIVMDK.S
840	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	119	446.22	1335.63	446.22	1335.65	3	-11.67	14.2	8618	34	2	95 - 105	K.GTDWIVNEMKK.S	Oxidation: 9
840	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	140	574.82	1147.62	574.82	1147.63	2	-14.41	14.7	8999	27	1	197 - 207	R.REAYAAGLLGK.N
840	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	405	826.09	2475.24	826.10	2475.27	3	-13.52	21.3	6855	42	3	441 - 463	K.QIEGHTICALGDAAAWPVQGLIR.H	Carbamidomethyl: 8
840	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	290	702.86	1403.70	702.87	1403.73	2	-16.71	18.3	9495	79	2	161 - 173	K.LLEGCLIAGVGMR.A	Oxidation: 12
840	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	24	637.80	1273.59	637.81	1273.61	2	-14.38	10.8	93531	17	2	53 - 63	K.THFGGLKDEDR.I
840	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	306	520.61	1558.82	520.62	1558.84	3	-14.90	18.7	7005	67	1	367 - 382	K.AVQSGLGTAAVIVMDK.S
879	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	369	694.86	1387.71	694.87	1387.73	2	-13.74	19.6	5850	66	2	161 - 173	K.LLEGCLIAGVGMR.A	Carbamidomethyl: 5
879	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	415	1128.60	3382.77	1128.61	3382.80	3	-8.44	20.8	4517	57	1	248 - 279	R.LKPPFPANAGLYGCPTTVTNVETVAVSPTILR.R	Carbamidomethyl: 14
879	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	189	1046.54	1045.53	1046.55	1045.54	1	-11.08	15.2	6833	18	1	383 - 392	K.STDVVDAIAR.L
879	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	446	762.85	1523.68	762.85	1523.69	2	-9.35	22.8	9914	58	2	410 - 421	R.EGTGWLWMIMER.M	Oxidation: 10
879	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	41	616.36	615.35	616.37	615.36	1	-9.27	11.1	11365	19	3	190 - 194	R.LNLEK.A
879	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	240	514.28	1026.54	514.28	1026.55	2	-10.31	16.3	5150	61	3	174 - 182	R.ASAAYIYIR.G
879	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	324	780.42	1558.82	780.43	1558.84	2	-10.76	18.6	17212	124	3	367 - 382	K.AVQSGLGTAAVIVMDK.S
879	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	257	788.42	1574.82	788.42	1574.83	2	-8.48	16.8	20816	118	3	367 - 382	K.AVQSGLGTAAVIVMDK.S	Oxidation: 14
879	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	379	724.37	1446.72	724.37	1446.73	2	-8.05	19.8	65305	25	3	429 - 440	K.LEEIDMLQEVTK.Q
879	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	426	770.84	1539.67	770.85	1539.69	2	-8.92	21	23702	63	4	410 - 421	R.EGTGWLWMIMER.M	Oxidation: 8
879	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	431	826.09	2475.25	826.10	2475.27	3	-8.27	21.2	31135	41	3	441 - 463	K.QIEGHTICALGDAAAWPVQGLIR.H	Carbamidomethyl: 8
879	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	428	770.84	1539.67	770.85	1539.69	2	-9.74	21.1	7625	42	4	410 - 421	R.EGTGWLWMIMER.M	Oxidation: 8
879	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	23	425.54	1273.59	425.54	1273.61	3	-8.68	10.6	22215	34	4	53 - 63	K.THFGGLKDEDR.I
879	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	27	637.80	1273.59	637.81	1273.61	2	-10.46	10.7	61901	21	2	53 - 63	K.THFGGLKDEDR.I
879	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	234	496.77	991.52	496.77	991.53	2	-11.19	16.2	3334	56	2	198 - 207	R.EAYAAGLLGK.N
879	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	311	702.86	1403.71	702.87	1403.73	2	-11.97	18.3	17033	80	2	161 - 173	K.LLEGCLIAGVGMR.A	Oxidation: 12
879	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	25	425.54	1273.59	425.54	1273.61	3	-8.19	10.7	33138	58	4	53 - 63	K.THFGGLKDEDR.I
879	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	389	585.27	1168.52	585.27	1168.53	2	-9.27	20.1	5022	50	3	281 - 290	R.GPEWFSSFGR.K
879	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	259	645.00	1931.98	645.00	1931.99	3	-6.35	16.8	51109	15	2	424 - 440	K.VGNAKLEEIDMLQEVTK.Q	Oxidation: 11
879	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	429	826.09	2475.25	826.10	2475.27	3	-6.10	21.1	17207	42	3	441 - 463	K.QIEGHTICALGDAAAWPVQGLIR.H	Carbamidomethyl: 8
879	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	423	770.84	1539.67	770.85	1539.69	2	-8.09	21	32887	62	4	410 - 421	R.EGTGWLWMIMER.M	Oxidation: 8
879	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	448	762.85	1523.68	762.85	1523.69	2	-8.65	22.9	9277	36	2	410 - 421	R.EGTGWLWMIMER.M	Oxidation: 8
879	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	316	442.55	1324.62	442.55	1324.63	3	-10.69	18.4	8636	39	2	280 - 290	R.RGPEWFSSFGR.K
879	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	309	702.86	1403.71	702.87	1403.73	2	-10.10	18.2	27584	91	2	161 - 173	K.LLEGCLIAGVGMR.A	Oxidation: 12
879	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	424	559.97	1676.87	559.97	1676.89	3	-10.60	21	31617	23	3	64 - 77	R.IFTNLYGLHDPFLK.G
879	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	254	788.42	1574.82	788.42	1574.83	2	-8.48	16.7	17551	117	3	367 - 382	K.AVQSGLGTAAVIVMDK.S	Oxidation: 14
879	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	366	694.86	1387.71	694.87	1387.73	2	-17.79	19.5	8259	67	2	161 - 173	K.LLEGCLIAGVGMR.A	Carbamidomethyl: 5
879	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	372	724.36	1446.71	724.37	1446.73	2	-9.35	19.7	3599	73	3	429 - 440	K.LEEIDMLQEVTK.Q
879	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	448	762.85	1523.68	762.85	1523.69	2	-8.65	22.9	9277	61	2	410 - 421	R.EGTGWLWMIMER.M	Oxidation: 10
879	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	330	639.66	1915.97	639.67	1915.99	3	-10.62	18.7	17095	34	1	424 - 440	K.VGNAKLEEIDMLQEVTK.Q
879	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	451	849.88	1697.75	849.89	1697.76	2	-5.94	23.4	11458	51	2	353 - 366	K.NICEDVLMDFDALK.A	Oxidation: 8
879	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	233	992.53	991.52	992.54	991.53	1	-11.15	16.1	4334	51	1	198 - 207	R.EAYAAGLLGK.N
879	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	263	440.89	1319.64	440.89	1319.65	3	-11.63	16.9	29159	26	1	95 - 105	K.GTDWIVNEMKK.S
879	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	26	637.80	1273.59	637.81	1273.61	2	-8.21	10.7	25653	30	2	53 - 63	K.THFGGLKDEDR.I
879	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	322	780.42	1558.82	780.43	1558.84	2	-13.05	18.5	7060	120	3	367 - 382	K.AVQSGLGTAAVIVMDK.S
879	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	266	732.36	1462.71	732.37	1462.72	2	-7.03	17	27182	90	2	429 - 440	K.LEEIDMLQEVTK.Q	Oxidation: 6
879	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	153	445.73	889.45	445.74	889.47	2	-13.59	14.3	11704	34	1	112 - 121	R.GGAGFPSGLK.W
879	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	184	715.39	714.38	715.40	714.39	1	-11.65	15.1	32597	36	3	480 - 486	R.ELLQAAA.-
879	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	185	523.77	1045.53	523.78	1045.54	2	-11.97	15.1	12396	54	3	383 - 392	K.STDVVDAIAR.L
879	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	325	520.61	1558.82	520.62	1558.84	3	-10.75	18.6	13011	81	2	367 - 382	K.AVQSGLGTAAVIVMDK.S
879	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	28	425.54	1273.59	425.54	1273.61	3	-11.36	10.7	17037	46	4	53 - 63	K.THFGGLKDEDR.I
879	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	271	732.36	1462.71	732.37	1462.72	2	-9.68	17	18772	68	2	429 - 440	K.LEEIDMLQEVTK.Q	Oxidation: 6
879	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	391	585.27	1168.52	585.27	1168.53	2	-10.06	20.2	22537	47	3	281 - 290	R.GPEWFSSFGR.K
879	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	450	849.88	1697.75	849.89	1697.76	2	-8.73	23.4	4031	51	2	353 - 366	K.NICEDVLMDFDALK.A	Oxidation: 8
879	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	37	616.36	615.35	616.37	615.36	1	-9.28	11	7595	20	3	190 - 194	R.LNLEK.A
879	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	236	514.28	1026.54	514.28	1026.55	2	-11.44	16.2	4339	61	3	174 - 182	R.ASAAYIYIR.G
879	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	214	410.71	819.41	410.72	819.42	2	-12.37	15.7	4538	23	3	393 - 398	R.LSYFYK.H
879	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	181	715.39	714.38	715.40	714.39	1	-10.72	15	8891	25	3	480 - 486	R.ELLQAAA.-
879	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	180	715.39	714.38	715.40	714.39	1	-11.53	15	5651	39	3	480 - 486	R.ELLQAAA.-
879	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	34	616.36	615.35	616.37	615.36	1	-8.20	10.9	5022	30	3	190 - 194	R.LNLEK.A
879	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	251	788.42	1574.82	788.42	1574.83	2	-7.64	16.6	16732	124	3	367 - 382	K.AVQSGLGTAAVIVMDK.S	Oxidation: 14
879	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	216	410.71	819.41	410.72	819.42	2	-11.57	15.8	9252	37	3	393 - 398	R.LSYFYK.H
879	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	190	523.77	1045.53	523.78	1045.54	2	-11.78	15.2	9494	67	3	383 - 392	K.STDVVDAIAR.L
879	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	144	446.22	1335.64	446.22	1335.65	3	-10.21	14.1	6653	30	2	95 - 105	K.GTDWIVNEMKK.S	Oxidation: 9
879	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	420	559.97	1676.88	559.97	1676.89	3	-8.51	20.9	11882	35	3	64 - 77	R.IFTNLYGLHDPFLK.G
879	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	386	585.27	1168.52	585.27	1168.53	2	-6.60	20	7199	50	3	281 - 290	R.GPEWFSSFGR.K
879	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	217	820.41	819.41	820.42	819.42	1	-11.58	15.8	8134	20	1	393 - 398	R.LSYFYK.H
879	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	162	574.82	1147.62	574.82	1147.63	2	-11.00	14.5	4012	28	1	197 - 207	R.REAYAAGLLGK.N
879	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	33	408.76	815.50	408.76	815.51	2	-11.53	10.9	19741	34	2	88 - 94	R.TKDLVLK.G
879	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	187	523.77	1045.53	523.78	1045.54	2	-11.07	15.1	25467	52	3	383 - 392	K.STDVVDAIAR.L
879	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	427	770.84	1539.67	770.85	1539.69	2	-8.99	21.1	20712	57	4	410 - 421	R.EGTGWLWMIMER.M	Oxidation: 8
879	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	11	433.70	865.39	433.70	865.39	2	-8.96	9.7	8259	36	3	183 - 189	R.GEYVNER.L
879	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	36	408.76	815.50	408.76	815.51	2	-11.90	11	22537	36	2	88 - 94	R.TKDLVLK.G
879	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	113	587.37	586.36	587.38	586.37	1	-13.01	13.4	6301	17	1	90 - 94	K.DLVLK.G
879	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	7	433.70	865.38	433.70	865.39	2	-10.43	9.6	7800	36	3	183 - 189	R.GEYVNER.L
879	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	327	780.42	1558.82	780.43	1558.84	2	-11.21	18.6	13690	120	3	367 - 382	K.AVQSGLGTAAVIVMDK.S
879	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	147	446.22	1335.63	446.22	1335.65	3	-10.88	14.2	12521	27	2	95 - 105	K.GTDWIVNEMKK.S	Oxidation: 9
879	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	430	826.09	2475.25	826.10	2475.27	3	-7.97	21.2	2212	36	3	441 - 463	K.QIEGHTICALGDAAAWPVQGLIR.H	Carbamidomethyl: 8
879	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	258	525.95	1574.82	525.95	1574.83	3	-8.47	16.8	94414	64	1	367 - 382	K.AVQSGLGTAAVIVMDK.S	Oxidation: 14
879	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	313	442.55	1324.62	442.55	1324.63	3	-9.52	18.3	4927	31	2	280 - 290	R.RGPEWFSSFGR.K
879	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	256	645.00	1931.97	645.00	1931.99	3	-6.83	16.7	29911	54	2	424 - 440	K.VGNAKLEEIDMLQEVTK.Q	Oxidation: 11
879	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	418	559.97	1676.87	559.97	1676.89	3	-11.28	20.8	18167	38	3	64 - 77	R.IFTNLYGLHDPFLK.G
879	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	237	514.28	1026.54	514.28	1026.55	2	-10.39	16.3	8009	61	3	174 - 182	R.ASAAYIYIR.G
879	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	446	762.85	1523.68	762.85	1523.69	2	-9.35	22.8	9914	33	2	410 - 421	R.EGTGWLWMIMER.M	Oxidation: 8
879	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	9	433.70	865.38	433.70	865.39	2	-10.78	9.6	21826	34	3	183 - 189	R.GEYVNER.L
879	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	24	425.54	1273.59	425.54	1273.61	3	-9.79	10.6	65305	53	4	53 - 63	K.THFGGLKDEDR.I
879	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	219	410.71	819.41	410.72	819.42	2	-11.13	15.9	4275	36	3	393 - 398	R.LSYFYK.H
879	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	329	520.61	1558.82	520.62	1558.84	3	-11.21	18.7	35090	51	2	367 - 382	K.AVQSGLGTAAVIVMDK.S
879	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	375	724.37	1446.72	724.37	1446.73	2	-7.78	19.8	8254	77	3	429 - 440	K.LEEIDMLQEVTK.Q
879	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	231	496.77	991.52	496.77	991.53	2	-11.13	16.1	5057	58	2	198 - 207	R.EAYAAGLLGK.N
934	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	421	585.28	1168.54	585.27	1168.53	2	5.71	20.1	2760	46	3	281 - 290	R.GPEWFSSFGR.K
934	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	43	425.54	1273.61	425.54	1273.61	3	2.55	10.6	30382	53	3	53 - 63	K.THFGGLKDEDR.I
934	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	256	406.19	810.37	406.19	810.37	2	1.28	15.9	7223	21	3	122 - 127	K.WSFMPK.V	Oxidation: 4
934	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	15	433.71	865.40	433.70	865.39	2	3.61	9.5	14389	39	3	183 - 189	R.GEYVNER.L
934	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	218	523.78	1045.54	523.78	1045.54	2	2.23	15.1	19435	50	3	383 - 392	K.STDVVDAIAR.L
934	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	246	410.72	819.42	410.72	819.42	2	1.14	15.7	37211	30	2	393 - 398	R.LSYFYK.H
934	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	50	408.76	815.51	408.76	815.51	2	0.31	10.8	9938	34	3	88 - 94	R.TKDLVLK.G
934	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	402	694.88	1387.74	694.87	1387.73	2	3.39	19.6	58223	101	3	161 - 173	K.LLEGCLIAGVGMR.A	Carbamidomethyl: 5
934	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	354	702.87	1403.73	702.87	1403.73	2	4.59	18.3	188887	69	2	161 - 173	K.LLEGCLIAGVGMR.A	Oxidation: 12
934	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	367	520.62	1558.84	520.62	1558.84	3	2.87	18.7	18649	77	1	367 - 382	K.AVQSGLGTAAVIVMDK.S
934	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	461	770.85	1539.70	770.85	1539.69	2	6.61	21.1	19807	46	3	410 - 421	R.EGTGWLWMIMER.M	Oxidation: 8
934	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	300	440.89	1319.66	440.89	1319.65	3	2.46	16.9	18547	39	2	95 - 105	K.GTDWIVNEMKK.S
934	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	17	433.71	865.40	433.70	865.39	2	3.10	9.6	21595	38	3	183 - 189	R.GEYVNER.L
934	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	409	724.38	1446.74	724.37	1446.73	2	5.50	19.8	5009	86	4	429 - 440	K.LEEIDMLQEVTK.Q
934	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	220	523.78	1045.54	523.78	1045.54	2	1.01	15.1	5083	64	3	383 - 392	K.STDVVDAIAR.L
934	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	269	514.28	1026.55	514.28	1026.55	2	2.68	16.2	7497	61	3	174 - 182	R.ASAAYIYIR.G
934	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	47	637.81	1273.61	637.81	1273.61	2	3.52	10.7	58223	24	3	53 - 63	K.THFGGLKDEDR.I
934	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	305	732.37	1462.73	732.37	1462.72	2	4.91	17	73755	95	3	429 - 440	K.LEEIDMLQEVTK.Q	Oxidation: 6
934	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	296	440.89	1319.66	440.89	1319.65	3	2.07	16.8	47828	48	2	95 - 105	K.GTDWIVNEMKK.S
934	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	462	826.10	2475.28	826.10	2475.27	3	3.74	21.3	23232	35	2	441 - 463	K.QIEGHTICALGDAAAWPVQGLIR.H	Carbamidomethyl: 8
934	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	264	496.78	991.54	496.77	991.53	2	2.40	16.1	7210	58	3	198 - 207	R.EAYAAGLLGK.N
934	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	360	596.79	1191.56	596.79	1191.56	2	3.48	18.5	39201	42	2	95 - 104	K.GTDWIVNEMK.K
934	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	221	1046.55	1045.54	1046.55	1045.54	1	1.01	15.1	9754	25	1	383 - 392	K.STDVVDAIAR.L
934	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	249	410.72	819.42	410.72	819.42	2	0.24	15.8	6637	42	2	393 - 398	R.LSYFYK.H
934	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	263	496.77	991.53	496.77	991.53	2	-1.79	16.1	12659	62	3	198 - 207	R.EAYAAGLLGK.N
934	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	270	514.28	1026.55	514.28	1026.55	2	2.41	16.3	6936	57	3	174 - 182	R.ASAAYIYIR.G
934	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	422	585.28	1168.54	585.27	1168.53	2	5.71	20.2	31273	48	3	281 - 290	R.GPEWFSSFGR.K
934	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	301	660.84	1319.66	660.83	1319.65	2	2.45	16.9	5822	19	2	95 - 105	K.GTDWIVNEMKK.S
934	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	268	992.54	991.54	992.54	991.53	1	3.02	16.2	8114	40	2	198 - 207	R.EAYAAGLLGK.N
934	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	419	585.27	1168.53	585.27	1168.53	2	1.70	20.1	10768	56	3	281 - 290	R.GPEWFSSFGR.K
934	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	460	770.86	1539.70	770.85	1539.69	2	8.12	21.1	26720	52	3	410 - 421	R.EGTGWLWMIMER.M	Oxidation: 8
934	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	14	433.71	865.40	433.70	865.39	2	3.36	9.5	23787	31	3	183 - 189	R.GEYVNER.L
934	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	250	820.42	819.42	820.42	819.42	1	0.25	15.8	7503	23	2	393 - 398	R.LSYFYK.H
934	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	44	637.81	1273.61	637.81	1273.61	2	2.55	10.6	74381	63	3	53 - 63	K.THFGGLKDEDR.I
934	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	287	788.43	1574.84	788.42	1574.83	2	3.13	16.6	23582	120	3	367 - 382	K.AVQSGLGTAAVIVMDK.S	Oxidation: 14
934	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	399	694.88	1387.74	694.87	1387.73	2	3.95	19.5	74381	76	3	161 - 173	K.LLEGCLIAGVGMR.A	Carbamidomethyl: 5
934	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	411	724.37	1446.74	724.37	1446.73	2	5.25	19.8	9174	95	4	429 - 440	K.LEEIDMLQEVTK.Q
934	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	247	820.42	819.42	820.42	819.42	1	1.15	15.7	5197	32	2	393 - 398	R.LSYFYK.H
934	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	46	637.81	1273.61	637.81	1273.61	2	2.71	10.7	29907	31	3	53 - 63	K.THFGGLKDEDR.I
934	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	363	780.43	1558.84	780.43	1558.84	2	1.89	18.6	84149	84	3	367 - 382	K.AVQSGLGTAAVIVMDK.S
934	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	57	408.76	815.51	408.76	815.51	2	-0.06	10.9	7482	42	3	88 - 94	R.TKDLVLK.G
934	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	359	442.55	1324.64	442.55	1324.63	3	4.31	18.5	2834	31	2	280 - 290	R.RGPEWFSSFGR.K
934	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	53	408.76	815.51	408.76	815.51	2	0.68	10.9	7281	26	3	88 - 94	R.TKDLVLK.G
934	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	209	715.40	714.39	715.40	714.39	1	4.54	14.9	4123	22	2	480 - 486	R.ELLQAAA.-
934	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	267	496.78	991.54	496.77	991.53	2	3.02	16.2	3800	60	3	198 - 207	R.EAYAAGLLGK.N
934	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	193	445.74	889.47	445.74	889.47	2	1.50	14.5	21963	41	3	112 - 121	R.GGAGFPSGLK.W
934	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	400	694.87	1387.74	694.87	1387.73	2	2.71	19.6	26691	76	3	161 - 173	K.LLEGCLIAGVGMR.A	Carbamidomethyl: 5
934	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	302	732.37	1462.73	732.37	1462.72	2	4.23	17	37916	93	3	429 - 440	K.LEEIDMLQEVTK.Q	Oxidation: 6
934	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	453	559.97	1676.90	559.97	1676.89	3	5.10	20.9	3232	47	3	64 - 77	R.IFTNLYGLHDPFLK.G
934	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	211	715.40	714.39	715.40	714.39	1	3.47	14.9	5529	33	2	480 - 486	R.ELLQAAA.-
934	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	410	724.38	1446.74	724.37	1446.73	2	6.18	19.8	27396	81	4	429 - 440	K.LEEIDMLQEVTK.Q
934	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	223	523.78	1045.54	523.78	1045.54	2	2.23	15.2	13580	50	3	383 - 392	K.STDVVDAIAR.L
934	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	192	574.82	1147.63	574.82	1147.63	2	-0.39	14.5	14834	31	1	197 - 207	R.REAYAAGLLGK.N
934	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	299	732.37	1462.73	732.37	1462.72	2	3.83	16.9	27062	89	3	429 - 440	K.LEEIDMLQEVTK.Q	Oxidation: 6
934	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	456	559.97	1676.90	559.97	1676.89	3	5.19	21	18787	45	3	64 - 77	R.IFTNLYGLHDPFLK.G
934	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	463	826.10	2475.28	826.10	2475.27	3	4.39	21.3	24036	58	2	441 - 463	K.QIEGHTICALGDAAAWPVQGLIR.H	Carbamidomethyl: 8
934	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	355	442.55	1324.63	442.55	1324.63	3	2.23	18.4	18836	33	2	280 - 290	R.RGPEWFSSFGR.K
934	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	42	425.54	1273.61	425.54	1273.61	3	2.34	10.6	37175	63	3	53 - 63	K.THFGGLKDEDR.I
934	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	188	445.74	889.47	445.74	889.47	2	1.53	14.4	17294	43	3	112 - 121	R.GGAGFPSGLK.W
934	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	407	724.38	1446.74	724.37	1446.73	2	6.40	19.7	7611	89	4	429 - 440	K.LEEIDMLQEVTK.Q
934	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	177	446.22	1335.65	446.22	1335.65	3	2.74	14.1	10625	24	2	95 - 105	K.GTDWIVNEMKK.S	Oxidation: 9
934	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	292	788.43	1574.84	788.42	1574.83	2	1.84	16.7	22032	125	3	367 - 382	K.AVQSGLGTAAVIVMDK.S	Oxidation: 14
934	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	304	488.58	1462.73	488.58	1462.72	3	4.22	17	25668	35	1	429 - 440	K.LEEIDMLQEVTK.Q	Oxidation: 6
934	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	261	406.19	810.37	406.19	810.37	2	1.75	16.1	12557	19	3	122 - 127	K.WSFMPK.V	Oxidation: 4
934	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	361	596.79	1191.57	596.79	1191.56	2	6.94	18.5	14960	56	2	95 - 104	K.GTDWIVNEMK.K
934	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	450	559.97	1676.90	559.97	1676.89	3	3.88	20.8	5190	42	3	64 - 77	R.IFTNLYGLHDPFLK.G
934	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	298	660.84	1319.66	660.83	1319.65	2	2.08	16.9	41344	44	2	95 - 105	K.GTDWIVNEMKK.S
934	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	370	780.43	1558.84	780.43	1558.84	2	1.62	18.7	14389	104	3	367 - 382	K.AVQSGLGTAAVIVMDK.S
934	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	258	406.19	810.37	406.19	810.37	2	0.22	16	4753	17	3	122 - 127	K.WSFMPK.V	Oxidation: 4
934	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	290	788.43	1574.84	788.42	1574.83	2	1.56	16.7	45031	133	3	367 - 382	K.AVQSGLGTAAVIVMDK.S	Oxidation: 14
934	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	366	780.43	1558.84	780.43	1558.84	2	2.88	18.6	75561	96	3	367 - 382	K.AVQSGLGTAAVIVMDK.S
934	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	265	992.54	991.54	992.54	991.53	1	2.41	16.1	12707	54	2	198 - 207	R.EAYAAGLLGK.N
934	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	458	770.85	1539.69	770.85	1539.69	2	5.28	21	40265	43	3	410 - 421	R.EGTGWLWMIMER.M	Oxidation: 8
934	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	273	514.28	1026.55	514.28	1026.55	2	2.31	16.3	13641	54	3	174 - 182	R.ASAAYIYIR.G
934	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	186	445.74	889.47	445.74	889.47	2	-0.18	14.3	11610	40	3	112 - 121	R.GGAGFPSGLK.W
934	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	445	1128.61	3382.81	1128.61	3382.80	3	4.76	20.7	10475	82	1	248 - 279	R.LKPPFPANAGLYGCPTTVTNVETVAVSPTILR.R	Carbamidomethyl: 14
934	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	45	425.54	1273.61	425.54	1273.61	3	2.69	10.7	26691	62	3	53 - 63	K.THFGGLKDEDR.I
934	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	349	702.87	1403.73	702.87	1403.73	2	2.71	18.2	6818	95	2	161 - 173	K.LLEGCLIAGVGMR.A	Oxidation: 12
934	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	175	446.23	1335.66	446.22	1335.65	3	6.26	14.1	7318	35	2	95 - 105	K.GTDWIVNEMKK.S	Oxidation: 9
987	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	5	433.71	865.41	433.70	865.39	2	17.33	9.5	13966	43	4	183 - 189	R.GEYVNER.L
987	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	33	408.77	815.52	408.76	815.51	2	13.89	10.9	6429	41	3	88 - 94	R.TKDLVLK.G
987	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	493	841.91	1681.80	841.89	1681.77	2	18.80	23.9	4481	63	2	353 - 366	K.NICEDVLMDFDALK.A	Carbamidomethyl: 3
987	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	213	406.20	810.39	406.19	810.37	2	16.50	15.9	47279	16	2	122 - 127	K.WSFMPK.V	Oxidation: 4
987	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	362	694.89	1387.76	694.87	1387.73	2	18.43	19.5	16518	81	2	161 - 173	K.LLEGCLIAGVGMR.A	Carbamidomethyl: 5
987	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	389	585.28	1168.55	585.27	1168.53	2	19.64	20.1	3951	50	2	281 - 290	R.GPEWFSSFGR.K
987	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	420	839.47	1676.92	839.45	1676.89	2	17.52	20.8	6116	45	2	64 - 77	R.IFTNLYGLHDPFLK.G
987	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	365	694.88	1387.75	694.87	1387.73	2	16.46	19.6	19129	63	2	161 - 173	K.LLEGCLIAGVGMR.A	Carbamidomethyl: 5
987	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	221	496.78	991.55	496.77	991.53	2	15.46	16.1	23587	61	3	198 - 207	R.EAYAAGLLGK.N
987	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	311	442.56	1324.65	442.55	1324.63	3	15.59	18.4	4190	42	2	280 - 290	R.RGPEWFSSFGR.K
987	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	247	525.96	1574.87	525.95	1574.83	3	19.94	16.7	13306	70	3	367 - 382	K.AVQSGLGTAAVIVMDK.S	Oxidation: 14
987	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	150	574.83	1147.65	574.82	1147.63	2	13.06	14.4	5148	32	3	197 - 207	R.REAYAAGLLGK.N
987	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	164	715.41	714.40	715.40	714.39	1	17.44	14.8	6993	31	3	480 - 486	R.ELLQAAA.-
987	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	371	724.39	1446.76	724.37	1446.73	2	19.53	19.7	19085	68	2	429 - 440	K.LEEIDMLQEVTK.Q
987	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	167	715.41	714.40	715.40	714.39	1	19.02	14.9	5336	30	3	480 - 486	R.ELLQAAA.-
987	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	243	788.44	1574.86	788.42	1574.83	2	18.79	16.6	20859	115	3	367 - 382	K.AVQSGLGTAAVIVMDK.S	Oxidation: 14
987	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	215	406.20	810.39	406.19	810.37	2	14.65	16	13039	17	2	122 - 127	K.WSFMPK.V	Oxidation: 4
987	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	153	574.83	1147.65	574.82	1147.63	2	15.60	14.5	9173	32	3	197 - 207	R.REAYAAGLLGK.N
987	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	32	408.77	815.52	408.76	815.51	2	13.06	10.8	4028	25	3	88 - 94	R.TKDLVLK.G
987	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	484	566.94	1697.79	566.93	1697.76	3	16.72	23.5	5750	33	1	353 - 366	K.NICEDVLMDFDALK.A	Oxidation: 8
987	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	36	408.77	815.52	408.76	815.51	2	13.06	10.9	5578	27	3	88 - 94	R.TKDLVLK.G
987	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	162	715.41	714.40	715.40	714.39	1	14.90	14.7	24231	33	3	480 - 486	R.ELLQAAA.-
987	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	323	780.44	1558.87	780.43	1558.84	2	18.57	18.6	12958	108	2	367 - 382	K.AVQSGLGTAAVIVMDK.S
987	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	21	425.55	1273.63	425.54	1273.61	3	16.11	10.6	35022	66	3	53 - 63	K.THFGGLKDEDR.I
987	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	9	433.71	865.41	433.70	865.39	2	17.68	9.6	11946	36	4	183 - 189	R.GEYVNER.L
987	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	260	732.38	1462.75	732.37	1462.72	2	18.89	17	4054	101	2	429 - 440	K.LEEIDMLQEVTK.Q	Oxidation: 6
987	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	480	849.90	1697.79	849.89	1697.76	2	16.92	23.4	5925	69	2	353 - 366	K.NICEDVLMDFDALK.A	Oxidation: 8
987	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	140	445.74	889.47	445.74	889.47	2	0.45	14.2	15290	25	3	112 - 121	R.GGAGFPSGLK.W
987	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	422	559.98	1676.92	559.97	1676.89	3	16.90	20.9	12560	57	3	64 - 77	R.IFTNLYGLHDPFLK.G
987	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	320	780.44	1558.87	780.43	1558.84	2	17.42	18.6	72880	107	2	367 - 382	K.AVQSGLGTAAVIVMDK.S
987	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	394	585.28	1168.55	585.27	1168.53	2	19.32	20.2	8298	24	2	281 - 290	R.GPEWFSSFGR.K
987	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	176	523.79	1045.56	523.78	1045.54	2	16.40	15.1	3779	66	3	383 - 392	K.STDVVDAIAR.L
987	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	428	770.86	1539.71	770.85	1539.69	2	18.74	21	258214	54	1	410 - 421	R.EGTGWLWMIMER.M	Oxidation: 8
987	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	39	542.30	1082.58	542.29	1082.56	2	14.79	11.1	8298	22	2	464 - 471	R.HFRPELER.R
987	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	230	514.29	1026.57	514.28	1026.55	2	16.19	16.3	3654	61	3	174 - 182	R.ASAAYIYIR.G
987	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	374	724.39	1446.76	724.37	1446.73	2	19.78	19.8	91035	86	2	429 - 440	K.LEEIDMLQEVTK.Q
987	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	99	587.38	586.38	587.38	586.37	1	11.78	13.3	4058	17	1	90 - 94	K.DLVLK.G
987	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	423	839.47	1676.92	839.45	1676.89	2	16.90	20.9	8666	31	2	64 - 77	R.IFTNLYGLHDPFLK.G
987	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	203	410.72	819.43	410.72	819.42	2	14.90	15.7	4068	33	3	393 - 398	R.LSYFYK.H
987	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	250	525.96	1574.86	525.95	1574.83	3	18.91	16.8	9018	62	3	367 - 382	K.AVQSGLGTAAVIVMDK.S	Oxidation: 14
987	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	219	496.78	991.55	496.77	991.53	2	14.60	16.1	7181	59	3	198 - 207	R.EAYAAGLLGK.N
987	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	482	849.90	1697.79	849.89	1697.76	2	16.72	23.5	11559	86	2	353 - 366	K.NICEDVLMDFDALK.A	Oxidation: 8
987	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	155	445.75	889.48	445.74	889.47	2	14.72	14.6	5743	40	3	112 - 121	R.GGAGFPSGLK.W
987	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	208	820.44	819.43	820.42	819.42	1	16.07	15.8	24696	34	3	393 - 398	R.LSYFYK.H
987	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	19	425.55	1273.62	425.54	1273.61	3	15.57	10.5	91035	56	3	53 - 63	K.THFGGLKDEDR.I
987	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	174	1046.57	1045.56	1046.55	1045.54	1	17.64	15	34397	40	1	383 - 392	K.STDVVDAIAR.L
987	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	4	433.71	865.41	433.70	865.39	2	16.18	9.5	46873	33	4	183 - 189	R.GEYVNER.L
987	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	469	762.87	1523.72	762.85	1523.69	2	17.41	22.9	2893	30	1	410 - 421	R.EGTGWLWMIMER.M	Oxidation: 8
987	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	240	788.44	1574.86	788.42	1574.83	2	17.46	16.6	24445	101	3	367 - 382	K.AVQSGLGTAAVIVMDK.S	Oxidation: 14
987	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	173	523.79	1045.56	523.78	1045.54	2	17.62	15	3521	52	3	383 - 392	K.STDVVDAIAR.L
987	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	413	1128.63	3382.86	1128.61	3382.80	3	18.31	20.7	39932	41	2	248 - 279	R.LKPPFPANAGLYGCPTTVTNVETVAVSPTILR.R	Carbamidomethyl: 14
987	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	246	788.44	1574.87	788.42	1574.83	2	19.95	16.7	3570	113	3	367 - 382	K.AVQSGLGTAAVIVMDK.S	Oxidation: 14
987	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	223	992.56	991.55	992.54	991.53	1	15.48	16.1	3664	56	2	198 - 207	R.EAYAAGLLGK.N
987	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	227	514.29	1026.57	514.28	1026.55	2	15.90	16.3	24459	57	3	174 - 182	R.ASAAYIYIR.G
987	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	225	514.29	1026.57	514.28	1026.55	2	16.10	16.2	12557	47	3	174 - 182	R.ASAAYIYIR.G
987	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	206	410.72	819.43	410.72	819.42	2	16.06	15.8	7117	33	3	393 - 398	R.LSYFYK.H
987	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	41	542.30	1082.58	542.29	1082.56	2	16.47	11.2	25604	18	2	464 - 471	R.HFRPELER.R
987	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	200	410.72	819.43	410.72	819.42	2	15.97	15.6	8625	34	3	393 - 398	R.LSYFYK.H
987	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	154	574.83	1147.65	574.82	1147.63	2	17.06	14.6	4309	36	3	197 - 207	R.REAYAAGLLGK.N
987	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	419	559.98	1676.92	559.97	1676.89	3	17.51	20.8	6100	60	3	64 - 77	R.IFTNLYGLHDPFLK.G
987	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	411	1128.63	3382.86	1128.61	3382.80	3	19.36	20.6	8257	52	2	248 - 279	R.LKPPFPANAGLYGCPTTVTNVETVAVSPTILR.R	Carbamidomethyl: 14
987	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	204	820.44	819.43	820.42	819.42	1	14.91	15.7	10319	32	3	393 - 398	R.LSYFYK.H
987	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	469	762.87	1523.72	762.85	1523.69	2	17.41	22.9	2893	53	1	410 - 421	R.EGTGWLWMIMER.M	Oxidation: 10
987	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	3	433.71	865.41	433.70	865.39	2	17.77	9.5	19663	38	4	183 - 189	R.GEYVNER.L
987	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	321	520.63	1558.87	520.62	1558.84	3	17.41	18.6	11425	90	2	367 - 382	K.AVQSGLGTAAVIVMDK.S
987	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	244	525.96	1574.86	525.95	1574.83	3	18.78	16.6	4866	65	3	367 - 382	K.AVQSGLGTAAVIVMDK.S	Oxidation: 14
987	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	324	520.63	1558.87	520.62	1558.84	3	18.56	18.6	15657	83	2	367 - 382	K.AVQSGLGTAAVIVMDK.S
987	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	18	425.55	1273.63	425.54	1273.61	3	16.42	10.5	5513	34	3	53 - 63	K.THFGGLKDEDR.I
987	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	137	446.23	1335.67	446.22	1335.65	3	16.89	14.2	5737	22	1	95 - 105	K.GTDWIVNEMKK.S	Oxidation: 9
987	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	171	523.79	1045.56	523.78	1045.54	2	16.59	15	5721	48	3	383 - 392	K.STDVVDAIAR.L
987	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	418	559.98	1676.91	559.97	1676.89	3	12.88	20.8	3337	44	3	64 - 77	R.IFTNLYGLHDPFLK.G
987	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	144	536.30	1070.59	536.29	1070.57	2	13.67	14.3	10176	39	1	477 - 486	R.AERELLQAAA.-
987	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	431	826.11	2475.32	826.10	2475.27	3	19.39	21.1	202946	73	1	441 - 463	K.QIEGHTICALGDAAAWPVQGLIR.H	Carbamidomethyl: 8
987	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	22	637.82	1273.63	637.81	1273.61	2	16.13	10.6	71267	31	2	53 - 63	K.THFGGLKDEDR.I
987	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	306	702.88	1403.75	702.87	1403.73	2	18.39	18.2	22057	96	2	161 - 173	K.LLEGCLIAGVGMR.A	Oxidation: 12
987	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	202	820.44	819.43	820.42	819.42	1	15.98	15.7	7412	34	3	393 - 398	R.LSYFYK.H
987	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	259	440.90	1319.68	440.89	1319.65	3	15.66	17	5191	36	2	95 - 105	K.GTDWIVNEMKK.S
987	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	20	637.82	1273.63	637.81	1273.61	2	15.60	10.5	51682	58	2	53 - 63	K.THFGGLKDEDR.I
987	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	491	841.91	1681.80	841.89	1681.77	2	18.89	23.9	22444	41	2	353 - 366	K.NICEDVLMDFDALK.A	Carbamidomethyl: 3
987	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	142	445.74	889.47	445.74	889.47	2	10.14	14.3	25341	29	3	112 - 121	R.GGAGFPSGLK.W
987	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	303	702.88	1403.75	702.87	1403.73	2	19.67	18.2	5082	84	2	161 - 173	K.LLEGCLIAGVGMR.A	Oxidation: 12
987	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	314	442.56	1324.65	442.55	1324.63	3	15.34	18.4	7404	35	2	280 - 290	R.RGPEWFSSFGR.K
987	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	257	732.38	1462.75	732.37	1462.72	2	19.09	17	4318	83	2	429 - 440	K.LEEIDMLQEVTK.Q	Oxidation: 6
987	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	224	496.78	991.55	496.77	991.53	2	15.06	16.2	27205	58	3	198 - 207	R.EAYAAGLLGK.N
987	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	255	440.90	1319.68	440.89	1319.65	3	16.18	16.9	7028	49	2	95 - 105	K.GTDWIVNEMKK.S
987	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	220	992.56	991.55	992.54	991.53	1	14.61	16.1	3664	57	2	198 - 207	R.EAYAAGLLGK.N
1049	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	192	496.78	991.55	496.77	991.53	2	12.60	16.4	4341	17	3	198 - 207	R.EAYAAGLLGK.N
1049	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	154	536.30	1070.59	536.29	1070.57	2	13.77	14.6	7514	34	1	477 - 486	R.AERELLQAAA.-
1049	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	193	496.78	991.54	496.77	991.53	2	9.16	16.4	8451	41	3	198 - 207	R.EAYAAGLLGK.N
1049	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	183	523.78	1045.55	523.78	1045.54	2	13.00	15.4	4935	43	1	383 - 392	K.STDVVDAIAR.L
1049	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	196	496.78	991.54	496.77	991.53	2	10.69	16.5	8371	26	3	198 - 207	R.EAYAAGLLGK.N
1049	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	174	715.41	714.40	715.40	714.39	1	16.94	15.2	4669	23	1	480 - 486	R.ELLQAAA.-
1106	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	169	523.79	1045.56	523.78	1045.54	2	18.63	15.1	4164	46	2	383 - 392	K.STDVVDAIAR.L
1106	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	188	514.29	1026.56	514.28	1026.55	2	11.84	16.3	4153	49	2	174 - 182	R.ASAAYIYIR.G
1106	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	171	523.79	1045.56	523.78	1045.54	2	16.02	15.2	7146	53	2	383 - 392	K.STDVVDAIAR.L
1106	AT5G08530.1	51 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	189	514.29	1026.56	514.28	1026.55	2	9.25	16.4	6101	47	2	174 - 182	R.ASAAYIYIR.G
705	AT3G46430.1	6 kDa subunit (At3g46430/At5g59613)	complex V	a) oxidative phosphorylation	mitochondria	29	574.30	1146.58	574.30	1146.58	2	1.68	12.9	3993	62	3	35 - 45	K.LTAGLTEEDAK.N
705	AT3G46430.1	6 kDa subunit (At3g46430/At5g59613)	complex V	a) oxidative phosphorylation	mitochondria	31	574.30	1146.58	574.30	1146.58	2	0.99	13	17821	63	3	35 - 45	K.LTAGLTEEDAK.N
705	AT3G46430.1	6 kDa subunit (At3g46430/At5g59613)	complex V	a) oxidative phosphorylation	mitochondria	246	648.35	1294.68	648.34	1294.68	2	2.46	24.8	5171	27	2	3 - 12	R.LFDPWPVFFK.R
705	AT3G46430.1	6 kDa subunit (At3g46430/At5g59613)	complex V	a) oxidative phosphorylation	mitochondria	245	648.34	1294.67	648.34	1294.68	2	-7.02	24.8	4306	34	2	3 - 12	R.LFDPWPVFFK.R
705	AT3G46430.1	6 kDa subunit (At3g46430/At5g59613)	complex V	a) oxidative phosphorylation	mitochondria	30	574.30	1146.58	574.30	1146.58	2	-0.96	13	15405	79	3	35 - 45	K.LTAGLTEEDAK.N
774	AT3G46430.1	6 kDa subunit (At3g46430/At5g59613)	complex V	a) oxidative phosphorylation	mitochondria	158	648.34	1294.66	648.34	1294.68	2	-10.43	24.7	4998	30	2	3 - 12	R.LFDPWPVFFK.R
774	AT3G46430.1	6 kDa subunit (At3g46430/At5g59613)	complex V	a) oxidative phosphorylation	mitochondria	159	648.34	1294.66	648.34	1294.68	2	-9.69	24.7	6012	31	2	3 - 12	R.LFDPWPVFFK.R
774	AT3G46430.1	6 kDa subunit (At3g46430/At5g59613)	complex V	a) oxidative phosphorylation	mitochondria	17	574.29	1146.57	574.30	1146.58	2	-4.85	12.9	3612	72	3	35 - 45	K.LTAGLTEEDAK.N
774	AT3G46430.1	6 kDa subunit (At3g46430/At5g59613)	complex V	a) oxidative phosphorylation	mitochondria	19	574.29	1146.57	574.30	1146.58	2	-9.46	13	13682	59	3	35 - 45	K.LTAGLTEEDAK.N
774	AT3G46430.1	6 kDa subunit (At3g46430/At5g59613)	complex V	a) oxidative phosphorylation	mitochondria	18	574.29	1146.57	574.30	1146.58	2	-8.83	12.9	19591	61	3	35 - 45	K.LTAGLTEEDAK.N
101	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	206	671.38	1340.75	671.39	1340.76	2	-7.37	20.5	4195	75	3	511 - 523	K.NPAIIVGAGLFNR.T
101	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	31	480.75	959.48	480.75	959.49	2	-8.12	12.4	4983	68	1	449 - 457	R.VEAAMVNAR.I
101	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	210	816.44	1630.86	816.44	1630.87	2	-2.10	20.7	8961	73	2	227 - 242	R.FASEVAGVQDLGILGR.G
101	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	9	488.74	975.47	488.75	975.48	2	-9.23	10.2	4050	42	2	449 - 457	R.VEAAMVNAR.I	Oxidation: 5
101	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	208	671.38	1340.75	671.39	1340.76	2	-7.43	20.6	6108	40	3	511 - 523	K.NPAIIVGAGLFNR.T
101	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	10	488.74	975.47	488.75	975.48	2	-9.61	10.2	7277	41	2	449 - 457	R.VEAAMVNAR.I	Oxidation: 5
101	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	209	816.44	1630.87	816.44	1630.87	2	-1.03	20.7	3840	83	2	227 - 242	R.FASEVAGVQDLGILGR.G
101	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	49	491.57	1471.67	491.57	1471.68	3	-7.14	13.4	4057	34	1	597 - 609	K.DAFVVYQGHHGDK.A
101	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	207	671.38	1340.75	671.39	1340.76	2	-1.33	20.5	8902	65	3	511 - 523	K.NPAIIVGAGLFNR.T
101	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	36	445.73	889.45	445.73	889.44	2	1.39	12.8	6049	22	2	111 - 118	R.LSIAGNCR.M	Carbamidomethyl: 7
101	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	37	445.73	889.44	445.73	889.44	2	-3.95	12.8	8677	32	2	111 - 118	R.LSIAGNCR.M	Carbamidomethyl: 7
175	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	82	671.38	1340.74	671.39	1340.76	2	-9.88	20.1	6703	42	2	511 - 523	K.NPAIIVGAGLFNR.T
175	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	81	671.38	1340.74	671.39	1340.76	2	-10.59	20	4364	57	2	511 - 523	K.NPAIIVGAGLFNR.T
175	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	83	816.44	1630.86	816.44	1630.87	2	-5.54	20.3	5215	44	1	227 - 242	R.FASEVAGVQDLGILGR.G
175	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	66	647.33	1938.96	647.33	1938.98	3	-10.37	17.6	3964	27	1	580 - 596	K.FVYLMGADDVNVDKIPK.D	Oxidation: 5
249	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	46	519.78	1037.54	519.78	1037.55	2	-10.69	11.47681667	5462	62	5	484 - 493	K.HLGTGPDTLK.E
249	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	17	488.74	975.47	488.75	975.48	2	-14.03	10.09955	78892	72	3	449 - 457	R.VEAAMVNAR.I	Oxidation: 5
249	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	148	423.59	1267.74	423.59	1267.75	3	-11.34	15.31320833	82392	46	2	201 - 212	R.SVVDKNLGPLVK.T
249	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	280	671.38	1340.75	671.39	1340.76	2	-7.46	20.41720833	78910	89	4	511 - 523	K.NPAIIVGAGLFNR.T
249	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	286	544.63	1630.86	544.63	1630.87	3	-5.32	20.63271667	6068	71	2	227 - 242	R.FASEVAGVQDLGILGR.G
249	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	73	445.73	889.44	445.73	889.44	2	-9.58	12.71795	22516	32	2	111 - 118	R.LSIAGNCR.M	Carbamidomethyl: 7
249	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	153	423.59	1267.73	423.59	1267.75	3	-12.29	15.43398333	19105	23	2	201 - 212	R.SVVDKNLGPLVK.T
249	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	134	454.59	1360.74	454.59	1360.76	3	-14.66	14.85651667	22235	51	1	734 - 745	K.IMAQCSAVLLKK.-	Carbamidomethyl: 5
249	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	92	491.56	1471.67	491.57	1471.68	3	-10.89	13.34926667	17570	48	3	597 - 609	K.DAFVVYQGHHGDK.A
249	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	23	435.19	868.36	435.19	868.37	2	-10.98	10.30156667	9561	35	2	105 - 110	R.FCYHSR.L	Carbamidomethyl: 2
249	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	197	621.30	1860.87	621.30	1860.89	3	-8.69	16.899675	62089	63	1	319 - 333	R.LNEDINEEWISDKTR.F
249	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	137	416.22	830.42	416.22	830.43	2	-12.71	14.95054167	21976	40	1	344 - 350	R.LSDPMIR.D
249	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	283	671.38	1340.75	671.39	1340.76	2	-8.51	20.51121667	41976	89	4	511 - 523	K.NPAIIVGAGLFNR.T
249	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	110	529.75	1057.49	529.76	1057.50	2	-12.13	14.11784167	19189	28	1	334 - 341	R.FCYDGLKR.Q	Carbamidomethyl: 2
249	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	2	419.18	836.35	419.19	836.36	2	-14.37	8.71809167	15556	29	2	218 - 223	R.CIQCTR.C	Carbamidomethyl: 1
249	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	29	493.79	985.57	493.80	985.58	2	-14.53	10.55778333	17435	73	1	144 - 152	K.IKTDTPIAK.K
249	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	175	574.30	1146.59	574.31	1146.60	2	-10.34	16.17370833	24825	54	2	668 - 677	K.LPYNSIEGVR.S
249	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	85	446.56	1336.66	446.57	1336.67	3	-13.03	13.09401667	13581	30	2	682 - 693	K.SVAPNLVHTDER.E
249	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	124	634.80	1267.58	634.80	1267.59	2	-8.01	14.56111667	95448	88	2	243 - 254	R.GSGEEIGTYVEK.L
249	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	129	634.80	1267.58	634.80	1267.59	2	-7.85	14.6819	39785	75	2	243 - 254	R.GSGEEIGTYVEK.L
249	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	279	671.38	1340.74	671.39	1340.76	2	-8.80	20.376725	37975	73	4	511 - 523	K.NPAIIVGAGLFNR.T
249	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	48	519.78	1037.54	519.78	1037.55	2	-11.27	11.55774167	29012	56	5	484 - 493	K.HLGTGPDTLK.E
249	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	245	673.36	2017.07	673.37	2017.08	3	-8.38	18.41745	34652	62	3	659 - 677	R.ALSEVSGVKLPYNSIEGVR.S
249	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	49	519.78	1037.54	519.78	1037.55	2	-11.07	11.5982	28452	52	5	484 - 493	K.HLGTGPDTLK.E
249	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	172	574.30	1146.59	574.31	1146.60	2	-9.47	16.07970833	43351	52	2	668 - 677	K.LPYNSIEGVR.S
249	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	263	641.99	1922.96	642.00	1922.98	3	-9.98	19.44403333	6144	46	2	580 - 596	K.FVYLMGADDVNVDKIPK.D
249	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	190	617.33	1232.65	617.34	1232.66	2	-9.60	16.64444167	6033	61	2	734 - 744	K.IMAQCSAVLLK.K	Carbamidomethyl: 5
249	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	201	549.94	1646.80	549.94	1646.81	3	-6.95	17.00706667	10641	49	2	289 - 304	K.ATETIDVSDAVGSNIR.V
249	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	102	459.92	1376.73	459.92	1376.75	3	-13.92	13.8626	57340	55	2	734 - 745	K.IMAQCSAVLLKK.-	Oxidation: 2
249	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	72	487.24	972.47	487.25	972.49	2	-13.62	12.70456667	9711	32	1	500 - 507	R.HPFCTALK.N	Carbamidomethyl: 4
249	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	15	488.74	975.47	488.75	975.48	2	-14.24	10.01860833	7286	85	3	449 - 457	R.VEAAMVNAR.I	Oxidation: 5
249	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	248	680.87	1359.72	680.88	1359.74	2	-11.73	18.51168333	7031	41	3	614 - 626	R.ANVILPASAFTEK.E
249	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	199	549.94	1646.80	549.94	1646.81	3	-7.50	16.92645	14642	82	2	289 - 304	K.ATETIDVSDAVGSNIR.V
249	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	252	680.87	1359.73	680.88	1359.74	2	-8.94	18.64616667	71020	53	3	614 - 626	R.ANVILPASAFTEK.E
249	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	288	544.63	1630.86	544.63	1630.87	3	-5.14	20.69993333	9988	58	2	227 - 242	R.FASEVAGVQDLGILGR.G
249	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	240	673.36	2017.07	673.37	2017.08	3	-7.49	18.25621667	8679	62	3	659 - 677	R.ALSEVSGVKLPYNSIEGVR.S
249	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	222	858.38	1714.75	858.39	1714.77	2	-6.79	17.6922	11728	54	1	469 - 483	K.VGYVGPPAEFNYDCK.H	Carbamidomethyl: 14
249	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	103	543.61	1627.79	543.61	1627.81	3	-12.63	13.87598333	10043	19	1	494 - 507	K.EIAEGRHPFCTALK.N	Carbamidomethyl: 10
249	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	9	406.21	810.40	406.21	810.41	2	-11.28	9.59925833	3728	43	1	195 - 200	R.FTEMKR.S
249	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	86	491.56	1471.67	491.57	1471.68	3	-12.51	13.16125833	5691	41	3	597 - 609	K.DAFVVYQGHHGDK.A
249	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	81	446.56	1336.66	446.57	1336.67	3	-13.03	12.986625	17175	48	2	682 - 693	K.SVAPNLVHTDER.E
249	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	261	642.00	1922.96	642.00	1922.98	3	-8.73	19.36341667	18020	58	2	580 - 596	K.FVYLMGADDVNVDKIPK.D
249	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	249	680.87	1359.73	680.88	1359.74	2	-8.64	18.55214167	54869	57	3	614 - 626	R.ANVILPASAFTEK.E
249	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	200	824.41	1646.80	824.41	1646.81	2	-6.97	16.99368333	24837	85	2	289 - 304	K.ATETIDVSDAVGSNIR.V
249	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	55	459.88	1376.62	459.89	1376.64	3	-12.51	12.04486667	12927	17	2	344 - 355	R.LSDPMIRDSDGR.F	Oxidation: 5
249	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	101	689.37	1376.73	689.38	1376.75	2	-13.15	13.80874167	4904	54	1	734 - 745	K.IMAQCSAVLLKK.-	Oxidation: 2
249	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	1	419.18	836.35	419.19	836.36	2	-12.22	8.67763333	6193	35	2	218 - 223	R.CIQCTR.C	Carbamidomethyl: 1
249	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	24	435.18	868.35	435.19	868.37	2	-13.51	10.355425	14537	24	2	105 - 110	R.FCYHSR.L	Carbamidomethyl: 2
249	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	285	816.44	1630.86	816.44	1630.87	2	-5.28	20.61933333	35460	123	3	227 - 242	R.FASEVAGVQDLGILGR.G
249	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	282	447.92	1340.75	447.93	1340.76	3	-7.37	20.443975	5250	69	1	511 - 523	K.NPAIIVGAGLFNR.T
249	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	100	459.92	1376.73	459.92	1376.75	3	-13.05	13.79535833	50187	73	2	734 - 745	K.IMAQCSAVLLKK.-	Oxidation: 2
249	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	62	480.74	959.47	480.75	959.49	2	-14.15	12.28674167	45087	63	2	449 - 457	R.VEAAMVNAR.I
249	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	52	459.88	1376.62	459.89	1376.64	3	-14.25	11.96423333	9884	19	2	344 - 355	R.LSDPMIRDSDGR.F	Oxidation: 5
249	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	198	824.41	1646.80	824.41	1646.81	2	-7.46	16.91305833	36902	105	2	289 - 304	K.ATETIDVSDAVGSNIR.V
249	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	59	480.74	959.47	480.75	959.49	2	-14.77	12.19274167	66388	68	2	449 - 457	R.VEAAMVNAR.I
249	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	278	671.38	1340.74	671.39	1340.76	2	-13.57	20.33626667	3628	62	4	511 - 523	K.NPAIIVGAGLFNR.T
249	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	149	634.88	1267.74	634.88	1267.75	2	-11.29	15.32659167	56953	60	1	201 - 212	R.SVVDKNLGPLVK.T
249	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	50	519.78	1037.54	519.78	1037.55	2	-9.73	11.63868333	19444	44	5	484 - 493	K.HLGTGPDTLK.E
249	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	68	445.73	889.44	445.73	889.44	2	-8.46	12.597175	84906	40	2	111 - 118	R.LSIAGNCR.M	Carbamidomethyl: 7
249	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	287	816.44	1630.86	816.44	1630.87	2	-5.16	20.68655	60334	104	3	227 - 242	R.FASEVAGVQDLGILGR.G
249	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	47	519.78	1037.54	519.78	1037.55	2	-12.04	11.517275	15338	80	5	484 - 493	K.HLGTGPDTLK.E
249	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	284	816.43	1630.85	816.44	1630.87	2	-8.59	20.57885	3357	62	3	227 - 242	R.FASEVAGVQDLGILGR.G
249	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	235	647.33	1938.96	647.33	1938.98	3	-8.72	18.0816	97790	84	1	580 - 596	K.FVYLMGADDVNVDKIPK.D	Oxidation: 5
249	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	79	424.21	846.41	424.22	846.43	2	-14.49	12.90600833	19243	31	1	344 - 350	R.LSDPMIR.D	Oxidation: 5
249	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	89	491.56	1471.67	491.57	1471.68	3	-11.09	13.25526667	63409	50	3	597 - 609	K.DAFVVYQGHHGDK.A
249	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	16	488.74	975.47	488.75	975.48	2	-13.01	10.05908333	46050	73	3	449 - 457	R.VEAAMVNAR.I	Oxidation: 5
249	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	193	617.33	1232.65	617.34	1232.66	2	-13.16	16.73845	6944	31	2	734 - 744	K.IMAQCSAVLLK.K	Carbamidomethyl: 5
249	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	242	673.36	2017.07	673.37	2017.08	3	-6.90	18.32345833	37909	69	3	659 - 677	R.ALSEVSGVKLPYNSIEGVR.S
249	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	157	625.33	1248.64	625.34	1248.66	2	-9.73	15.595225	13608	82	1	734 - 744	K.IMAQCSAVLLK.K	Oxidation: 2
249	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	219	801.37	1600.73	801.38	1600.74	2	-7.15	17.59819167	7947	63	1	580 - 593	K.FVYLMGADDVNVDK.I	Oxidation: 5
710	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	42	480.75	959.49	480.75	959.49	2	4.20	12	3400	45	1	449 - 457	R.VEAAMVNAR.I
710	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	49	445.73	889.45	445.73	889.44	2	4.02	12.4	4772	33	1	111 - 118	R.LSIAGNCR.M	Carbamidomethyl: 7
710	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	257	816.45	1630.88	816.44	1630.87	2	5.23	20.5	5329	66	1	227 - 242	R.FASEVAGVQDLGILGR.G
710	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	256	671.39	1340.76	671.39	1340.76	2	2.96	20.4	5513	57	1	511 - 523	K.NPAIIVGAGLFNR.T
835	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	15	445.72	889.44	445.73	889.44	2	-9.74	12.3	6629	42	3	111 - 118	R.LSIAGNCR.M	Carbamidomethyl: 7
835	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	14	445.73	889.44	445.73	889.44	2	-9.40	12.3	6297	48	3	111 - 118	R.LSIAGNCR.M	Carbamidomethyl: 7
835	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	78	423.59	1267.74	423.59	1267.75	3	-6.27	15.1	7999	32	2	201 - 212	R.SVVDKNLGPLVK.T
835	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	77	423.59	1267.74	423.59	1267.75	3	-9.22	15.1	6482	32	2	201 - 212	R.SVVDKNLGPLVK.T
835	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	13	445.72	889.43	445.73	889.44	2	-11.78	12.3	4086	29	3	111 - 118	R.LSIAGNCR.M	Carbamidomethyl: 7
835	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	175	671.38	1340.75	671.39	1340.76	2	-8.19	19.8	9248	35	1	511 - 523	K.NPAIIVGAGLFNR.T
837	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	30	445.72	889.43	445.73	889.44	2	-11.66	12.7	4296	30	2	111 - 118	R.LSIAGNCR.M	Carbamidomethyl: 7
837	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	180	671.37	1340.73	671.39	1340.76	2	-17.62	20.6	5558	41	2	511 - 523	K.NPAIIVGAGLFNR.T
837	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	182	816.43	1630.84	816.44	1630.87	2	-14.06	20.8	5589	68	2	227 - 242	R.FASEVAGVQDLGILGR.G
837	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	179	671.37	1340.73	671.39	1340.76	2	-17.26	20.6	4366	34	2	511 - 523	K.NPAIIVGAGLFNR.T
837	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	181	816.43	1630.84	816.44	1630.87	2	-15.09	20.8	4231	72	2	227 - 242	R.FASEVAGVQDLGILGR.G
837	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	60	634.80	1267.58	634.80	1267.59	2	-12.65	14.7	4952	59	1	243 - 254	R.GSGEEIGTYVEK.L
837	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	31	445.72	889.43	445.73	889.44	2	-17.09	12.8	5454	37	2	111 - 118	R.LSIAGNCR.M	Carbamidomethyl: 7
880	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	334	671.38	1340.74	671.39	1340.76	2	-13.47	20.1	4762	52	3	511 - 523	K.NPAIIVGAGLFNR.T
880	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	340	816.43	1630.85	816.44	1630.87	2	-9.19	20.3	5623	67	2	227 - 242	R.FASEVAGVQDLGILGR.G
880	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	166	634.88	1267.74	634.88	1267.75	2	-10.77	14.8	8426	29	1	201 - 212	R.SVVDKNLGPLVK.T
880	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	49	480.75	959.48	480.75	959.49	2	-9.01	11.6	7352	63	3	449 - 457	R.VEAAMVNAR.I
880	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	67	424.22	846.42	424.22	846.43	2	-13.40	12.1	4196	16	1	344 - 350	R.LSDPMIR.D	Oxidation: 5
880	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	63	445.73	889.44	445.73	889.44	2	-5.76	12	7073	37	2	111 - 118	R.LSIAGNCR.M	Carbamidomethyl: 7
880	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	165	423.59	1267.74	423.59	1267.75	3	-10.75	14.8	2045	38	2	201 - 212	R.SVVDKNLGPLVK.T
880	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	337	671.38	1340.74	671.39	1340.76	2	-14.76	20.2	4065	35	3	511 - 523	K.NPAIIVGAGLFNR.T
880	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	48	480.74	959.47	480.75	959.49	2	-11.36	11.6	2136	55	3	449 - 457	R.VEAAMVNAR.I
880	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	331	671.38	1340.74	671.39	1340.76	2	-12.92	20.1	12533	67	3	511 - 523	K.NPAIIVGAGLFNR.T
880	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	47	480.74	959.47	480.75	959.49	2	-11.73	11.6	4720	54	3	449 - 457	R.VEAAMVNAR.I
880	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	129	634.80	1267.58	634.80	1267.59	2	-8.23	13.9	9810	68	1	243 - 254	R.GSGEEIGTYVEK.L
880	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	65	445.72	889.43	445.73	889.44	2	-10.83	12	3504	42	2	111 - 118	R.LSIAGNCR.M	Carbamidomethyl: 7
880	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	10	488.74	975.47	488.75	975.48	2	-12.23	9.4	5809	49	2	449 - 457	R.VEAAMVNAR.I	Oxidation: 5
880	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	344	816.43	1630.85	816.44	1630.87	2	-9.87	20.4	48709	48	2	227 - 242	R.FASEVAGVQDLGILGR.G
880	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	167	423.59	1267.73	423.59	1267.75	3	-11.91	14.8	6376	36	2	201 - 212	R.SVVDKNLGPLVK.T
880	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	11	488.74	975.47	488.75	975.48	2	-10.43	9.4	5229	42	2	449 - 457	R.VEAAMVNAR.I	Oxidation: 5
983	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	394	816.46	1630.90	816.44	1630.87	2	17.43	20.2	27262	87	1	227 - 242	R.FASEVAGVQDLGILGR.G
983	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	62	445.74	889.46	445.73	889.44	2	14.79	12	6279	24	3	111 - 118	R.LSIAGNCR.M	Carbamidomethyl: 7
983	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	387	671.40	1340.78	671.39	1340.76	2	15.77	20.1	8845	78	1	511 - 523	K.NPAIIVGAGLFNR.T
983	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	63	424.23	846.44	424.22	846.43	2	15.87	12	11676	27	1	344 - 350	R.LSDPMIR.D	Oxidation: 5
983	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	61	445.74	889.46	445.73	889.44	2	19.83	11.9	5022	22	3	111 - 118	R.LSIAGNCR.M	Carbamidomethyl: 7
983	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	247	824.43	1646.84	824.41	1646.81	2	19.51	16.4	90677	81	1	289 - 304	K.ATETIDVSDAVGSNIR.V
983	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	64	445.74	889.46	445.73	889.44	2	12.86	12	16844	37	3	111 - 118	R.LSIAGNCR.M	Carbamidomethyl: 7
983	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	52	480.76	959.50	480.75	959.49	2	16.51	11.5	25101	49	2	449 - 457	R.VEAAMVNAR.I
983	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	53	480.76	959.50	480.75	959.49	2	13.14	11.5	5260	33	2	449 - 457	R.VEAAMVNAR.I
1045	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	144	816.46	1630.90	816.44	1630.87	2	17.49	20.3	10094	84	4	227 - 242	R.FASEVAGVQDLGILGR.G
1045	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	70	634.89	1267.77	634.88	1267.75	2	14.27	14.7	9470	20	3	201 - 212	R.SVVDKNLGPLVK.T
1045	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	44	634.81	1267.61	634.80	1267.59	2	15.97	14	3967	40	2	243 - 254	R.GSGEEIGTYVEK.L
1045	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	143	816.45	1630.90	816.44	1630.87	2	16.72	20.3	9897	83	4	227 - 242	R.FASEVAGVQDLGILGR.G
1045	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	92	621.31	1860.91	621.30	1860.89	3	15.61	16.5	5624	24	2	319 - 333	R.LNEDINEEWISDKTR.F
1045	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	13	445.74	889.46	445.73	889.44	2	13.42	12	7814	45	4	111 - 118	R.LSIAGNCR.M	Carbamidomethyl: 7
1045	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	68	634.89	1267.77	634.88	1267.75	2	13.15	14.7	3911	55	3	201 - 212	R.SVVDKNLGPLVK.T
1045	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	142	816.45	1630.89	816.44	1630.87	2	15.70	20.3	4543	64	4	227 - 242	R.FASEVAGVQDLGILGR.G
1045	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	141	671.40	1340.78	671.39	1340.76	2	18.48	20.1	5666	44	2	511 - 523	K.NPAIIVGAGLFNR.T
1045	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	91	621.31	1860.92	621.30	1860.89	3	17.50	16.5	3792	59	2	319 - 333	R.LNEDINEEWISDKTR.F
1045	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	18	424.22	846.43	424.22	846.43	2	8.61	12.1	6262	26	2	344 - 350	R.LSDPMIR.D	Oxidation: 5
1045	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	145	816.45	1630.89	816.44	1630.87	2	16.51	20.4	8295	71	4	227 - 242	R.FASEVAGVQDLGILGR.G
1045	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	67	423.60	1267.77	423.59	1267.75	3	13.14	14.6	8852	34	3	201 - 212	R.SVVDKNLGPLVK.T
1045	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	73	634.89	1267.77	634.88	1267.75	2	12.02	14.8	6393	36	3	201 - 212	R.SVVDKNLGPLVK.T
1045	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	1	488.75	975.49	488.75	975.48	2	11.73	9.4	4436	32	1	449 - 457	R.VEAAMVNAR.I	Oxidation: 5
1045	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	71	423.60	1267.77	423.59	1267.75	3	12.00	14.7	11871	32	3	201 - 212	R.SVVDKNLGPLVK.T
1045	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	15	445.73	889.45	445.73	889.44	2	10.70	12	10947	37	4	111 - 118	R.LSIAGNCR.M	Carbamidomethyl: 7
1045	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	14	445.73	889.46	445.73	889.44	2	12.68	12	10680	50	4	111 - 118	R.LSIAGNCR.M	Carbamidomethyl: 7
1045	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	41	634.82	1267.62	634.80	1267.59	2	19.15	14	3284	22	2	243 - 254	R.GSGEEIGTYVEK.L
1045	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	12	445.74	889.46	445.73	889.44	2	13.13	11.9	3565	29	4	111 - 118	R.LSIAGNCR.M	Carbamidomethyl: 7
1045	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	69	423.60	1267.77	423.59	1267.75	3	14.25	14.7	18190	36	3	201 - 212	R.SVVDKNLGPLVK.T
1045	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	140	671.40	1340.78	671.39	1340.76	2	16.26	20.1	5352	39	2	511 - 523	K.NPAIIVGAGLFNR.T
1045	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	16	424.22	846.43	424.22	846.43	2	5.74	12.1	4318	16	2	344 - 350	R.LSDPMIR.D	Oxidation: 5
1101	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	204	680.88	1359.75	680.88	1359.74	2	10.45	18.5	5517	18	2	614 - 626	R.ANVILPASAFTEK.E
1101	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	83	529.76	1057.51	529.76	1057.50	2	9.48	14	3890	28	1	334 - 341	R.FCYDGLKR.Q	Carbamidomethyl: 2
1101	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	196	673.38	2017.11	673.37	2017.08	3	11.00	18.2	6906	57	4	659 - 677	R.ALSEVSGVKLPYNSIEGVR.S
1101	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	123	423.58	1267.73	423.59	1267.75	3	-19.02	15	4103	27	3	201 - 212	R.SVVDKNLGPLVK.T
1101	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	1	488.75	975.49	488.75	975.48	2	9.64	9.6	6642	63	6	449 - 457	R.VEAAMVNAR.I	Oxidation: 5
1101	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	14	493.80	985.59	493.80	985.58	2	10.38	10.1	9354	50	3	144 - 152	K.IKTDTPIAK.K
1101	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	15	493.80	985.59	493.80	985.58	2	10.12	10.1	6225	33	3	144 - 152	K.IKTDTPIAK.K
1101	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	210	671.39	1340.77	671.39	1340.76	2	6.72	20.4	4822	55	2	511 - 523	K.NPAIIVGAGLFNR.T
1101	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	201	680.88	1359.75	680.88	1359.74	2	6.87	18.5	5107	56	2	614 - 626	R.ANVILPASAFTEK.E
1101	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	70	459.93	1376.76	459.92	1376.75	3	4.45	13.6	3493	43	3	734 - 745	K.IMAQCSAVLLKK.-	Oxidation: 2
1101	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	198	673.38	2017.11	673.37	2017.08	3	12.05	18.3	9638	58	4	659 - 677	R.ALSEVSGVKLPYNSIEGVR.S
1101	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	29	480.75	959.49	480.75	959.49	2	9.44	12.1	8710	45	1	449 - 457	R.VEAAMVNAR.I
1101	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	45	424.22	846.43	424.22	846.43	2	9.32	12.5	18940	22	3	344 - 350	R.LSDPMIR.D	Oxidation: 5
1101	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	211	671.39	1340.77	671.39	1340.76	2	7.46	20.4	6204	50	2	511 - 523	K.NPAIIVGAGLFNR.T
1101	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	42	445.73	889.45	445.73	889.44	2	8.55	12.4	19382	68	2	111 - 118	R.LSIAGNCR.M	Carbamidomethyl: 7
1101	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	95	634.81	1267.61	634.80	1267.59	2	13.28	14.3	9397	62	3	243 - 254	R.GSGEEIGTYVEK.L
1101	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	3	488.75	975.49	488.75	975.48	2	9.82	9.7	12794	64	6	449 - 457	R.VEAAMVNAR.I	Oxidation: 5
1101	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	94	634.81	1267.60	634.80	1267.59	2	9.23	14.3	3879	25	3	243 - 254	R.GSGEEIGTYVEK.L
1101	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	38	445.73	889.45	445.73	889.44	2	8.89	12.3	43868	60	2	111 - 118	R.LSIAGNCR.M	Carbamidomethyl: 7
1101	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	124	423.59	1267.75	423.59	1267.75	3	3.08	15	14593	33	3	201 - 212	R.SVVDKNLGPLVK.T
1101	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	4	488.75	975.49	488.75	975.48	2	7.29	9.7	16079	52	6	449 - 457	R.VEAAMVNAR.I	Oxidation: 5
1101	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	2	488.75	975.49	488.75	975.48	2	8.78	9.6	11919	60	6	449 - 457	R.VEAAMVNAR.I	Oxidation: 5
1101	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	72	459.93	1376.76	459.92	1376.75	3	6.78	13.6	13167	44	3	734 - 745	K.IMAQCSAVLLKK.-	Oxidation: 2
1101	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	197	673.38	2017.11	673.37	2017.08	3	12.69	18.3	10013	63	4	659 - 677	R.ALSEVSGVKLPYNSIEGVR.S
1101	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	215	816.45	1630.88	816.44	1630.87	2	9.05	20.6	7205	94	2	227 - 242	R.FASEVAGVQDLGILGR.G
1101	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	213	816.45	1630.88	816.44	1630.87	2	7.04	20.6	6174	61	2	227 - 242	R.FASEVAGVQDLGILGR.G
1101	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	5	488.75	975.49	488.75	975.48	2	8.92	9.7	14274	64	6	449 - 457	R.VEAAMVNAR.I	Oxidation: 5
1101	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	128	423.59	1267.76	423.59	1267.75	3	8.44	15.1	29301	36	3	201 - 212	R.SVVDKNLGPLVK.T
1101	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	73	491.25	1960.97	491.25	1960.95	4	9.68	13.7	3348	48	2	597 - 613	K.DAFVVYQGHHGDKAVYR.A
1101	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	41	424.22	846.43	424.22	846.43	2	7.77	12.4	20770	19	3	344 - 350	R.LSDPMIR.D	Oxidation: 5
1101	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	169	621.31	1860.91	621.30	1860.89	3	11.65	16.9	5492	25	1	319 - 333	R.LNEDINEEWISDKTR.F
1101	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	195	673.38	2017.10	673.37	2017.08	3	10.05	18.2	4879	48	4	659 - 677	R.ALSEVSGVKLPYNSIEGVR.S
1101	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	74	491.25	1960.97	491.25	1960.95	4	8.23	13.7	4721	30	2	597 - 613	K.DAFVVYQGHHGDKAVYR.A
1101	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	40	424.22	846.43	424.22	846.43	2	3.81	12.3	5954	18	3	344 - 350	R.LSDPMIR.D	Oxidation: 5
1101	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	71	459.93	1376.76	459.92	1376.75	3	6.28	13.6	10916	56	3	734 - 745	K.IMAQCSAVLLKK.-	Oxidation: 2
1101	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	13	493.80	985.59	493.80	985.58	2	12.55	10.1	5935	55	3	144 - 152	K.IKTDTPIAK.K
1101	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	6	488.75	975.49	488.75	975.48	2	12.14	9.8	11885	51	6	449 - 457	R.VEAAMVNAR.I	Oxidation: 5
1101	AT5G37510.1	75 kDa subunit	complex I	a) oxidative phosphorylation	mitochondria	99	634.81	1267.61	634.80	1267.59	2	12.66	14.4	9877	23	3	243 - 254	R.GSGEEIGTYVEK.L
202	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	202	447.23	1338.68	447.24	1338.69	3	-11.05	16.52726667	8029	38	1	228 - 238	R.QFDGLVDVYRK.T
202	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	180	483.25	964.49	483.26	964.50	2	-10.91	15.81483333	16500	36	2	242 - 250	K.TDGIAGLYR.G
202	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	176	483.25	964.49	483.26	964.50	2	-8.43	15.70721667	20775	70	2	242 - 250	K.TDGIAGLYR.G
202	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	198	672.86	1343.70	672.86	1343.71	2	-6.57	16.37939167	12093	45	1	106 - 116	K.LLIQNQDEMIK.A
202	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	253	606.30	1210.59	606.31	1210.60	2	-9.23	18.37231667	13956	52	2	228 - 237	R.QFDGLVDVYR.K
202	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	144	680.86	1359.70	680.86	1359.71	2	-7.90	14.68648333	13733	68	2	106 - 116	K.LLIQNQDEMIK.A	Oxidation: 9
202	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	204	670.35	1338.68	670.35	1338.69	2	-11.15	16.55434167	3710	26	1	228 - 238	R.QFDGLVDVYRK.T
202	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	34	422.73	843.44	422.74	843.46	2	-14.21	9.91135833	19018	57	1	146 - 153	R.GNTANVIR.Y
202	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	146	680.86	1359.70	680.86	1359.71	2	-8.19	14.76709167	19435	54	2	106 - 116	K.LLIQNQDEMIK.A	Oxidation: 9
202	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	249	470.24	1407.70	470.25	1407.71	3	-10.63	18.22418333	20358	66	1	134 - 145	R.TIKDEGFGSLWR.G
202	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	250	704.86	1407.70	704.86	1407.71	2	-10.65	18.23756667	15776	23	1	134 - 145	R.TIKDEGFGSLWR.G
202	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	255	606.30	1210.59	606.31	1210.60	2	-8.90	18.43954167	6805	46	2	228 - 237	R.QFDGLVDVYR.K
202	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	31	414.73	827.44	414.73	827.45	2	-14.55	9.81736667	32625	65	1	96 - 103	K.TAAAPIER.V
270	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	36	558.73	1115.45	558.74	1115.47	2	-12.22	9.50705	25712	29	1	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 1
270	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	199	680.85	1359.69	680.86	1359.71	2	-12.16	15.021825	11737	74	2	106 - 116	K.LLIQNQDEMIK.A	Oxidation: 9
270	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	415	723.87	1445.72	723.87	1445.73	2	-9.59	21.8742	80052	21	1	154 - 165	R.YFPTQALNFAFK.D
270	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	237	483.25	964.49	483.26	964.50	2	-6.98	16.17720833	14548	16	2	242 - 250	K.TDGIAGLYR.G
270	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	479	683.34	2046.99	683.34	2047.01	3	-10.87	24.93648333	12166	79	1	76 - 95	K.GFTNFALDFLMGGVSAAVSK.T	Oxidation: 11
270	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	234	483.25	964.49	483.26	964.50	2	-10.71	16.0832	8043	36	2	242 - 250	K.TDGIAGLYR.G
270	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	36	558.73	1115.45	558.74	1115.47	2	-12.22	9.50705	25712	29	1	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 2
270	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	204	680.85	1359.69	680.86	1359.71	2	-12.74	15.14261667	30740	39	2	106 - 116	K.LLIQNQDEMIK.A	Oxidation: 9
270	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	315	606.30	1210.59	606.31	1210.60	2	-10.22	18.66275	7374	65	1	228 - 237	R.QFDGLVDVYR.K
792	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	19	414.73	827.45	414.73	827.45	2	-2.78	10.4	4963	22	2	96 - 103	K.TAAAPIER.V
792	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	99	483.25	964.50	483.26	964.50	2	-2.55	16.1	4739	49	1	242 - 250	K.TDGIAGLYR.G
792	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	17	414.73	827.44	414.73	827.45	2	-6.59	10.3	4330	51	2	96 - 103	K.TAAAPIER.V
792	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	80	680.86	1359.71	680.86	1359.71	2	3.25	15.1	3990	33	1	106 - 116	K.LLIQNQDEMIK.A	Oxidation: 9
850	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	17	422.73	843.45	422.74	843.46	2	-8.89	10.2	9821	39	4	146 - 153	R.GNTANVIR.Y
850	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	182	447.24	1338.68	447.24	1338.69	3	-6.92	16.9	4909	17	1	228 - 238	R.QFDGLVDVYRK.T
850	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	20	414.73	827.44	414.73	827.45	2	-10.28	10.2	11446	30	4	96 - 103	K.TAAAPIER.V
850	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	13	414.73	827.44	414.73	827.45	2	-8.23	10.1	3819	16	4	96 - 103	K.TAAAPIER.V
850	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	15	422.73	843.45	422.74	843.46	2	-7.78	10.1	3708	26	4	146 - 153	R.GNTANVIR.Y
850	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	125	680.86	1359.70	680.86	1359.71	2	-6.43	15.1	9471	60	3	106 - 116	K.LLIQNQDEMIK.A	Oxidation: 9
850	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	157	483.25	964.49	483.26	964.50	2	-3.65	16.2	10375	29	2	242 - 250	K.TDGIAGLYR.G
850	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	14	414.73	827.44	414.73	827.45	2	-7.20	10.1	10363	38	4	96 - 103	K.TAAAPIER.V
850	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	159	483.25	964.50	483.26	964.50	2	-2.47	16.2	7706	29	2	242 - 250	K.TDGIAGLYR.G
850	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	16	414.73	827.44	414.73	827.45	2	-8.50	10.1	19288	62	4	96 - 103	K.TAAAPIER.V
850	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	18	422.73	843.45	422.74	843.46	2	-6.93	10.2	11574	44	4	146 - 153	R.GNTANVIR.Y
850	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	124	680.86	1359.70	680.86	1359.71	2	-8.03	15	4401	61	3	106 - 116	K.LLIQNQDEMIK.A	Oxidation: 9
850	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	171	672.86	1343.71	672.86	1343.71	2	-4.50	16.7	3935	39	1	106 - 116	K.LLIQNQDEMIK.A
850	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	126	680.86	1359.70	680.86	1359.71	2	-6.06	15.1	10607	63	3	106 - 116	K.LLIQNQDEMIK.A	Oxidation: 9
850	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	19	422.73	843.45	422.74	843.46	2	-8.87	10.2	10290	23	4	146 - 153	R.GNTANVIR.Y
890	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	159	680.85	1359.69	680.86	1359.71	2	-9.72	14.9	7778	52	1	106 - 116	K.LLIQNQDEMIK.A	Oxidation: 9
890	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	12	414.73	827.44	414.73	827.45	2	-11.20	9.9	7155	51	3	96 - 103	K.TAAAPIER.V
890	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	10	414.73	827.44	414.73	827.45	2	-13.49	9.8	9429	26	3	96 - 103	K.TAAAPIER.V
890	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	201	483.25	964.49	483.26	964.50	2	-6.42	16	7630	27	1	242 - 250	K.TDGIAGLYR.G
890	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	11	414.73	827.44	414.73	827.45	2	-13.83	9.9	10619	51	3	96 - 103	K.TAAAPIER.V
890	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	15	422.73	843.44	422.74	843.46	2	-15.61	10	8329	16	3	146 - 153	R.GNTANVIR.Y
890	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	14	422.73	843.44	422.74	843.46	2	-15.61	10	6936	26	3	146 - 153	R.GNTANVIR.Y
890	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	13	422.73	843.45	422.74	843.46	2	-12.53	9.9	8022	24	3	146 - 153	R.GNTANVIR.Y
945	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	200	483.26	964.51	483.26	964.50	2	7.96	15.8	7883	32	1	242 - 250	K.TDGIAGLYR.G
945	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	404	723.88	1445.74	723.87	1445.73	2	5.49	21.9	13905	50	1	154 - 165	R.YFPTQALNFAFK.D
945	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	359	459.30	916.58	459.29	916.57	2	5.40	19.9	18858	48	1	367 - 374	K.LQLIVFGK.K
945	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	2	414.73	827.45	414.73	827.45	2	5.61	9.8	6742	51	3	96 - 103	K.TAAAPIER.V
945	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	1	414.73	827.45	414.73	827.45	2	5.46	9.8	7794	27	3	96 - 103	K.TAAAPIER.V
945	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	3	414.73	827.45	414.73	827.45	2	4.43	9.9	8155	43	3	96 - 103	K.TAAAPIER.V
945	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	188	604.32	1206.63	604.32	1206.62	2	7.31	15.5	3686	24	1	354 - 366	R.AVAGAGVLSGYDK.L
1005	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	71	680.87	1359.72	680.86	1359.71	2	12.71	14.7	7193	53	2	106 - 116	K.LLIQNQDEMIK.A	Oxidation: 9
1005	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	31	548.97	1643.89	548.96	1643.87	3	11.47	13.6	3990	40	3	106 - 119	K.LLIQNQDEMIKAGR.L	Oxidation: 9
1005	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	147	470.25	1407.73	470.25	1407.71	3	8.47	18.3	5946	24	2	134 - 145	R.TIKDEGFGSLWR.G
1005	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	34	548.97	1643.89	548.96	1643.87	3	11.56	13.7	17693	43	3	106 - 119	K.LLIQNQDEMIKAGR.L	Oxidation: 9
1005	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	150	470.25	1407.73	470.25	1407.71	3	8.62	18.3	5649	30	2	134 - 145	R.TIKDEGFGSLWR.G
1005	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	68	680.87	1359.72	680.86	1359.71	2	12.88	14.6	6503	37	2	106 - 116	K.LLIQNQDEMIK.A	Oxidation: 9
1005	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	2	414.74	827.46	414.73	827.45	2	10.89	9.6	10251	57	5	96 - 103	K.TAAAPIER.V
1005	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	5	414.74	827.46	414.73	827.45	2	8.72	9.7	28420	65	5	96 - 103	K.TAAAPIER.V
1005	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	4	414.74	827.46	414.73	827.45	2	10.86	9.7	27874	60	5	96 - 103	K.TAAAPIER.V
1005	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	6	414.74	827.46	414.73	827.45	2	10.36	9.8	21409	35	5	96 - 103	K.TAAAPIER.V
1005	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	32	548.97	1643.89	548.96	1643.87	3	13.84	13.6	11338	43	3	106 - 119	K.LLIQNQDEMIKAGR.L	Oxidation: 9
1005	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	3	414.74	827.46	414.73	827.45	2	10.91	9.7	18522	60	5	96 - 103	K.TAAAPIER.V
1005	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	148	704.87	1407.73	704.86	1407.71	2	8.49	18.3	5129	33	1	134 - 145	R.TIKDEGFGSLWR.G
1059	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	2	414.74	827.46	414.73	827.45	2	15.64	9.8	10687	35	3	96 - 103	K.TAAAPIER.V
1059	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	4	414.74	827.47	414.73	827.45	2	18.27	9.8	13561	44	3	96 - 103	K.TAAAPIER.V
1059	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	38	548.97	1643.90	548.96	1643.87	3	17.66	13.8	3889	65	1	106 - 119	K.LLIQNQDEMIKAGR.L	Oxidation: 9
1059	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	3	414.74	827.46	414.73	827.45	2	17.04	9.8	14832	32	3	96 - 103	K.TAAAPIER.V
1117	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	12	422.74	843.47	422.74	843.46	2	17.70	10	5733	30	3	146 - 153	R.GNTANVIR.Y
1117	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	4	558.75	1115.49	558.74	1115.47	2	18.01	9.5	4955	29	4	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 2
1117	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	47	550.75	1099.49	550.74	1099.47	2	19.26	11.7	17294	19	1	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 3
1117	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	202	436.59	1306.74	436.58	1306.72	3	13.90	15.8	15234	29	2	239 - 250	K.TLKTDGIAGLYR.G
1117	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	4	558.75	1115.49	558.74	1115.47	2	18.01	9.5	4955	28	1	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 1
1117	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	2	558.75	1115.49	558.74	1115.47	2	18.01	9.4	4037	25	4	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 2
1117	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	7	414.74	827.46	414.73	827.45	2	17.06	9.8	4531	58	2	96 - 103	K.TAAAPIER.V
1117	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	3	558.75	1115.49	558.74	1115.47	2	17.42	9.4	12331	26	4	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 1
1117	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	47	550.75	1099.49	550.74	1099.47	2	19.26	11.7	17294	33	1	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 2
1117	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	312	459.30	916.59	459.29	916.57	2	14.72	20	4179	37	3	367 - 374	K.LQLIVFGK.K
1117	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	6	414.74	827.46	414.73	827.45	2	17.06	9.8	11996	51	2	96 - 103	K.TAAAPIER.V
1117	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	4	558.75	1115.49	558.74	1115.47	2	18.01	9.5	4955	45	4	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 1
1117	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	203	654.38	1306.74	654.37	1306.72	2	13.91	15.8	10702	36	2	239 - 250	K.TLKTDGIAGLYR.G
1117	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	1	558.75	1115.48	558.74	1115.47	2	12.19	9.4	6867	24	4	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 1
1117	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	2	558.75	1115.49	558.74	1115.47	2	18.01	9.4	4037	25	4	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 1
1117	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	14	422.74	843.47	422.74	843.46	2	15.26	10	3953	47	3	146 - 153	R.GNTANVIR.Y
1117	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	315	459.30	916.59	459.29	916.57	2	16.13	20	4806	39	3	367 - 374	K.LQLIVFGK.K
1117	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	47	550.75	1099.49	550.74	1099.47	2	19.26	11.7	17294	21	1	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 1
1117	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	209	483.27	964.52	483.26	964.50	2	19.71	16	4876	51	1	242 - 250	K.TDGIAGLYR.G
1117	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	186	529.97	1586.90	529.96	1586.87	3	19.47	15.1	5517	26	1	104 - 116	R.VKLLIQNQDEMIK.A	Oxidation: 11
1117	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	206	654.38	1306.75	654.37	1306.72	2	16.68	15.9	7565	32	2	239 - 250	K.TLKTDGIAGLYR.G
1117	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	13	422.74	843.47	422.74	843.46	2	16.18	10	5577	40	3	146 - 153	R.GNTANVIR.Y
1117	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	316	917.60	916.59	917.58	916.57	1	16.15	20	4798	17	1	367 - 374	K.LQLIVFGK.K
1117	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	204	436.59	1306.75	436.58	1306.72	3	16.65	15.9	18051	47	2	239 - 250	K.TLKTDGIAGLYR.G
1117	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	132	529.79	1057.56	529.78	1057.54	2	17.53	13.8	5942	19	2	324 - 332	K.YKSSLDAFK.Q
1117	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	134	529.79	1057.56	529.78	1057.54	2	17.99	13.9	7254	33	2	324 - 332	K.YKSSLDAFK.Q
1117	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	311	459.30	916.58	459.29	916.57	2	9.60	19.9	4917	24	3	367 - 374	K.LQLIVFGK.K
1117	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	1	558.75	1115.48	558.74	1115.47	2	12.19	9.4	6867	24	4	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 2
1117	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	3	558.75	1115.49	558.74	1115.47	2	17.42	9.4	12331	26	4	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 2
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	239	436.59	1306.73	436.58	1306.72	3	7.56	15.9	35515	38	2	239 - 250	K.TLKTDGIAGLYR.G
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	441	702.74	2105.20	702.74	2105.19	3	7.22	22.6	9882	64	3	354 - 374	R.AVAGAGVLSGYDKLQLIVFGK.K
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	392	917.59	916.58	917.58	916.57	1	7.56	20	15968	43	3	367 - 374	K.LQLIVFGK.K
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	246	533.60	1597.78	533.59	1597.76	3	12.15	16	10034	53	2	120 - 133	R.LSEPYKGIGDCFGR.T	Carbamidomethyl: 11
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	7	475.22	1422.63	475.21	1422.62	3	9.76	9.7	41635	33	1	314 - 325	R.MMMTSGEAVKYK.S	Oxidation: 1
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	210	681.36	1360.71	680.86	1359.71	2	735.32	15.2	46100	33	6	106 - 116	K.LLIQNQDEMIK.A	Oxidation: 9
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	31	423.23	844.44	422.74	843.46	2	1168.46	10.5	12430	23	5	146 - 153	R.GNTANVIR.Y
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	149	767.40	766.39	767.39	766.39	1	11.13	13.9	4674	52	3	326 - 332	K.SSLDAFK.Q
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	328	606.31	1210.61	606.31	1210.60	2	9.59	18.1	172863	70	7	228 - 237	R.QFDGLVDVYR.K
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	327	606.31	1210.61	606.31	1210.60	2	8.30	18.1	229577	58	7	228 - 237	R.QFDGLVDVYR.K
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	8	558.74	1115.47	558.74	1115.47	2	6.16	9.7	5695	23	4	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 1
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	269	447.24	1338.71	447.24	1338.69	3	10.19	16.6	66973	61	4	228 - 238	R.QFDGLVDVYRK.T
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	338	704.87	1407.73	704.86	1407.71	2	8.56	18.3	39458	97	3	134 - 145	R.TIKDEGFGSLWR.G
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	65	550.75	1099.48	550.74	1099.47	2	7.44	11.7	4602	67	4	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 2
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	260	524.63	1570.88	524.63	1570.88	3	4.05	16.3	119243	32	1	104 - 116	R.VKLLIQNQDEMIK.A
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	148	548.97	1643.88	548.96	1643.87	3	9.74	13.8	17629	33	1	106 - 119	K.LLIQNQDEMIKAGR.L	Oxidation: 9
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	215	604.33	1206.64	604.32	1206.62	2	12.22	15.3	5626	72	3	354 - 366	R.AVAGAGVLSGYDK.L
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	244	533.60	1597.78	533.59	1597.76	3	14.62	16	26357	59	2	120 - 133	R.LSEPYKGIGDCFGR.T	Carbamidomethyl: 11
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	63	550.75	1099.48	550.74	1099.47	2	5.97	11.6	18795	37	4	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 3
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	448	667.34	1999.00	667.34	1998.99	3	5.84	23.1	5094	55	1	154 - 169	R.YFPTQALNFAFKDYFK.R
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	108	542.75	1083.49	542.75	1083.48	2	12.32	12.9	34566	19	2	314 - 323	R.MMMTSGEAVK.Y
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	3	558.74	1115.47	558.74	1115.47	2	6.86	9.5	149452	16	3	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 1
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	106	542.75	1083.49	542.75	1083.48	2	8.86	12.9	26578	29	2	314 - 323	R.MMMTSGEAVK.Y
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	44	736.39	735.39	736.39	735.38	1	9.68	11	4082	34	5	120 - 125	R.LSEPYK.G
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	355	625.36	1248.71	625.36	1248.71	2	3.26	18.7	189379	44	2	326 - 336	K.SSLDAFKQILK.N
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	187	454.25	1359.72	454.24	1359.71	3	12.49	14.7	19175	48	3	106 - 116	K.LLIQNQDEMIK.A	Oxidation: 9
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	436	724.37	1446.73	723.87	1445.73	2	688.98	22.4	5998	18	4	154 - 165	R.YFPTQALNFAFK.D
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	69	470.23	938.44	470.22	938.42	2	14.31	11.9	6330	21	3	177 - 183	K.DRDGYWK.W
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	390	533.76	1065.50	533.75	1065.49	2	9.62	20	21194	57	2	137 - 145	K.DEGFGSLWR.G
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	203	529.97	1586.89	529.96	1586.87	3	9.83	15.1	47438	45	2	104 - 116	R.VKLLIQNQDEMIK.A	Oxidation: 11
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	200	529.97	1586.89	529.96	1586.87	3	9.79	15	49801	49	2	104 - 116	R.VKLLIQNQDEMIK.A	Oxidation: 11
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	219	1207.65	1206.64	1207.63	1206.62	1	12.73	15.4	5559	30	1	354 - 366	R.AVAGAGVLSGYDK.L
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	426	723.88	1445.75	723.87	1445.73	2	8.52	21.9	9533	49	4	154 - 165	R.YFPTQALNFAFK.D
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	1	558.74	1115.47	558.74	1115.47	2	6.82	9.4	7615	23	4	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 2
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	139	1058.56	1057.55	1058.55	1057.54	1	8.33	13.6	154108	19	2	324 - 332	K.YKSSLDAFK.Q
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	143	529.78	1057.55	529.78	1057.54	2	7.81	13.7	92482	71	3	324 - 332	K.YKSSLDAFK.Q
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	261	672.87	1343.73	672.86	1343.71	2	10.24	16.4	33321	69	3	106 - 116	K.LLIQNQDEMIK.A
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	273	670.36	1338.71	670.35	1338.69	2	10.39	16.6	48214	58	5	228 - 238	R.QFDGLVDVYRK.T
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	190	454.25	1359.72	454.24	1359.71	3	12.82	14.7	38605	37	3	106 - 116	K.LLIQNQDEMIK.A	Oxidation: 9
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	54	736.39	735.39	736.39	735.38	1	8.65	11.2	4445	34	5	120 - 125	R.LSEPYK.G
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	342	606.31	1210.61	606.31	1210.60	2	9.10	18.4	4141	68	7	228 - 237	R.QFDGLVDVYR.K
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	275	447.24	1338.71	447.24	1338.69	3	9.92	16.7	44016	59	4	228 - 238	R.QFDGLVDVYRK.T
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	185	680.87	1359.72	680.86	1359.71	2	12.50	14.7	87078	67	6	106 - 116	K.LLIQNQDEMIK.A	Oxidation: 9
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	391	459.30	916.58	459.29	916.57	2	7.55	20	47512	38	3	367 - 374	K.LQLIVFGK.K
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	158	441.20	880.39	441.20	880.39	2	8.76	14.1	13873	43	3	126 - 133	K.GIGDCFGR.T	Carbamidomethyl: 5
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	81	771.46	770.45	771.45	770.44	1	11.43	12.3	5998	25	3	346 - 353	K.GAGANILR.A
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	295	670.85	1339.69	670.35	1338.69	2	745.16	17.2	164044	43	5	228 - 238	R.QFDGLVDVYRK.T
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	2	558.75	1115.48	558.74	1115.47	2	10.35	9.4	165287	49	4	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 1
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	387	917.59	916.58	917.58	916.57	1	6.11	19.9	6392	39	3	367 - 374	K.LQLIVFGK.K
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	84	771.45	770.45	771.45	770.44	1	10.07	12.4	8004	25	3	346 - 353	K.GAGANILR.A
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	421	723.88	1445.75	723.87	1445.73	2	8.59	21.8	3943	67	4	154 - 165	R.YFPTQALNFAFK.D
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	71	470.23	938.44	470.22	938.42	2	11.69	12	9533	28	3	177 - 183	K.DRDGYWK.W
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	410	749.40	1496.79	749.40	1496.78	2	5.88	21.5	6242	72	2	251 - 263	R.GFNISCVGIIVYR.G	Carbamidomethyl: 6
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	66	550.75	1099.48	550.74	1099.47	2	8.48	11.7	3943	33	4	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 2
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	318	523.34	1044.67	523.34	1044.67	2	4.66	17.8	3750	61	3	367 - 375	K.LQLIVFGKK.Y
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	236	654.37	1306.73	654.37	1306.72	2	5.54	15.8	81999	56	1	239 - 250	K.TLKTDGIAGLYR.G
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	340	606.31	1210.61	606.31	1210.60	2	7.43	18.4	21072	65	7	228 - 237	R.QFDGLVDVYR.K
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	65	550.75	1099.48	550.74	1099.47	2	7.44	11.7	4602	44	4	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 1
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	332	704.87	1407.73	704.86	1407.71	2	8.17	18.2	7865	74	3	134 - 145	R.TIKDEGFGSLWR.G
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	162	441.20	880.39	441.20	880.39	2	9.46	14.1	11894	42	3	126 - 133	K.GIGDCFGR.T	Carbamidomethyl: 5
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	165	441.20	880.40	441.20	880.39	2	10.33	14.2	6536	33	3	126 - 133	K.GIGDCFGR.T	Carbamidomethyl: 5
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	22	422.74	843.46	422.74	843.46	2	6.89	10	6944	23	5	146 - 153	R.GNTANVIR.Y
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	204	794.45	1586.89	794.44	1586.87	2	9.84	15.1	13467	29	2	104 - 116	R.VKLLIQNQDEMIK.A	Oxidation: 11
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	264	672.87	1343.73	672.86	1343.71	2	10.82	16.4	47706	70	3	106 - 116	K.LLIQNQDEMIK.A
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	262	623.87	1245.73	623.87	1245.72	2	4.64	16.4	13178	21	1	342 - 353	K.SLFKGAGANILR.A
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	297	670.85	1339.69	670.35	1338.69	2	742.57	17.2	4061	47	5	228 - 238	R.QFDGLVDVYRK.T
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	272	447.24	1338.71	447.24	1338.69	3	10.37	16.6	93214	55	4	228 - 238	R.QFDGLVDVYRK.T
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	43	736.39	735.39	736.39	735.38	1	9.86	11	49821	34	5	120 - 125	R.LSEPYK.G
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	258	672.87	1343.73	672.86	1343.71	2	10.86	16.3	55394	64	3	106 - 116	K.LLIQNQDEMIK.A
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	409	749.40	1496.79	749.40	1496.78	2	8.89	21.4	4445	39	2	251 - 263	R.GFNISCVGIIVYR.G	Carbamidomethyl: 6
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	315	523.34	1044.67	523.34	1044.67	2	5.02	17.7	11986	57	3	367 - 375	K.LQLIVFGKK.Y
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	201	794.45	1586.89	794.44	1586.87	2	9.80	15	49471	45	2	104 - 116	R.VKLLIQNQDEMIK.A	Oxidation: 11
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	160	796.48	795.47	796.47	795.46	1	7.19	14.1	81505	24	1	171 - 176	R.LFNFKK.D
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	240	483.26	964.50	483.26	964.50	2	7.19	15.9	12852	65	3	242 - 250	K.TDGIAGLYR.G
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	9	414.74	827.46	414.73	827.45	2	7.80	9.7	4437	62	3	96 - 103	K.TAAAPIER.V
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	440	702.74	2105.20	702.74	2105.19	3	4.60	22.6	11494	44	3	354 - 374	R.AVAGAGVLSGYDKLQLIVFGK.K
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	188	680.87	1359.72	680.86	1359.71	2	12.84	14.7	14011	71	6	106 - 116	K.LLIQNQDEMIK.A	Oxidation: 9
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	64	550.75	1099.48	550.74	1099.47	2	9.88	11.6	34321	38	4	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 3
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	212	681.36	1360.71	680.86	1359.71	2	736.31	15.3	32776	22	6	106 - 116	K.LLIQNQDEMIK.A	Oxidation: 9
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	78	771.46	770.45	771.45	770.44	1	10.41	12.3	14667	25	3	346 - 353	K.GAGANILR.A
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	346	1211.62	1210.61	1211.61	1210.60	1	8.65	18.5	4501	29	1	228 - 237	R.QFDGLVDVYR.K
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	66	550.75	1099.48	550.74	1099.47	2	8.48	11.7	3943	21	4	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 1
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	3	558.74	1115.47	558.74	1115.47	2	6.86	9.5	149452	34	4	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 1
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	65	550.75	1099.48	550.74	1099.47	2	7.44	11.7	4602	46	4	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 3
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	3	558.74	1115.47	558.74	1115.47	2	6.86	9.5	149452	34	4	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 2
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	74	470.22	938.43	470.22	938.42	2	10.63	12.1	55451	28	3	177 - 183	K.DRDGYWK.W
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	140	529.78	1057.55	529.78	1057.54	2	8.36	13.7	64576	65	3	324 - 332	K.YKSSLDAFK.Q
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	137	529.78	1057.55	529.78	1057.54	2	8.32	13.6	11032	68	3	324 - 332	K.YKSSLDAFK.Q
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	286	668.38	667.37	668.38	667.37	1	7.21	17	8071	27	2	171 - 175	R.LFNFK.K
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	146	767.40	766.39	767.39	766.39	1	9.88	13.8	57680	52	3	326 - 332	K.SSLDAFK.Q
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	66	550.75	1099.48	550.74	1099.47	2	8.48	11.7	3943	19	4	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 3
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	221	604.33	1206.64	604.32	1206.62	2	11.13	15.5	16396	78	3	354 - 366	R.AVAGAGVLSGYDK.L
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	237	483.26	964.51	483.26	964.50	2	9.30	15.8	6543	60	3	242 - 250	K.TDGIAGLYR.G
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	42	736.39	735.39	736.39	735.38	1	8.88	10.9	5872	34	5	120 - 125	R.LSEPYK.G
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	331	470.25	1407.73	470.25	1407.71	3	8.17	18.2	4774	63	3	134 - 145	R.TIKDEGFGSLWR.G
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	442	1053.61	2105.20	1053.60	2105.19	2	7.23	22.6	3985	24	1	354 - 374	R.AVAGAGVLSGYDKLQLIVFGK.K
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	444	702.74	2105.20	702.74	2105.19	3	7.29	22.7	6513	65	3	354 - 374	R.AVAGAGVLSGYDKLQLIVFGK.K
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	393	533.76	1065.50	533.75	1065.49	2	10.56	20	9868	44	2	137 - 145	K.DEGFGSLWR.G
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	388	459.30	916.58	459.29	916.57	2	7.20	19.9	509461	54	3	367 - 374	K.LQLIVFGK.K
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	218	604.33	1206.64	604.32	1206.62	2	12.72	15.4	6911	88	3	354 - 366	R.AVAGAGVLSGYDK.L
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	386	459.30	916.58	459.29	916.57	2	6.09	19.9	12430	54	3	367 - 374	K.LQLIVFGK.K
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	14	828.47	827.46	828.46	827.45	1	9.56	9.9	6451	16	2	96 - 103	K.TAAAPIER.V
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	353	625.36	1248.71	625.36	1248.71	2	1.13	18.7	11021	27	2	326 - 336	K.SSLDAFKQILK.N
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	64	550.75	1099.48	550.74	1099.47	2	9.88	11.6	34321	58	4	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 2
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	263	416.25	1245.73	416.25	1245.72	3	4.63	16.4	71837	40	1	342 - 353	K.SLFKGAGANILR.A
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	234	483.26	964.51	483.26	964.50	2	7.88	15.8	13430	69	3	242 - 250	K.TDGIAGLYR.G
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	1	558.74	1115.47	558.74	1115.47	2	6.82	9.4	7615	23	4	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 1
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	337	470.25	1407.73	470.25	1407.71	3	8.55	18.3	8219	63	3	134 - 145	R.TIKDEGFGSLWR.G
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	389	917.59	916.58	917.58	916.57	1	7.21	19.9	60242	57	3	367 - 374	K.LQLIVFGK.K
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	64	550.75	1099.48	550.74	1099.47	2	9.88	11.6	34321	40	4	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 1
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	276	670.36	1338.71	670.35	1338.69	2	9.94	16.7	12190	77	5	228 - 238	R.QFDGLVDVYRK.T
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	63	550.75	1099.48	550.74	1099.47	2	5.97	11.6	18795	54	4	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 2
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	335	704.87	1407.73	704.86	1407.71	2	7.92	18.2	18972	88	3	134 - 145	R.TIKDEGFGSLWR.G
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	345	606.31	1210.61	606.31	1210.60	2	8.65	18.5	4868	80	7	228 - 237	R.QFDGLVDVYR.K
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	334	470.25	1407.73	470.25	1407.71	3	7.92	18.2	3348	64	3	134 - 145	R.TIKDEGFGSLWR.G
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	2	558.75	1115.48	558.74	1115.47	2	10.35	9.4	165287	35	4	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 2
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	41	736.39	735.39	736.39	735.38	1	8.47	10.9	25157	27	5	120 - 125	R.LSEPYK.G
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	8	558.74	1115.47	558.74	1115.47	2	6.16	9.7	5695	36	3	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 1
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	235	436.58	1306.73	436.58	1306.72	3	5.52	15.8	34645	53	2	239 - 250	K.TLKTDGIAGLYR.G
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	271	670.36	1338.71	670.35	1338.69	2	10.19	16.6	5317	67	5	228 - 238	R.QFDGLVDVYRK.T
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	32	423.23	844.45	422.74	843.46	2	1171.16	10.5	6392	37	5	146 - 153	R.GNTANVIR.Y
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	365	606.80	1211.59	606.31	1210.60	2	820.95	19	109988	60	7	228 - 237	R.QFDGLVDVYR.K
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	11	828.46	827.46	828.46	827.45	1	8.40	9.8	12506	21	2	96 - 103	K.TAAAPIER.V
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	152	767.40	766.39	767.39	766.39	1	10.72	13.9	11873	49	3	326 - 332	K.SSLDAFK.Q
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	20	422.74	843.46	422.74	843.46	2	5.80	10	11813	43	5	146 - 153	R.GNTANVIR.Y
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	33	423.23	844.45	422.74	843.46	2	1173.38	10.6	509461	26	5	146 - 153	R.GNTANVIR.Y
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	8	558.74	1115.47	558.74	1115.47	2	6.16	9.7	5695	23	4	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 2
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	320	523.35	1044.68	523.34	1044.67	2	5.88	17.8	6255	52	3	367 - 375	K.LQLIVFGKK.Y
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	183	680.87	1359.72	680.86	1359.71	2	10.95	14.6	31254	62	6	106 - 116	K.LLIQNQDEMIK.A	Oxidation: 9
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	192	454.25	1359.72	454.24	1359.71	3	12.44	14.8	7315	39	3	106 - 116	K.LLIQNQDEMIK.A	Oxidation: 9
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	13	414.74	827.46	414.73	827.45	2	9.54	9.8	18063	55	3	96 - 103	K.TAAAPIER.V
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	10	414.74	827.46	414.73	827.45	2	8.38	9.8	109988	57	3	96 - 103	K.TAAAPIER.V
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	2	558.75	1115.48	558.74	1115.47	2	10.35	9.4	165287	31	3	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 1
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	356	417.24	1248.71	417.24	1248.71	3	3.25	18.7	7615	41	1	326 - 336	K.SSLDAFKQILK.N
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	423	723.88	1445.75	723.87	1445.73	2	9.19	21.9	9255	69	4	154 - 165	R.YFPTQALNFAFK.D
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	364	606.80	1211.59	606.31	1210.60	2	820.29	19	4437	58	7	228 - 237	R.QFDGLVDVYR.K
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	256	447.24	1338.70	447.24	1338.69	3	6.01	16.3	44130	46	4	228 - 238	R.QFDGLVDVYRK.T
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	289	668.38	667.37	668.38	667.37	1	8.30	17	11487	17	2	171 - 175	R.LFNFK.K
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	216	681.36	1360.71	680.86	1359.71	2	735.91	15.3	5537	20	6	106 - 116	K.LLIQNQDEMIK.A	Oxidation: 9
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	141	1058.56	1057.55	1058.55	1057.54	1	8.36	13.7	58150	26	2	324 - 332	K.YKSSLDAFK.Q
1172	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	63	550.75	1099.48	550.74	1099.47	2	5.97	11.6	18795	38	4	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 1
1232	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	247	417.24	1248.71	417.24	1248.71	3	2.89	18.6	5766	28	1	326 - 336	K.SSLDAFKQILK.N
1232	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	145	529.96	1586.87	529.96	1586.87	3	1.43	15	16696	34	1	104 - 116	R.VKLLIQNQDEMIK.A	Oxidation: 11
1232	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	236	470.25	1407.72	470.25	1407.71	3	2.09	18.3	41720	71	3	134 - 145	R.TIKDEGFGSLWR.G
1232	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	5	414.73	827.45	414.73	827.45	2	-1.10	9.7	4639	31	3	96 - 103	K.TAAAPIER.V
1232	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	2	475.21	1422.62	475.21	1422.62	3	-0.60	9.5	12123	55	4	314 - 325	R.MMMTSGEAVKYK.S	Oxidation: 1
1232	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	202	670.36	1338.70	670.35	1338.69	2	3.57	16.6	6288	51	1	228 - 238	R.QFDGLVDVYRK.T
1232	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	92	548.96	1643.87	548.96	1643.87	3	1.00	13.7	17821	51	3	106 - 119	K.LLIQNQDEMIKAGR.L	Oxidation: 9
1232	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	171	483.26	964.50	483.26	964.50	2	1.05	15.9	3865	18	1	242 - 250	K.TDGIAGLYR.G
1232	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	4	475.21	1422.62	475.21	1422.62	3	-1.48	9.6	14682	41	4	314 - 325	R.MMMTSGEAVKYK.S	Oxidation: 1
1232	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	132	680.86	1359.71	680.86	1359.71	2	3.79	14.7	4759	89	3	106 - 116	K.LLIQNQDEMIK.A	Oxidation: 9
1232	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	7	414.73	827.45	414.73	827.45	2	0.01	9.7	90267	58	3	96 - 103	K.TAAAPIER.V
1232	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	151	543.63	1627.87	543.63	1627.87	3	-2.44	15.4	5353	48	2	106 - 119	K.LLIQNQDEMIKAGR.L
1232	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	232	470.25	1407.72	470.25	1407.71	3	0.75	18.2	3725	42	3	134 - 145	R.TIKDEGFGSLWR.G
1232	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	15	422.73	843.45	422.74	843.46	2	-4.04	9.9	7714	29	2	146 - 153	R.GNTANVIR.Y
1232	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	172	533.60	1597.78	533.59	1597.76	3	17.75	15.9	7695	49	3	120 - 133	R.LSEPYKGIGDCFGR.T	Carbamidomethyl: 11
1232	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	3	475.21	1422.62	475.21	1422.62	3	0.69	9.5	17441	50	4	314 - 325	R.MMMTSGEAVKYK.S	Oxidation: 1
1232	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	189	416.25	1245.72	416.25	1245.72	3	0.52	16.3	27844	55	2	342 - 353	K.SLFKGAGANILR.A
1232	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	190	623.87	1245.72	623.87	1245.72	2	0.54	16.3	18323	43	2	342 - 353	K.SLFKGAGANILR.A
1232	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	138	454.24	1359.71	454.24	1359.71	3	4.19	14.9	6873	25	1	106 - 116	K.LLIQNQDEMIK.A	Oxidation: 9
1232	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	13	422.73	843.45	422.74	843.46	2	-2.58	9.9	8962	38	2	146 - 153	R.GNTANVIR.Y
1232	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	192	672.86	1343.71	672.86	1343.71	2	1.28	16.4	15433	70	2	106 - 116	K.LLIQNQDEMIK.A
1232	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	153	543.63	1627.87	543.63	1627.87	3	-2.22	15.4	10006	44	2	106 - 119	K.LLIQNQDEMIKAGR.L
1232	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	1	475.21	1422.62	475.21	1422.62	3	-1.73	9.5	5313	33	4	314 - 325	R.MMMTSGEAVKYK.S	Oxidation: 1
1232	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	98	548.96	1643.87	548.96	1643.87	3	1.16	13.9	21685	59	3	106 - 119	K.LLIQNQDEMIKAGR.L	Oxidation: 9
1232	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	137	680.86	1359.71	680.86	1359.71	2	4.20	14.8	43183	84	3	106 - 116	K.LLIQNQDEMIK.A	Oxidation: 9
1232	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	95	548.96	1643.87	548.96	1643.87	3	0.67	13.8	61415	53	3	106 - 119	K.LLIQNQDEMIKAGR.L	Oxidation: 9
1232	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	237	704.87	1407.72	704.86	1407.71	2	2.10	18.3	26877	55	2	134 - 145	R.TIKDEGFGSLWR.G
1232	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	204	447.24	1338.70	447.24	1338.69	3	1.40	16.7	19031	42	2	228 - 238	R.QFDGLVDVYRK.T
1232	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	187	623.87	1245.72	623.87	1245.72	2	-0.62	16.3	6638	54	2	342 - 353	K.SLFKGAGANILR.A
1232	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	134	680.86	1359.71	680.86	1359.71	2	4.40	14.8	30957	73	3	106 - 116	K.LLIQNQDEMIK.A	Oxidation: 9
1232	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	201	447.24	1338.70	447.24	1338.69	3	3.57	16.6	12263	32	2	228 - 238	R.QFDGLVDVYRK.T
1232	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	6	414.73	827.45	414.73	827.45	2	-0.08	9.7	27159	44	3	96 - 103	K.TAAAPIER.V
1232	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	186	416.25	1245.72	416.25	1245.72	3	-0.63	16.3	11790	35	2	342 - 353	K.SLFKGAGANILR.A
1232	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	233	470.25	1407.72	470.25	1407.71	3	2.64	18.2	25221	66	3	134 - 145	R.TIKDEGFGSLWR.G
1232	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	174	533.60	1597.77	533.59	1597.76	3	6.94	16	23813	67	3	120 - 133	R.LSEPYKGIGDCFGR.T	Carbamidomethyl: 11
1232	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	191	672.87	1343.72	672.86	1343.71	2	3.48	16.3	11757	67	2	106 - 116	K.LLIQNQDEMIK.A
1232	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	243	606.31	1210.60	606.31	1210.60	2	3.29	18.4	6619	70	2	228 - 237	R.QFDGLVDVYR.K
1232	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	234	704.87	1407.72	704.86	1407.71	2	2.64	18.3	15141	44	2	134 - 145	R.TIKDEGFGSLWR.G
1232	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	245	625.36	1248.71	625.36	1248.71	2	-1.55	18.6	4905	21	1	326 - 336	K.SSLDAFKQILK.N
1232	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	244	606.31	1210.60	606.31	1210.60	2	4.13	18.5	8940	67	2	228 - 237	R.QFDGLVDVYR.K
1232	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	177	533.60	1597.76	533.59	1597.76	3	4.87	16	13817	35	3	120 - 133	R.LSEPYKGIGDCFGR.T	Carbamidomethyl: 11
1286	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	342	470.25	1407.72	470.25	1407.71	3	3.28	18.1	86033	47	2	134 - 145	R.TIKDEGFGSLWR.G
1286	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	162	548.97	1643.87	548.96	1643.87	3	4.60	13.6	20503	38	2	106 - 119	K.LLIQNQDEMIKAGR.L	Oxidation: 9
1286	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	343	704.87	1407.72	704.86	1407.71	2	3.29	18.1	6415	57	2	134 - 145	R.TIKDEGFGSLWR.G
1286	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	166	548.97	1643.87	548.96	1643.87	3	4.18	13.7	4569	39	2	106 - 119	K.LLIQNQDEMIKAGR.L	Oxidation: 9
1286	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	25	414.73	827.45	414.73	827.45	2	-5.48	9.8	20215	37	6	96 - 103	K.TAAAPIER.V
1286	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	24	414.73	827.45	414.73	827.45	2	-1.53	9.8	11812	50	6	96 - 103	K.TAAAPIER.V
1286	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	229	543.63	1627.87	543.63	1627.87	3	-1.77	15.1	5986	35	1	106 - 119	K.LLIQNQDEMIKAGR.L
1286	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	351	606.31	1210.61	606.31	1210.60	2	6.51	18.4	12520	71	1	228 - 237	R.QFDGLVDVYR.K
1286	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	12	475.21	1422.62	475.21	1422.62	3	-0.41	9.4	4122	45	3	314 - 325	R.MMMTSGEAVKYK.S	Oxidation: 1
1286	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	253	533.60	1597.77	533.59	1597.76	3	6.79	15.7	12979	21	3	120 - 133	R.LSEPYKGIGDCFGR.T	Carbamidomethyl: 11
1286	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	255	533.59	1597.76	533.59	1597.76	3	4.48	15.8	10345	43	3	120 - 133	R.LSEPYKGIGDCFGR.T	Carbamidomethyl: 11
1286	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	22	414.73	827.45	414.73	827.45	2	2.04	9.7	5942	53	6	96 - 103	K.TAAAPIER.V
1286	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	345	704.87	1407.72	704.86	1407.71	2	2.17	18.2	65588	31	2	134 - 145	R.TIKDEGFGSLWR.G
1286	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	19	414.73	827.45	414.73	827.45	2	2.01	9.6	4935	55	6	96 - 103	K.TAAAPIER.V
1286	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	15	475.21	1422.62	475.21	1422.62	3	2.54	9.4	7723	21	3	314 - 325	R.MMMTSGEAVKYK.S	Oxidation: 1
1286	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	18	414.73	827.45	414.73	827.45	2	0.90	9.6	4945	61	6	96 - 103	K.TAAAPIER.V
1286	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	17	414.73	827.45	414.73	827.45	2	0.90	9.5	3585	27	6	96 - 103	K.TAAAPIER.V
1286	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	344	470.25	1407.72	470.25	1407.71	3	2.17	18.2	4421	49	2	134 - 145	R.TIKDEGFGSLWR.G
1286	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	202	680.87	1359.72	680.86	1359.71	2	6.44	14.5	15724	70	1	106 - 116	K.LLIQNQDEMIK.A	Oxidation: 9
1286	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	256	799.89	1597.76	799.89	1597.76	2	4.49	15.8	4210	29	1	120 - 133	R.LSEPYKGIGDCFGR.T	Carbamidomethyl: 11
1286	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	11	475.22	1422.62	475.21	1422.62	3	3.23	9.3	4456	38	3	314 - 325	R.MMMTSGEAVKYK.S	Oxidation: 1
1286	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	254	533.60	1597.77	533.59	1597.76	3	7.46	15.7	11325	44	3	120 - 133	R.LSEPYKGIGDCFGR.T	Carbamidomethyl: 11
1286	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	23	422.73	843.45	422.74	843.46	2	-4.18	9.7	23889	17	1	146 - 153	R.GNTANVIR.Y
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	30	475.21	1422.61	475.21	1422.62	3	-5.79	9.3	42913	28	2	314 - 325	R.MMMTSGEAVKYK.S	Oxidation: 1
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	310	533.59	1597.75	533.59	1597.76	3	-3.88	15.9	41590	61	2	120 - 133	R.LSEPYKGIGDCFGR.T	Carbamidomethyl: 11
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	304	483.25	964.49	483.26	964.50	2	-6.40	15.8	50787	60	3	242 - 250	K.TDGIAGLYR.G
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	221	767.39	766.38	767.39	766.39	1	-5.65	13.9	72967	43	3	326 - 332	K.SSLDAFK.Q
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	26	558.73	1115.46	558.74	1115.47	2	-9.59	9.2	101374	48	10	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 1
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	408	470.24	1407.70	470.25	1407.71	3	-7.59	18.2	4634	61	3	134 - 145	R.TIKDEGFGSLWR.G
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	25	558.74	1115.46	558.74	1115.47	2	-9.21	9.2	47431	32	10	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 2
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	570	667.33	1998.98	667.34	1998.99	3	-5.55	22.9	21867	28	3	154 - 169	R.YFPTQALNFAFKDYFK.R
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	411	470.24	1407.71	470.25	1407.71	3	-6.69	18.2	6033	63	3	134 - 145	R.TIKDEGFGSLWR.G
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	339	670.35	1338.68	670.35	1338.69	2	-6.96	16.5	17221	75	2	228 - 238	R.QFDGLVDVYRK.T
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	49	422.73	843.45	422.74	843.46	2	-8.13	9.8	57629	34	3	146 - 153	R.GNTANVIR.Y
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	343	447.24	1338.68	447.24	1338.69	3	-7.07	16.7	34082	60	3	228 - 238	R.QFDGLVDVYRK.T
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	23	558.74	1115.46	558.74	1115.47	2	-8.78	9.1	121929	26	10	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 2
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	11	558.74	1115.46	558.74	1115.47	2	-8.69	8.7	38870	16	9	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 1
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	355	668.37	667.36	668.38	667.37	1	-8.31	16.9	405018	21	3	171 - 175	R.LFNFK.K
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	593	683.34	2046.99	683.34	2047.01	3	-6.89	25	7232	94	1	76 - 95	K.GFTNFALDFLMGGVSAAVSK.T	Oxidation: 11
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	412	704.86	1407.71	704.86	1407.71	2	-6.71	18.2	7256	70	3	134 - 145	R.TIKDEGFGSLWR.G
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	400	606.30	1210.59	606.31	1210.60	2	-6.24	18	143930	64	5	228 - 237	R.QFDGLVDVYR.K
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	44	422.73	843.45	422.74	843.46	2	-8.73	9.6	103115	41	3	146 - 153	R.GNTANVIR.Y
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	8	558.74	1115.46	558.74	1115.47	2	-8.53	8.6	90693	44	10	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 2
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	498	749.39	1496.77	749.40	1496.78	2	-8.11	21	6689	93	2	251 - 263	R.GFNISCVGIIVYR.G	Carbamidomethyl: 6
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	23	558.74	1115.46	558.74	1115.47	2	-8.78	9.1	121929	23	9	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 1
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	341	670.35	1338.68	670.35	1338.69	2	-6.96	16.6	12724	56	2	228 - 238	R.QFDGLVDVYRK.T
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	87	736.38	735.37	736.39	735.38	1	-7.93	10.9	9566	44	3	120 - 125	R.LSEPYK.G
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	552	702.73	2105.17	702.74	2105.19	3	-6.44	22.3	21110	44	3	354 - 374	R.AVAGAGVLSGYDKLQLIVFGK.K
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	76	550.74	1099.46	550.74	1099.47	2	-9.42	10.5	4823	33	3	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 3
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	283	604.31	1206.62	604.32	1206.62	2	-7.70	15.3	28145	74	3	354 - 366	R.AVAGAGVLSGYDK.L
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	214	767.39	766.38	767.39	766.39	1	-6.09	13.8	14014	35	3	326 - 332	K.SSLDAFK.Q
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	143	771.44	770.43	771.45	770.44	1	-7.04	12.2	26159	29	3	346 - 353	K.GAGANILR.A
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	217	767.39	766.38	767.39	766.39	1	-5.19	13.8	6775	46	3	326 - 332	K.SSLDAFK.Q
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	132	470.22	938.42	470.22	938.42	2	-5.00	11.9	4105	17	3	177 - 183	K.DRDGYWK.W
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	10	558.74	1115.46	558.74	1115.47	2	-8.80	8.6	7998	34	10	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 1
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	280	604.31	1206.61	604.32	1206.62	2	-9.70	15.2	7693	74	3	354 - 366	R.AVAGAGVLSGYDK.L
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	517	723.87	1445.72	723.87	1445.73	2	-6.73	21.4	32444	52	3	154 - 165	R.YFPTQALNFAFK.D
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	39	414.73	827.44	414.73	827.45	2	-9.29	9.5	14738	53	4	96 - 103	K.TAAAPIER.V
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	43	414.73	827.44	414.73	827.45	2	-6.38	9.6	17246	57	4	96 - 103	K.TAAAPIER.V
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	11	558.74	1115.46	558.74	1115.47	2	-8.69	8.7	38870	32	10	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 1
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	502	749.39	1496.77	749.40	1496.78	2	-7.05	21	43248	70	2	251 - 263	R.GFNISCVGIIVYR.G	Carbamidomethyl: 6
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	337	447.24	1338.68	447.24	1338.69	3	-6.96	16.5	137340	60	3	228 - 238	R.QFDGLVDVYRK.T
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	9	558.74	1115.46	558.74	1115.47	2	-8.52	8.6	6317	48	10	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 2
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	25	558.74	1115.46	558.74	1115.47	2	-9.21	9.2	47431	29	9	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 1
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	40	414.73	827.44	414.73	827.45	2	-7.37	9.6	9636	51	4	96 - 103	K.TAAAPIER.V
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	191	668.30	667.29	668.30	667.30	1	-7.08	13.2	66813	26	3	179 - 183	R.DGYWK.W
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	256	680.86	1359.70	680.86	1359.71	2	-6.24	14.7	6091	65	3	106 - 116	K.LLIQNQDEMIK.A	Oxidation: 9
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	22	558.74	1115.46	558.74	1115.47	2	-7.69	9.1	28892	29	10	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 2
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	23	558.74	1115.46	558.74	1115.47	2	-8.78	9.1	121929	41	10	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 1
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	340	447.24	1338.68	447.24	1338.69	3	-6.96	16.6	62586	64	3	228 - 238	R.QFDGLVDVYRK.T
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	307	483.25	964.49	483.26	964.50	2	-6.73	15.9	39579	64	3	242 - 250	K.TDGIAGLYR.G
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	13	558.74	1115.46	558.74	1115.47	2	-8.68	8.7	12464	34	10	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 1
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	233	441.20	880.39	441.20	880.39	2	0.81	14.2	21865	17	3	126 - 133	K.GIGDCFGR.T	Carbamidomethyl: 5
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	203	529.78	1057.54	529.78	1057.54	2	-5.80	13.5	13061	63	2	324 - 332	K.YKSSLDAFK.Q
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	439	459.29	916.56	459.29	916.57	2	-10.54	18.8	6304	36	2	367 - 374	K.LQLIVFGK.K
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	141	771.44	770.44	771.45	770.44	1	-5.12	12.1	16915	29	3	346 - 353	K.GAGANILR.A
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	567	1000.50	1998.98	1000.50	1998.99	2	-5.01	22.8	15049	86	1	154 - 169	R.YFPTQALNFAFKDYFK.R
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	22	558.74	1115.46	558.74	1115.47	2	-7.69	9.1	28892	46	10	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 1
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	227	441.20	880.38	441.20	880.39	2	-5.70	14	13521	26	3	126 - 133	K.GIGDCFGR.T	Carbamidomethyl: 5
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	165	542.74	1083.47	542.75	1083.48	2	-10.03	12.6	18994	33	2	314 - 323	R.MMMTSGEAVK.Y
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	187	668.30	667.29	668.30	667.30	1	-6.51	13.2	10536	30	3	179 - 183	R.DGYWK.W
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	557	702.73	2105.18	702.74	2105.19	3	-5.29	22.4	6465	66	3	354 - 374	R.AVAGAGVLSGYDKLQLIVFGK.K
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	128	470.22	938.42	470.22	938.42	2	-5.04	11.8	33528	23	3	177 - 183	K.DRDGYWK.W
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	73	550.74	1099.46	550.74	1099.47	2	-9.99	10.4	9283	32	2	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 2
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	8	558.74	1115.46	558.74	1115.47	2	-8.53	8.6	90693	34	10	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 1
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	13	558.74	1115.46	558.74	1115.47	2	-8.68	8.7	12464	47	10	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 2
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	555	1053.60	2105.18	1053.60	2105.19	2	-4.95	22.4	13079	29	1	354 - 374	R.AVAGAGVLSGYDKLQLIVFGK.K
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	50	414.73	827.44	414.73	827.45	2	-9.99	9.8	405018	39	4	96 - 103	K.TAAAPIER.V
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	251	680.86	1359.70	680.86	1359.71	2	-5.27	14.6	40680	70	3	106 - 116	K.LLIQNQDEMIK.A	Oxidation: 9
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	324	672.86	1343.70	672.86	1343.71	2	-8.90	16.2	45087	70	3	106 - 116	K.LLIQNQDEMIK.A
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	523	723.87	1445.72	723.87	1445.73	2	-7.37	21.5	16458	77	3	154 - 165	R.YFPTQALNFAFK.D
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	90	736.38	735.37	736.39	735.38	1	-7.53	11	4354	40	3	120 - 125	R.LSEPYK.G
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	26	558.73	1115.46	558.74	1115.47	2	-9.59	9.2	101374	29	9	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 1
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	325	672.86	1343.70	672.86	1343.71	2	-7.03	16.3	71378	81	3	106 - 116	K.LLIQNQDEMIK.A
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	403	606.30	1210.59	606.31	1210.60	2	-8.93	18	162600	41	5	228 - 237	R.QFDGLVDVYR.K
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	84	736.38	735.37	736.39	735.38	1	-8.41	10.8	10501	45	3	120 - 125	R.LSEPYK.G
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	592	1024.50	2046.99	1024.51	2047.01	2	-6.90	25	13912	88	1	76 - 95	K.GFTNFALDFLMGGVSAAVSK.T	Oxidation: 11
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	305	965.50	964.49	965.51	964.50	1	-6.41	15.8	36113	25	1	242 - 250	K.TDGIAGLYR.G
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	286	604.32	1206.62	604.32	1206.62	2	-6.06	15.4	22593	97	3	354 - 366	R.AVAGAGVLSGYDK.L
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	554	702.73	2105.18	702.74	2105.19	3	-4.95	22.4	24992	65	3	354 - 374	R.AVAGAGVLSGYDKLQLIVFGK.K
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	12	558.74	1115.46	558.74	1115.47	2	-9.05	8.7	12583	24	9	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 1
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	328	672.86	1343.70	672.86	1343.71	2	-7.28	16.3	121929	64	3	106 - 116	K.LLIQNQDEMIK.A
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	442	917.58	916.57	917.58	916.57	1	-7.11	18.9	4449	67	2	367 - 374	K.LQLIVFGK.K
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	410	704.86	1407.70	704.86	1407.71	2	-7.59	18.2	11538	81	3	134 - 145	R.TIKDEGFGSLWR.G
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	230	441.20	880.38	441.20	880.39	2	-4.72	14.1	48170	23	3	126 - 133	K.GIGDCFGR.T	Carbamidomethyl: 5
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	500	499.93	1496.77	499.93	1496.78	3	-8.11	21	21770	81	1	251 - 263	R.GFNISCVGIIVYR.G	Carbamidomethyl: 6
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	13	558.74	1115.46	558.74	1115.47	2	-8.68	8.7	12464	21	9	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 1
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	417	606.30	1210.59	606.31	1210.60	2	-7.86	18.4	39309	83	5	228 - 237	R.QFDGLVDVYR.K
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	313	533.59	1597.74	533.59	1597.76	3	-6.91	16	90693	41	2	120 - 133	R.LSEPYKGIGDCFGR.T	Carbamidomethyl: 11
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	301	483.25	964.49	483.26	964.50	2	-6.69	15.7	22491	54	3	242 - 250	K.TDGIAGLYR.G
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	352	668.37	667.36	668.38	667.37	1	-8.28	16.9	197513	20	3	171 - 175	R.LFNFK.K
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	11	558.74	1115.46	558.74	1115.47	2	-8.69	8.7	38870	44	10	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 2
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	306	654.36	1306.71	654.37	1306.72	2	-13.86	15.8	22844	51	1	239 - 250	K.TLKTDGIAGLYR.G
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	9	558.74	1115.46	558.74	1115.47	2	-8.52	8.6	6317	30	10	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 1
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	440	917.57	916.56	917.58	916.57	1	-10.54	18.8	3451	54	2	367 - 374	K.LQLIVFGK.K
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	25	558.74	1115.46	558.74	1115.47	2	-9.21	9.2	47431	46	10	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 1
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	12	558.74	1115.46	558.74	1115.47	2	-9.05	8.7	12583	39	10	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 1
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	146	771.44	770.43	771.45	770.44	1	-6.99	12.2	80427	21	3	346 - 353	K.GAGANILR.A
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	46	422.73	843.45	422.74	843.46	2	-7.95	9.7	17775	33	3	146 - 153	R.GNTANVIR.Y
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	125	470.22	938.42	470.22	938.42	2	-3.19	11.8	32385	22	3	177 - 183	K.DRDGYWK.W
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	73	550.74	1099.46	550.74	1099.47	2	-9.99	10.4	9283	61	3	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 3
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	568	667.33	1998.97	667.34	1998.99	3	-6.53	22.9	31840	37	3	154 - 169	R.YFPTQALNFAFKDYFK.R
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	77	550.74	1099.46	550.74	1099.47	2	-9.91	10.5	20293	45	3	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 3
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	424	606.30	1210.59	606.31	1210.60	2	-6.62	18.5	28670	72	5	228 - 237	R.QFDGLVDVYR.K
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	267	529.96	1586.86	529.96	1586.87	3	-8.25	14.9	22419	32	1	104 - 116	R.VKLLIQNQDEMIK.A	Oxidation: 11
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	556	527.30	2105.18	527.30	2105.19	4	-4.94	22.4	40680	39	1	354 - 374	R.AVAGAGVLSGYDKLQLIVFGK.K
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	565	667.33	1998.98	667.34	1998.99	3	-5.01	22.8	59588	24	3	154 - 169	R.YFPTQALNFAFKDYFK.R
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	161	542.74	1083.47	542.75	1083.48	2	-8.31	12.6	7950	53	2	314 - 323	R.MMMTSGEAVK.Y
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	26	558.73	1115.46	558.74	1115.47	2	-9.59	9.2	101374	31	10	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 2
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	12	558.74	1115.46	558.74	1115.47	2	-9.05	8.7	12583	54	10	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 2
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	441	459.29	916.57	459.29	916.57	2	-7.10	18.9	21961	49	2	367 - 374	K.LQLIVFGK.K
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	253	680.86	1359.70	680.86	1359.71	2	-6.31	14.6	4235	79	3	106 - 116	K.LLIQNQDEMIK.A	Oxidation: 9
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	326	448.91	1343.70	448.91	1343.71	3	-7.04	16.3	44318	37	1	106 - 116	K.LLIQNQDEMIK.A
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	416	704.86	1407.71	704.86	1407.71	2	-5.66	18.3	20361	45	3	134 - 145	R.TIKDEGFGSLWR.G
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	349	668.37	667.36	668.38	667.37	1	-8.08	16.8	103115	25	3	171 - 175	R.LFNFK.K
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	184	668.30	667.29	668.30	667.30	1	-4.69	13.1	8560	29	3	179 - 183	R.DGYWK.W
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	22	558.74	1115.46	558.74	1115.47	2	-7.69	9.1	28892	30	9	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 1
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	8	558.74	1115.46	558.74	1115.47	2	-8.53	8.6	90693	19	9	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 1
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	446	533.75	1065.49	533.75	1065.49	2	-1.94	19	16915	46	1	137 - 145	K.DEGFGSLWR.G
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	414	470.24	1407.71	470.25	1407.71	3	-5.65	18.3	4638	63	3	134 - 145	R.TIKDEGFGSLWR.G
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	77	550.74	1099.46	550.74	1099.47	2	-9.91	10.5	20293	22	2	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 2
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	206	529.78	1057.54	529.78	1057.54	2	-4.87	13.6	29811	72	2	324 - 332	K.YKSSLDAFK.Q
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	31	475.21	1422.61	475.21	1422.62	3	-7.50	9.4	12210	27	2	314 - 325	R.MMMTSGEAVKYK.S	Oxidation: 1
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	10	558.74	1115.46	558.74	1115.47	2	-8.80	8.6	7998	47	10	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 2
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	10	558.74	1115.46	558.74	1115.47	2	-8.80	8.6	7998	19	9	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 1
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	520	723.87	1445.72	723.87	1445.73	2	-6.86	21.5	33586	63	3	154 - 165	R.YFPTQALNFAFK.D
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	420	606.30	1210.59	606.31	1210.60	2	-6.39	18.4	24649	77	5	228 - 237	R.QFDGLVDVYR.K
1343	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	36	566.73	1131.45	566.74	1131.46	2	-5.64	9.4	12724	31	1	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 1
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	133	542.74	1083.46	542.75	1083.48	2	-16.79	12.6	14369	61	2	314 - 323	R.MMMTSGEAVK.Y
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	439	459.29	916.56	459.29	916.57	2	-13.76	19.7	7544	54	3	367 - 374	K.LQLIVFGK.K
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	505	482.91	1445.72	482.92	1445.73	3	-10.57	21.7	4992	39	2	154 - 165	R.YFPTQALNFAFK.D
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	269	533.60	1597.77	533.59	1597.76	3	7.03	15.7	8035	46	3	120 - 133	R.LSEPYKGIGDCFGR.T	Carbamidomethyl: 11
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	2	558.73	1115.45	558.74	1115.47	2	-16.34	9.1	24281	47	5	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 1
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	50	469.88	1406.61	469.88	1406.62	3	-12.29	10.6	10377	54	3	314 - 325	R.MMMTSGEAVKYK.S	Oxidation: 1
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	220	454.24	1359.69	454.24	1359.71	3	-13.58	14.6	11145	34	3	106 - 116	K.LLIQNQDEMIK.A	Oxidation: 9
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	245	604.31	1206.61	604.32	1206.62	2	-12.94	15.2	12569	83	3	354 - 366	R.AVAGAGVLSGYDK.L
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	45	550.73	1099.46	550.74	1099.47	2	-14.45	10.4	71816	31	4	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 2
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	263	965.49	964.49	965.51	964.50	1	-12.12	15.6	13816	38	2	242 - 250	K.TDGIAGLYR.G
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	56	736.38	735.37	736.39	735.38	1	-12.43	10.7	13519	17	3	120 - 125	R.LSEPYK.G
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	152	668.30	667.29	668.30	667.30	1	-11.51	13.1	4505	33	3	179 - 183	R.DGYWK.W
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	46	550.74	1099.46	550.74	1099.47	2	-14.13	10.4	8653	27	4	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 2
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	365	704.86	1407.70	704.86	1407.71	2	-11.43	18	119697	78	3	134 - 145	R.TIKDEGFGSLWR.G
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	134	542.74	1083.46	542.75	1083.48	2	-15.80	12.7	7544	37	2	314 - 323	R.MMMTSGEAVK.Y
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	3	558.73	1115.45	558.74	1115.47	2	-16.30	9.1	16720	33	5	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 2
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	1	558.73	1115.45	558.74	1115.47	2	-16.82	9	197051	51	5	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 1
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	147	668.30	667.29	668.30	667.30	1	-10.19	13	6200	29	3	179 - 183	R.DGYWK.W
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	3	558.73	1115.45	558.74	1115.47	2	-16.30	9.1	16720	47	5	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 1
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	7	475.21	1422.60	475.21	1422.62	3	-10.99	9.3	56518	57	3	314 - 325	R.MMMTSGEAVKYK.S	Oxidation: 1
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	264	654.36	1306.71	654.37	1306.72	2	-12.68	15.6	60997	67	2	239 - 250	K.TLKTDGIAGLYR.G
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	46	550.74	1099.46	550.74	1099.47	2	-14.13	10.4	8653	49	4	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 3
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	302	670.35	1338.68	670.35	1338.69	2	-11.02	16.5	67322	79	3	228 - 238	R.QFDGLVDVYRK.T
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	10	712.31	1422.60	712.32	1422.62	2	-11.85	9.4	13146	19	2	314 - 325	R.MMMTSGEAVKYK.S	Oxidation: 1
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	170	529.77	1057.53	529.78	1057.54	2	-12.71	13.5	11870	59	2	324 - 332	K.YKSSLDAFK.Q
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	39	469.88	1406.61	469.88	1406.62	3	-13.76	10.2	20630	36	3	314 - 325	R.MMMTSGEAVKYK.S	Oxidation: 2
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	362	606.30	1210.58	606.31	1210.60	2	-14.90	17.9	289555	62	3	228 - 237	R.QFDGLVDVYR.K
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	98	470.21	938.41	470.22	938.42	2	-12.27	11.8	9041	23	2	177 - 183	K.DRDGYWK.W
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	3	558.73	1115.45	558.74	1115.47	2	-16.30	9.1	16720	29	5	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 1
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	484	749.39	1496.76	749.40	1496.78	2	-13.35	21.2	2387	67	3	251 - 263	R.GFNISCVGIIVYR.G	Carbamidomethyl: 6
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	528	702.73	2105.17	702.74	2105.19	3	-10.53	22.4	28934	52	3	354 - 374	R.AVAGAGVLSGYDKLQLIVFGK.K
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	48	550.74	1099.46	550.74	1099.47	2	-13.82	10.5	23167	62	4	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 3
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	173	548.96	1643.85	548.96	1643.87	3	-12.30	13.6	30542	52	2	106 - 119	K.LLIQNQDEMIKAGR.L	Oxidation: 9
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	57	736.38	735.37	736.39	735.38	1	-12.39	10.8	289555	44	3	120 - 125	R.LSEPYK.G
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	14	566.73	1131.45	566.74	1131.46	2	-9.56	9.5	4900	32	2	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 1
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	482	749.39	1496.76	749.40	1496.78	2	-12.01	21.1	26579	67	3	251 - 263	R.GFNISCVGIIVYR.G	Carbamidomethyl: 6
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	228	794.43	1586.85	794.44	1586.87	2	-12.88	14.8	43236	54	2	104 - 116	R.VKLLIQNQDEMIK.A	Oxidation: 11
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	262	483.25	964.49	483.26	964.50	2	-12.09	15.6	22296	58	3	242 - 250	K.TDGIAGLYR.G
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	436	459.29	916.56	459.29	916.57	2	-15.72	19.6	10159	37	3	367 - 374	K.LQLIVFGK.K
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	371	704.86	1407.70	704.86	1407.71	2	-10.04	18.1	13099	81	3	134 - 145	R.TIKDEGFGSLWR.G
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	83	550.74	1099.46	550.74	1099.47	2	-13.24	11.4	36369	46	4	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 3
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	301	447.23	1338.68	447.24	1338.69	3	-11.01	16.5	16042	54	5	228 - 238	R.QFDGLVDVYRK.T
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	215	680.85	1359.69	680.86	1359.71	2	-13.36	14.5	11204	70	3	106 - 116	K.LLIQNQDEMIK.A	Oxidation: 9
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	547	1024.50	2046.99	1024.51	2047.01	2	-8.52	24.9	9329	98	2	76 - 95	K.GFTNFALDFLMGGVSAAVSK.T	Oxidation: 11
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	359	606.30	1210.58	606.31	1210.60	2	-12.43	17.9	214830	70	3	228 - 237	R.QFDGLVDVYR.K
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	502	482.91	1445.72	482.92	1445.73	3	-11.08	21.6	5457	56	2	154 - 165	R.YFPTQALNFAFK.D
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	48	550.74	1099.46	550.74	1099.47	2	-13.82	10.5	23167	36	4	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 2
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	15	414.73	827.44	414.73	827.45	2	-12.19	9.5	102787	53	3	96 - 103	K.TAAAPIER.V
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	1	558.73	1115.45	558.74	1115.47	2	-16.82	9	197051	29	5	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 1
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	259	436.58	1306.71	436.58	1306.72	3	-13.51	15.5	21600	49	1	239 - 250	K.TLKTDGIAGLYR.G
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	286	672.85	1343.70	672.86	1343.71	2	-12.54	16.1	47618	75	2	106 - 116	K.LLIQNQDEMIK.A
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	113	771.44	770.43	771.45	770.44	1	-11.89	12.2	8162	21	3	346 - 353	K.GAGANILR.A
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	498	723.87	1445.72	723.87	1445.73	2	-11.57	21.5	13521	67	3	154 - 165	R.YFPTQALNFAFK.D
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	45	550.73	1099.46	550.74	1099.47	2	-14.45	10.4	71816	15	3	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 1
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	216	454.24	1359.69	454.24	1359.71	3	-13.36	14.5	7015	39	3	106 - 116	K.LLIQNQDEMIK.A	Oxidation: 9
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	4	558.73	1115.45	558.74	1115.47	2	-15.24	9.1	103868	32	5	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 1
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	1	558.73	1115.45	558.74	1115.47	2	-16.82	9	197051	51	5	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 2
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	50	469.88	1406.61	469.88	1406.62	3	-12.29	10.6	10377	43	3	314 - 325	R.MMMTSGEAVKYK.S	Oxidation: 2
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	299	670.35	1338.68	670.35	1338.69	2	-10.75	16.4	6492	81	3	228 - 238	R.QFDGLVDVYRK.T
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	61	736.38	735.37	736.39	735.38	1	-11.56	10.9	55190	37	3	120 - 125	R.LSEPYK.G
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	2	558.73	1115.45	558.74	1115.47	2	-16.34	9.1	24281	29	5	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 1
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	27	422.73	843.44	422.74	843.46	2	-16.27	9.8	97664	38	2	146 - 153	R.GNTANVIR.Y
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	212	680.85	1359.69	680.86	1359.71	2	-13.08	14.5	6240	60	3	106 - 116	K.LLIQNQDEMIK.A	Oxidation: 9
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	261	654.36	1306.71	654.37	1306.72	2	-13.52	15.5	28358	88	2	239 - 250	K.TLKTDGIAGLYR.G
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	9	712.31	1422.60	712.32	1422.62	2	-12.06	9.3	42386	23	2	314 - 325	R.MMMTSGEAVKYK.S	Oxidation: 1
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	83	550.74	1099.46	550.74	1099.47	2	-13.24	11.4	36369	67	4	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 2
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	283	447.23	1338.68	447.24	1338.69	3	-11.52	16.1	11353	51	5	228 - 238	R.QFDGLVDVYRK.T
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	370	470.24	1407.70	470.25	1407.71	3	-10.03	18.1	16677	66	3	134 - 145	R.TIKDEGFGSLWR.G
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	218	680.85	1359.69	680.86	1359.71	2	-13.58	14.6	6279	70	3	106 - 116	K.LLIQNQDEMIK.A	Oxidation: 9
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	167	529.77	1057.53	529.78	1057.54	2	-12.22	13.4	4152	71	2	324 - 332	K.YKSSLDAFK.Q
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	194	441.20	880.38	441.20	880.39	2	-10.21	14.1	9285	26	2	126 - 133	K.GIGDCFGR.T	Carbamidomethyl: 5
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	5	558.73	1115.45	558.74	1115.47	2	-13.72	9.2	38188	28	5	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 1
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	385	625.35	1248.69	625.36	1248.71	2	-12.86	18.4	13827	51	2	326 - 336	K.SSLDAFKQILK.N
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	274	533.59	1597.74	533.59	1597.76	3	-11.37	15.9	34048	42	3	120 - 133	R.LSEPYKGIGDCFGR.T	Carbamidomethyl: 11
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	177	548.96	1643.85	548.96	1643.87	3	-12.85	13.7	26579	41	2	106 - 119	K.LLIQNQDEMIKAGR.L	Oxidation: 9
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	298	447.23	1338.68	447.24	1338.69	3	-10.74	16.4	60111	57	5	228 - 238	R.QFDGLVDVYRK.T
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	8	475.21	1422.60	475.21	1422.62	3	-12.06	9.3	18437	59	3	314 - 325	R.MMMTSGEAVKYK.S	Oxidation: 1
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	213	454.24	1359.69	454.24	1359.71	3	-13.07	14.5	53205	45	3	106 - 116	K.LLIQNQDEMIK.A	Oxidation: 9
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	272	799.88	1597.74	799.89	1597.76	2	-8.98	15.8	17080	16	1	120 - 133	R.LSEPYKGIGDCFGR.T	Carbamidomethyl: 11
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	21	414.73	827.44	414.73	827.45	2	-12.12	9.6	433057	58	3	96 - 103	K.TAAAPIER.V
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	435	459.29	916.56	459.29	916.57	2	-17.57	19.6	13954	54	3	367 - 374	K.LQLIVFGK.K
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	438	917.57	916.56	917.58	916.57	1	-15.74	19.6	14369	30	2	367 - 374	K.LQLIVFGK.K
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	248	604.31	1206.61	604.32	1206.62	2	-12.76	15.3	26332	78	3	354 - 366	R.AVAGAGVLSGYDK.L
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	149	668.30	667.29	668.30	667.30	1	-12.81	13	5927	33	3	179 - 183	R.DGYWK.W
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	49	469.88	1406.61	469.88	1406.62	3	-12.29	10.6	15319	25	3	314 - 325	R.MMMTSGEAVKYK.S	Oxidation: 1
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	313	668.37	667.36	668.38	667.37	1	-9.01	16.7	18437	27	3	171 - 175	R.LFNFK.K
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	452	631.32	1260.62	631.33	1260.64	2	-12.27	20.1	6200	71	3	264 - 274	R.GLYFGLYDSVK.P
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	185	767.38	766.38	767.39	766.39	1	-13.60	13.9	4019	38	3	326 - 332	K.SSLDAFK.Q
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	310	668.37	667.36	668.38	667.37	1	-9.48	16.7	38188	21	3	171 - 175	R.LFNFK.K
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	110	771.44	770.43	771.45	770.44	1	-11.73	12.1	4983	26	3	346 - 353	K.GAGANILR.A
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	226	794.43	1586.85	794.44	1586.87	2	-13.07	14.7	21465	59	2	104 - 116	R.VKLLIQNQDEMIK.A	Oxidation: 11
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	5	558.73	1115.45	558.74	1115.47	2	-13.72	9.2	38188	33	5	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 2
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	179	767.38	766.38	767.39	766.39	1	-11.44	13.7	2387	49	3	326 - 332	K.SSLDAFK.Q
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	182	767.38	766.38	767.39	766.39	1	-12.36	13.8	9403	52	3	326 - 332	K.SSLDAFK.Q
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	386	417.24	1248.69	417.24	1248.71	3	-12.84	18.5	9486	35	2	326 - 336	K.SSLDAFKQILK.N
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	282	447.23	1338.68	447.24	1338.69	3	-13.38	16	52335	61	5	228 - 238	R.QFDGLVDVYRK.T
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	107	771.44	770.43	771.45	770.44	1	-12.16	12	17491	23	3	346 - 353	K.GAGANILR.A
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	6	475.21	1422.61	475.21	1422.62	3	-9.35	9.2	13605	51	3	314 - 325	R.MMMTSGEAVKYK.S	Oxidation: 1
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	48	550.74	1099.46	550.74	1099.47	2	-13.82	10.5	23167	18	3	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 1
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	242	604.31	1206.61	604.32	1206.62	2	-12.48	15.1	9329	78	3	354 - 366	R.AVAGAGVLSGYDK.L
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	39	469.88	1406.61	469.88	1406.62	3	-13.76	10.2	20630	25	3	314 - 325	R.MMMTSGEAVKYK.S	Oxidation: 1
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	4	558.73	1115.45	558.74	1115.47	2	-15.24	9.1	103868	50	5	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 1
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	526	702.73	2105.16	702.74	2105.19	3	-11.37	22.4	7446	49	3	354 - 374	R.AVAGAGVLSGYDKLQLIVFGK.K
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	289	672.86	1343.70	672.86	1343.71	2	-11.50	16.2	25169	67	2	106 - 116	K.LLIQNQDEMIK.A
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	358	606.30	1210.59	606.31	1210.60	2	-10.40	17.8	14613	63	3	228 - 237	R.QFDGLVDVYR.K
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	39	469.88	1406.61	469.88	1406.62	3	-13.76	10.2	20630	28	3	314 - 325	R.MMMTSGEAVKYK.S	Oxidation: 1
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	525	702.73	2105.16	702.74	2105.19	3	-12.98	22.3	11145	39	3	354 - 374	R.AVAGAGVLSGYDKLQLIVFGK.K
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	451	631.32	1260.62	631.33	1260.64	2	-12.74	20.1	4232	44	3	264 - 274	R.GLYFGLYDSVK.P
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	50	469.88	1406.61	469.88	1406.62	3	-12.29	10.6	10377	43	3	314 - 325	R.MMMTSGEAVKYK.S	Oxidation: 1
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	367	470.24	1407.70	470.25	1407.71	3	-10.65	18	4946	63	3	134 - 145	R.TIKDEGFGSLWR.G
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	49	469.88	1406.61	469.88	1406.62	3	-12.29	10.6	15319	25	3	314 - 325	R.MMMTSGEAVKYK.S	Oxidation: 2
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	442	533.75	1065.48	533.75	1065.49	2	-10.39	19.8	9922	45	1	137 - 145	K.DEGFGSLWR.G
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	2	558.73	1115.45	558.74	1115.47	2	-16.34	9.1	24281	32	5	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 2
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	533	667.33	1998.97	667.34	1998.99	3	-10.74	22.8	43236	59	1	154 - 169	R.YFPTQALNFAFKDYFK.R
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	260	483.25	964.48	483.26	964.50	2	-13.54	15.5	12933	55	3	242 - 250	K.TDGIAGLYR.G
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	13	566.73	1131.45	566.74	1131.46	2	-9.08	9.4	13710	41	2	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 1
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	18	414.73	827.44	414.73	827.45	2	-12.24	9.6	561594	57	3	96 - 103	K.TAAAPIER.V
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	549	1024.50	2046.99	1024.51	2047.01	2	-10.16	25	13525	54	2	76 - 95	K.GFTNFALDFLMGGVSAAVSK.T	Oxidation: 11
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	304	447.23	1338.68	447.24	1338.69	3	-10.81	16.5	23335	65	5	228 - 238	R.QFDGLVDVYRK.T
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	307	668.37	667.36	668.38	667.37	1	-13.86	16.6	24281	20	3	171 - 175	R.LFNFK.K
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	266	965.49	964.49	965.51	964.50	1	-11.75	15.7	16851	17	2	242 - 250	K.TDGIAGLYR.G
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	45	550.73	1099.46	550.74	1099.47	2	-14.45	10.4	71816	58	4	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 3
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	500	723.87	1445.72	723.87	1445.73	2	-11.09	21.6	11889	79	3	154 - 165	R.YFPTQALNFAFK.D
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	191	441.20	880.38	441.20	880.39	2	-11.16	14	13005	42	2	126 - 133	K.GIGDCFGR.T	Carbamidomethyl: 5
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	483	749.39	1496.76	749.40	1496.78	2	-13.17	21.2	42955	87	3	251 - 263	R.GFNISCVGIIVYR.G	Carbamidomethyl: 6
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	4	558.73	1115.45	558.74	1115.47	2	-15.24	9.1	103868	36	5	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 2
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	24	422.73	843.44	422.74	843.46	2	-13.62	9.7	31728	40	2	146 - 153	R.GNTANVIR.Y
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	224	529.96	1586.85	529.96	1586.87	3	-13.06	14.7	9635	43	2	104 - 116	R.VKLLIQNQDEMIK.A	Oxidation: 11
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	441	917.57	916.56	917.58	916.57	1	-13.77	19.7	4031	34	2	367 - 374	K.LQLIVFGK.K
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	83	550.74	1099.46	550.74	1099.47	2	-13.24	11.4	36369	41	3	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 1
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	368	704.86	1407.70	704.86	1407.71	2	-10.65	18.1	10844	75	3	134 - 145	R.TIKDEGFGSLWR.G
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	305	670.35	1338.68	670.35	1338.69	2	-10.83	16.5	5454	50	3	228 - 238	R.QFDGLVDVYRK.T
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	175	822.93	1643.85	822.94	1643.87	2	-12.31	13.6	24367	24	1	106 - 119	K.LLIQNQDEMIKAGR.L	Oxidation: 9
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	503	723.87	1445.72	723.87	1445.73	2	-10.57	21.6	6362	80	3	154 - 165	R.YFPTQALNFAFK.D
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	265	483.25	964.49	483.26	964.50	2	-11.72	15.7	11292	58	3	242 - 250	K.TDGIAGLYR.G
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	95	470.21	938.41	470.22	938.42	2	-10.68	11.7	6635	23	2	177 - 183	K.DRDGYWK.W
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	546	683.34	2046.99	683.34	2047.01	3	-8.52	24.9	125114	81	1	76 - 95	K.GFTNFALDFLMGGVSAAVSK.T	Oxidation: 11
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	271	533.59	1597.74	533.59	1597.76	3	-8.97	15.8	29386	58	3	120 - 133	R.LSEPYKGIGDCFGR.T	Carbamidomethyl: 11
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	5	558.73	1115.45	558.74	1115.47	2	-13.72	9.2	38188	47	5	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 1
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	364	470.24	1407.70	470.25	1407.71	3	-11.44	18	22080	63	3	134 - 145	R.TIKDEGFGSLWR.G
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	384	417.24	1248.69	417.24	1248.71	3	-14.44	18.4	293640	33	2	326 - 336	K.SSLDAFKQILK.N
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	449	631.32	1260.62	631.33	1260.64	2	-14.91	20	21469	55	3	264 - 274	R.GLYFGLYDSVK.P
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	227	529.96	1586.85	529.96	1586.87	3	-12.87	14.8	7681	44	2	104 - 116	R.VKLLIQNQDEMIK.A	Oxidation: 11
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	49	469.88	1406.61	469.88	1406.62	3	-12.29	10.6	15319	25	3	314 - 325	R.MMMTSGEAVKYK.S	Oxidation: 1
1403	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	383	625.35	1248.69	625.36	1248.71	2	-14.44	18.4	3097	62	2	326 - 336	K.SSLDAFKQILK.N
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	78	736.38	735.38	736.39	735.38	1	-6.77	10.9	7987	44	3	120 - 125	R.LSEPYK.G
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	553	723.87	1445.73	723.87	1445.73	2	-2.44	21.8	5631	61	4	154 - 165	R.YFPTQALNFAFK.D
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	302	533.59	1597.75	533.59	1597.76	3	-3.93	16	34927	40	2	120 - 133	R.LSEPYKGIGDCFGR.T	Carbamidomethyl: 11
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	4	558.74	1115.46	558.74	1115.47	2	-6.10	8.7	6288	46	9	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 2
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	338	668.37	667.37	668.38	667.37	1	-4.01	16.8	18631	23	2	171 - 175	R.LFNFK.K
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	62	550.74	1099.46	550.74	1099.47	2	-5.67	10.5	47844	17	3	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 2
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	76	736.38	735.37	736.39	735.38	1	-8.29	10.9	12324	45	3	120 - 125	R.LSEPYK.G
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	327	670.35	1338.69	670.35	1338.69	2	-3.34	16.5	7528	78	3	228 - 238	R.QFDGLVDVYRK.T
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	245	680.86	1359.70	680.86	1359.71	2	-2.29	14.7	6912	66	5	106 - 116	K.LLIQNQDEMIK.A	Oxidation: 9
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	620	683.34	2047.00	683.34	2047.01	3	-2.20	24.9	6403	93	2	76 - 95	K.GFTNFALDFLMGGVSAAVSK.T	Oxidation: 11
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	579	527.30	2105.18	527.30	2105.19	4	-2.80	22.4	9370	67	2	354 - 374	R.AVAGAGVLSGYDKLQLIVFGK.K
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	29	566.74	1131.46	566.74	1131.46	2	-4.76	9.6	8240	43	1	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 1
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	196	529.78	1057.54	529.78	1057.54	2	-3.87	13.5	14583	57	2	324 - 332	K.YKSSLDAFK.Q
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	179	668.30	667.29	668.30	667.30	1	-3.04	13.2	69529	29	3	179 - 183	R.DGYWK.W
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	2	558.74	1115.46	558.74	1115.47	2	-6.10	8.6	7904	39	9	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 2
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	125	470.22	938.42	470.22	938.42	2	-5.21	12	241882	19	3	177 - 183	K.DRDGYWK.W
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	160	542.74	1083.47	542.75	1083.48	2	-6.51	12.7	50717	35	1	314 - 323	R.MMMTSGEAVK.Y
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	242	680.86	1359.70	680.86	1359.71	2	-1.49	14.6	7770	70	5	106 - 116	K.LLIQNQDEMIK.A	Oxidation: 9
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	473	917.58	916.57	917.58	916.57	1	-5.37	19.8	17136	39	3	367 - 374	K.LQLIVFGK.K
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	13	558.74	1115.46	558.74	1115.47	2	-4.97	9.1	6526	29	9	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 2
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	406	606.31	1210.60	606.31	1210.60	2	-1.91	18.3	48946	66	5	228 - 237	R.QFDGLVDVYR.K
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	6	558.74	1115.46	558.74	1115.47	2	-6.05	8.8	9566	30	9	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 1
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	65	550.74	1099.46	550.74	1099.47	2	-6.21	10.5	43330	46	3	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 3
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	314	672.86	1343.71	672.86	1343.71	2	-5.01	16.2	9702	68	2	106 - 116	K.LLIQNQDEMIK.A
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	329	447.24	1338.69	447.24	1338.69	3	-3.63	16.6	8579	58	4	228 - 238	R.QFDGLVDVYRK.T
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	272	604.32	1206.62	604.32	1206.62	2	-3.43	15.3	73224	92	3	354 - 366	R.AVAGAGVLSGYDK.L
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	69	550.74	1099.46	550.74	1099.47	2	-7.06	10.6	28948	15	1	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 1
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	239	680.86	1359.70	680.86	1359.71	2	-2.02	14.5	5122	70	5	106 - 116	K.LLIQNQDEMIK.A	Oxidation: 9
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	594	667.33	1998.98	667.34	1998.99	3	-2.90	22.9	8963	15	2	154 - 169	R.YFPTQALNFAFKDYFK.R
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	209	767.39	766.38	767.39	766.39	1	-3.71	13.9	610856	52	2	326 - 332	K.SSLDAFK.Q
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	38	422.73	843.45	422.74	843.46	2	-5.34	9.8	11407	35	2	146 - 153	R.GNTANVIR.Y
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	396	470.24	1407.71	470.25	1407.71	3	-3.27	18.1	5513	63	3	134 - 145	R.TIKDEGFGSLWR.G
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	185	668.30	667.29	668.30	667.30	1	-5.35	13.3	92069	27	3	179 - 183	R.DGYWK.W
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	405	704.86	1407.71	704.86	1407.71	2	-2.48	18.3	11204	43	3	134 - 145	R.TIKDEGFGSLWR.G
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	266	681.35	1360.69	680.86	1359.71	2	719.28	15.1	12941	26	5	106 - 116	K.LLIQNQDEMIK.A	Oxidation: 9
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	484	631.32	1260.63	631.33	1260.64	2	-4.10	20.1	69529	60	3	264 - 274	R.GLYFGLYDSVK.P
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	17	558.74	1115.46	558.74	1115.47	2	-6.55	9.3	23169	47	9	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 1
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	62	550.74	1099.46	550.74	1099.47	2	-5.67	10.5	47844	36	3	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 3
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	466	917.58	916.57	917.58	916.57	1	-3.24	19.7	562565	67	3	367 - 374	K.LQLIVFGK.K
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	128	470.22	938.42	470.22	938.42	2	-4.49	12	75735	21	3	177 - 183	K.DRDGYWK.W
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	137	771.44	770.44	771.45	770.44	1	-3.93	12.2	80712	19	3	346 - 353	K.GAGANILR.A
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	65	550.74	1099.46	550.74	1099.47	2	-6.21	10.5	43330	25	3	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 2
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	243	454.24	1359.70	454.24	1359.71	3	-1.49	14.6	4200	48	3	106 - 116	K.LLIQNQDEMIK.A	Oxidation: 9
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	3	558.74	1115.46	558.74	1115.47	2	-6.89	8.7	6477	25	9	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 1
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	16	558.74	1115.46	558.74	1115.47	2	-7.48	9.2	6475	46	9	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 1
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	69	550.74	1099.46	550.74	1099.47	2	-7.06	10.6	28948	22	3	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 3
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	533	499.93	1496.78	499.93	1496.78	3	-3.51	21.3	29881	56	1	251 - 263	R.GFNISCVGIIVYR.G	Carbamidomethyl: 6
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	547	723.87	1445.73	723.87	1445.73	2	-3.97	21.6	7770	78	4	154 - 165	R.YFPTQALNFAFK.D
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	551	482.92	1445.73	482.92	1445.73	3	-2.57	21.7	3246	38	2	154 - 165	R.YFPTQALNFAFK.D
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	218	441.20	880.38	441.20	880.39	2	-2.19	14.1	30141	32	2	126 - 133	K.GIGDCFGR.T	Carbamidomethyl: 5
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	7	558.74	1115.46	558.74	1115.47	2	-6.92	8.8	5063	48	9	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 2
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	221	441.20	880.39	441.20	880.39	2	1.51	14.1	27634	22	2	126 - 133	K.GIGDCFGR.T	Carbamidomethyl: 5
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	122	470.22	938.42	470.22	938.42	2	-1.75	11.9	354763	20	3	177 - 183	K.DRDGYWK.W
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	7	558.74	1115.46	558.74	1115.47	2	-6.92	8.8	5063	31	9	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 1
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	256	529.96	1586.86	529.96	1586.87	3	-5.74	14.9	76915	31	1	104 - 116	R.VKLLIQNQDEMIK.A	Oxidation: 11
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	290	483.25	964.50	483.26	964.50	2	-2.43	15.7	6941	58	3	242 - 250	K.TDGIAGLYR.G
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	550	723.87	1445.73	723.87	1445.73	2	-2.59	21.7	6912	73	4	154 - 165	R.YFPTQALNFAFK.D
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	275	604.32	1206.62	604.32	1206.62	2	-2.59	15.3	20253	78	3	354 - 366	R.AVAGAGVLSGYDK.L
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	465	459.29	916.57	459.29	916.57	2	-3.25	19.7	50717	37	3	367 - 374	K.LQLIVFGK.K
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	334	670.35	1338.69	670.35	1338.69	2	-3.62	16.6	8240	19	3	228 - 238	R.QFDGLVDVYRK.T
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	16	558.74	1115.46	558.74	1115.47	2	-7.48	9.2	6475	31	9	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 2
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	621	1024.51	2047.00	1024.51	2047.01	2	-2.20	24.9	11486	109	2	76 - 95	K.GFTNFALDFLMGGVSAAVSK.T	Oxidation: 11
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	291	436.58	1306.72	436.58	1306.72	3	-4.12	15.7	7471	52	1	239 - 250	K.TLKTDGIAGLYR.G
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	292	965.50	964.50	965.51	964.50	1	-2.44	15.7	11306	24	2	242 - 250	K.TDGIAGLYR.G
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	326	447.24	1338.69	447.24	1338.69	3	-3.34	16.5	8806	52	4	228 - 238	R.QFDGLVDVYRK.T
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	31	414.73	827.45	414.73	827.45	2	-4.74	9.6	8141	57	3	96 - 103	K.TAAAPIER.V
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	2	558.74	1115.46	558.74	1115.47	2	-6.10	8.6	7904	39	9	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 1
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	332	447.24	1338.69	447.24	1338.69	3	-3.63	16.6	7732	60	4	228 - 238	R.QFDGLVDVYRK.T
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	483	631.32	1260.63	631.33	1260.64	2	-6.61	20.1	8084	31	3	264 - 274	R.GLYFGLYDSVK.P
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	400	470.24	1407.71	470.25	1407.71	3	-2.04	18.2	35013	63	3	134 - 145	R.TIKDEGFGSLWR.G
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	247	454.24	1359.70	454.24	1359.71	3	-2.28	14.7	8225	28	3	106 - 116	K.LLIQNQDEMIK.A	Oxidation: 9
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	13	558.74	1115.46	558.74	1115.47	2	-4.97	9.1	6526	25	6	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 1
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	136	771.44	770.44	771.45	770.44	1	-5.76	12.2	64249	19	3	346 - 353	K.GAGANILR.A
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	409	606.31	1210.60	606.31	1210.60	2	-1.28	18.4	37432	77	5	228 - 237	R.QFDGLVDVYR.K
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	17	558.74	1115.46	558.74	1115.47	2	-6.55	9.3	23169	30	9	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 2
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	81	736.38	735.38	736.39	735.38	1	-4.74	11	14221	40	3	120 - 125	R.LSEPYK.G
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	392	606.30	1210.59	606.31	1210.60	2	-5.75	18	7356	51	5	228 - 237	R.QFDGLVDVYR.K
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	2	558.74	1115.46	558.74	1115.47	2	-6.10	8.6	7904	24	6	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 1
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	6	558.74	1115.46	558.74	1115.47	2	-6.05	8.8	9566	21	6	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 1
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	33	828.45	827.45	828.46	827.45	1	-4.75	9.6	18631	23	1	96 - 103	K.TAAAPIER.V
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	397	470.24	1407.71	470.25	1407.71	3	-1.95	18.1	19802	63	3	134 - 145	R.TIKDEGFGSLWR.G
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	241	454.24	1359.70	454.24	1359.71	3	-2.02	14.6	6756	37	3	106 - 116	K.LLIQNQDEMIK.A	Oxidation: 9
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	549	482.92	1445.73	482.92	1445.73	3	-3.98	21.6	9448	51	2	154 - 165	R.YFPTQALNFAFK.D
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	37	414.73	827.45	414.73	827.45	2	-3.94	9.8	7398	52	3	96 - 103	K.TAAAPIER.V
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	577	702.73	2105.18	702.74	2105.19	3	-2.80	22.4	73224	58	3	354 - 374	R.AVAGAGVLSGYDKLQLIVFGK.K
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	6	558.74	1115.46	558.74	1115.47	2	-6.05	8.8	9566	46	9	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 2
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	389	606.30	1210.59	606.31	1210.60	2	-4.99	17.9	10451	64	5	228 - 237	R.QFDGLVDVYR.K
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	469	917.58	916.57	917.58	916.57	1	-3.32	19.7	73943	67	3	367 - 374	K.LQLIVFGK.K
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	404	606.30	1210.59	606.31	1210.60	2	-4.84	18.3	7229	64	5	228 - 237	R.QFDGLVDVYR.K
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	17	558.74	1115.46	558.74	1115.47	2	-6.55	9.3	23169	31	6	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 1
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	4	558.74	1115.46	558.74	1115.47	2	-6.10	8.7	6288	28	9	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 1
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	199	529.78	1057.54	529.78	1057.54	2	-3.80	13.6	5332	27	2	324 - 332	K.YKSSLDAFK.Q
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	16	558.74	1115.46	558.74	1115.47	2	-7.48	9.2	6475	28	6	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 1
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	13	558.74	1115.46	558.74	1115.47	2	-4.97	9.1	6526	40	9	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 1
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	341	668.37	667.37	668.38	667.37	1	-4.84	16.8	13069	24	2	171 - 175	R.LFNFK.K
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	294	965.50	964.49	965.51	964.50	1	-3.19	15.8	11243	26	2	242 - 250	K.TDGIAGLYR.G
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	486	631.32	1260.64	631.33	1260.64	2	-3.02	20.2	14140	46	3	264 - 274	R.GLYFGLYDSVK.P
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	576	702.73	2105.18	702.74	2105.19	3	-5.70	22.3	12782	54	3	354 - 374	R.AVAGAGVLSGYDKLQLIVFGK.K
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	69	550.74	1099.46	550.74	1099.47	2	-7.06	10.6	28948	15	3	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 2
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	502	533.75	1065.49	533.75	1065.49	2	0.78	20.5	32686	32	2	137 - 145	K.DEGFGSLWR.G
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	263	681.35	1360.69	680.86	1359.71	2	720.37	15.1	6232	29	5	106 - 116	K.LLIQNQDEMIK.A	Oxidation: 9
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	624	683.34	2047.00	683.34	2047.01	3	-2.99	25	11384	113	2	76 - 95	K.GFTNFALDFLMGGVSAAVSK.T	Oxidation: 11
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	34	414.73	827.45	414.73	827.45	2	-3.10	9.7	11893	58	3	96 - 103	K.TAAAPIER.V
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	407	1211.60	1210.60	1211.61	1210.60	1	-1.90	18.3	23444	30	1	228 - 237	R.QFDGLVDVYR.K
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	40	422.73	843.45	422.74	843.46	2	-5.46	9.8	8084	32	2	146 - 153	R.GNTANVIR.Y
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	296	483.25	964.49	483.26	964.50	2	-5.55	15.8	5647	63	3	242 - 250	K.TDGIAGLYR.G
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	317	672.86	1343.71	672.86	1343.71	2	-4.43	16.3	7857	67	2	106 - 116	K.LLIQNQDEMIK.A
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	401	704.86	1407.71	704.86	1407.71	2	-2.03	18.2	16750	83	3	134 - 145	R.TIKDEGFGSLWR.G
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	207	767.39	766.38	767.39	766.39	1	-4.15	13.8	101865	45	2	326 - 332	K.SSLDAFK.Q
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	300	533.59	1597.75	533.59	1597.76	3	-1.97	15.9	11571	48	2	120 - 133	R.LSEPYKGIGDCFGR.T	Carbamidomethyl: 11
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	312	447.24	1338.69	447.24	1338.69	3	-4.90	16.2	5063	57	4	228 - 238	R.QFDGLVDVYRK.T
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	278	604.32	1206.62	604.32	1206.62	2	-3.26	15.4	8301	78	3	354 - 366	R.AVAGAGVLSGYDK.L
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	295	654.37	1306.72	654.37	1306.72	2	-6.49	15.8	16617	60	1	239 - 250	K.TLKTDGIAGLYR.G
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	623	1024.51	2047.00	1024.51	2047.01	2	-2.99	25	6526	140	2	76 - 95	K.GFTNFALDFLMGGVSAAVSK.T	Oxidation: 11
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	3	558.74	1115.46	558.74	1115.47	2	-6.89	8.7	6477	42	9	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 2
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	532	749.40	1496.78	749.40	1496.78	2	-3.51	21.3	33830	78	1	251 - 263	R.GFNISCVGIIVYR.G	Carbamidomethyl: 6
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	5	558.74	1115.46	558.74	1115.47	2	-5.28	8.7	33743	29	9	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 1
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	140	771.44	770.44	771.45	770.44	1	-4.63	12.3	28256	21	3	346 - 353	K.GAGANILR.A
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	330	670.35	1338.69	670.35	1338.69	2	-3.62	16.6	7202	73	3	228 - 238	R.QFDGLVDVYRK.T
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	475	533.75	1065.49	533.75	1065.49	2	-0.29	19.9	61150	50	2	137 - 145	K.DEGFGSLWR.G
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	582	527.30	2105.18	527.30	2105.19	4	-1.77	22.5	9434	49	2	354 - 374	R.AVAGAGVLSGYDKLQLIVFGK.K
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	293	483.25	964.49	483.26	964.50	2	-3.19	15.7	6191	58	3	242 - 250	K.TDGIAGLYR.G
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	580	702.74	2105.18	702.74	2105.19	3	-1.78	22.4	20253	75	3	354 - 374	R.AVAGAGVLSGYDKLQLIVFGK.K
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	471	459.29	916.57	459.29	916.57	2	-5.36	19.8	10189	49	3	367 - 374	K.LQLIVFGK.K
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	468	459.29	916.57	459.29	916.57	2	-3.31	19.7	83514	54	3	367 - 374	K.LQLIVFGK.K
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	593	667.34	1998.99	667.34	1998.99	3	1.91	22.8	5595	50	2	154 - 169	R.YFPTQALNFAFKDYFK.R
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	5	558.74	1115.46	558.74	1115.47	2	-5.28	8.7	33743	45	9	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 2
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	182	668.30	667.29	668.30	667.30	1	-3.64	13.3	102932	27	3	179 - 183	R.DGYWK.W
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	398	704.86	1407.71	704.86	1407.71	2	-1.96	18.1	16198	83	3	134 - 145	R.TIKDEGFGSLWR.G
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	571	724.36	1446.71	723.87	1445.73	2	676.56	22.2	12941	45	4	154 - 165	R.YFPTQALNFAFK.D
1455	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	7	558.74	1115.46	558.74	1115.47	2	-6.92	8.8	5063	16	6	314 - 323	R.MMMTSGEAVK.Y	Oxidation: 1
1506	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	220	533.58	1597.73	533.59	1597.76	3	-17.09	15.9	6968	74	2	120 - 133	R.LSEPYKGIGDCFGR.T	Carbamidomethyl: 11
1506	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	170	680.85	1359.68	680.86	1359.71	2	-18.40	14.7	11618	70	3	106 - 116	K.LLIQNQDEMIK.A	Oxidation: 9
1506	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	141	767.38	766.37	767.39	766.39	1	-19.59	14	8614	45	3	326 - 332	K.SSLDAFK.Q
1506	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	65	470.21	938.41	470.22	938.42	2	-18.27	12	16941	26	2	177 - 183	K.DRDGYWK.W
1506	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	144	441.19	880.37	441.20	880.39	2	-17.10	14.1	5038	27	2	126 - 133	K.GIGDCFGR.T	Carbamidomethyl: 5
1506	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	104	668.30	667.29	668.30	667.30	1	-10.60	13.1	23919	15	2	179 - 183	R.DGYWK.W
1506	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	259	668.36	667.36	668.38	667.37	1	-18.65	17	21327	21	2	171 - 175	R.LFNFK.K
1506	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	171	454.23	1359.68	454.24	1359.71	3	-18.38	14.7	7058	38	3	106 - 116	K.LLIQNQDEMIK.A	Oxidation: 9
1506	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	311	723.86	1445.71	723.87	1445.73	2	-19.44	21.7	5492	49	5	154 - 165	R.YFPTQALNFAFK.D
1506	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	63	470.21	938.41	470.22	938.42	2	-18.91	11.9	8889	28	2	177 - 183	K.DRDGYWK.W
1506	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	137	767.38	766.37	767.39	766.39	1	-19.29	13.9	143661	36	3	326 - 332	K.SSLDAFK.Q
1506	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	313	723.86	1445.71	723.87	1445.73	2	-19.49	21.8	3484	41	5	154 - 165	R.YFPTQALNFAFK.D
1506	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	245	670.34	1338.67	670.35	1338.69	2	-18.27	16.6	3457	57	2	228 - 238	R.QFDGLVDVYRK.T
1506	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	105	668.29	667.29	668.30	667.30	1	-15.92	13.2	4252	30	2	179 - 183	R.DGYWK.W
1506	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	246	447.23	1338.67	447.24	1338.69	3	-18.10	16.7	6909	46	3	228 - 238	R.QFDGLVDVYRK.T
1506	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	310	723.86	1445.71	723.87	1445.73	2	-18.17	21.7	11546	62	5	154 - 165	R.YFPTQALNFAFK.D
1506	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	286	470.24	1407.69	470.25	1407.71	3	-19.58	18.2	5104	61	2	134 - 145	R.TIKDEGFGSLWR.G
1506	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	256	668.36	667.36	668.38	667.37	1	-18.21	16.9	13323	27	2	171 - 175	R.LFNFK.K
1506	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	1	414.72	827.43	414.73	827.45	2	-18.87	9.6	7744	38	1	96 - 103	K.TAAAPIER.V
1506	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	194	604.31	1206.60	604.32	1206.62	2	-19.33	15.3	9048	74	1	354 - 366	R.AVAGAGVLSGYDK.L
1506	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	303	459.29	916.56	459.29	916.57	2	-19.95	19.7	15781	42	1	367 - 374	K.LQLIVFGK.K
1506	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	312	723.86	1445.71	723.87	1445.73	2	-18.92	21.7	11318	58	5	154 - 165	R.YFPTQALNFAFK.D
1506	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	147	441.19	880.37	441.20	880.39	2	-14.40	14.1	21780	16	2	126 - 133	K.GIGDCFGR.T	Carbamidomethyl: 5
1506	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	213	483.25	964.48	483.26	964.50	2	-19.79	15.7	91436	60	2	242 - 250	K.TDGIAGLYR.G
1506	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	289	704.85	1407.69	704.86	1407.71	2	-19.75	18.3	5136	50	1	134 - 145	R.TIKDEGFGSLWR.G
1506	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	288	470.24	1407.69	470.25	1407.71	3	-19.73	18.3	9253	59	2	134 - 145	R.TIKDEGFGSLWR.G
1506	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	243	447.23	1338.67	447.24	1338.69	3	-18.25	16.6	23229	59	3	228 - 238	R.QFDGLVDVYRK.T
1506	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	78	771.43	770.42	771.45	770.44	1	-19.54	12.3	16914	20	1	346 - 353	K.GAGANILR.A
1506	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	169	454.24	1359.69	454.24	1359.71	3	-15.29	14.6	6174	48	3	106 - 116	K.LLIQNQDEMIK.A	Oxidation: 9
1506	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	37	736.37	735.37	736.39	735.38	1	-19.99	11.1	5094	44	1	120 - 125	R.LSEPYK.G
1506	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	212	965.49	964.48	965.51	964.50	1	-19.79	15.7	74967	30	1	242 - 250	K.TDGIAGLYR.G
1506	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	248	670.34	1338.67	670.35	1338.69	2	-18.10	16.7	7134	35	2	228 - 238	R.QFDGLVDVYRK.T
1506	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	174	454.23	1359.68	454.24	1359.71	3	-19.54	14.7	6574	28	3	106 - 116	K.LLIQNQDEMIK.A	Oxidation: 9
1506	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	135	767.38	766.37	767.39	766.39	1	-18.98	13.9	12636	39	3	326 - 332	K.SSLDAFK.Q
1506	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	314	723.86	1445.71	723.87	1445.73	2	-17.25	21.8	26988	57	5	154 - 165	R.YFPTQALNFAFK.D
1506	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	167	680.85	1359.69	680.86	1359.71	2	-15.30	14.6	3999	67	3	106 - 116	K.LLIQNQDEMIK.A	Oxidation: 9
1506	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	221	533.58	1597.73	533.59	1597.76	3	-16.66	15.9	7231	39	2	120 - 133	R.LSEPYKGIGDCFGR.T	Carbamidomethyl: 11
1506	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	210	483.25	964.48	483.26	964.50	2	-19.77	15.7	4466	55	2	242 - 250	K.TDGIAGLYR.G
1506	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	304	917.56	916.56	917.58	916.57	1	-19.97	19.7	4679	37	1	367 - 374	K.LQLIVFGK.K
1506	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	165	680.85	1359.69	680.86	1359.71	2	-10.25	14.5	4476	52	3	106 - 116	K.LLIQNQDEMIK.A	Oxidation: 9
1506	AT3G08580.1	AAC1 (ADP/ATP carrier 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	241	447.23	1338.67	447.24	1338.69	3	-19.19	16.5	5264	36	3	228 - 238	R.QFDGLVDVYRK.T
1172	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	320	523.35	1044.68	523.34	1044.67	2	5.88	17.8	6255	52	3	371 - 379	K.LQLIVFGKK.Y
1172	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	64	550.75	1099.48	550.74	1099.47	2	9.88	11.6	34321	58	4	318 - 327	R.MMMTSGEAVK.Y	Oxidation: 2
1172	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	200	529.97	1586.89	529.96	1586.87	3	9.79	15	49801	49	2	108 - 120	R.VKLLIQNQDEMLK.A	Oxidation: 11
1172	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	201	794.45	1586.89	794.44	1586.87	2	9.80	15	49471	45	2	108 - 120	R.VKLLIQNQDEMLK.A	Oxidation: 11
1172	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	260	524.63	1570.88	524.63	1570.88	3	4.05	16.3	119243	32	1	108 - 120	R.VKLLIQNQDEMLK.A
1172	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	63	550.75	1099.48	550.74	1099.47	2	5.97	11.6	18795	37	4	318 - 327	R.MMMTSGEAVK.Y	Oxidation: 3
1172	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	187	454.25	1359.72	454.24	1359.71	3	12.49	14.7	19175	48	3	110 - 120	K.LLIQNQDEMLK.A	Oxidation: 9
1172	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	192	454.25	1359.72	454.24	1359.71	3	12.44	14.8	7315	39	3	110 - 120	K.LLIQNQDEMLK.A	Oxidation: 9
1172	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	14	828.47	827.46	828.46	827.45	1	9.56	9.9	6451	16	2	100 - 107	K.TAAAPIER.V
1172	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	190	454.25	1359.72	454.24	1359.71	3	12.82	14.7	38605	37	3	110 - 120	K.LLIQNQDEMLK.A	Oxidation: 9
1172	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	3	558.74	1115.47	558.74	1115.47	2	6.86	9.5	149452	16	3	318 - 327	R.MMMTSGEAVK.Y	Oxidation: 1
1172	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	8	558.74	1115.47	558.74	1115.47	2	6.16	9.7	5695	23	4	318 - 327	R.MMMTSGEAVK.Y	Oxidation: 2
1172	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	286	668.38	667.37	668.38	667.37	1	7.21	17	8071	27	2	175 - 179	R.LFNFK.K
1172	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	204	794.45	1586.89	794.44	1586.87	2	9.84	15.1	13467	29	2	108 - 120	R.VKLLIQNQDEMLK.A	Oxidation: 11
1172	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	289	668.38	667.37	668.38	667.37	1	8.30	17	11487	17	2	175 - 179	R.LFNFK.K
1172	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	108	542.75	1083.49	542.75	1083.48	2	12.32	12.9	34566	19	2	318 - 327	R.MMMTSGEAVK.Y
1172	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	64	550.75	1099.48	550.74	1099.47	2	9.88	11.6	34321	40	4	318 - 327	R.MMMTSGEAVK.Y	Oxidation: 1
1172	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	66	550.75	1099.48	550.74	1099.47	2	8.48	11.7	3943	21	4	318 - 327	R.MMMTSGEAVK.Y	Oxidation: 1
1172	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	448	667.34	1999.00	667.34	1998.99	3	5.84	23.1	5094	55	1	158 - 173	R.YFPTQALNFAFKDYFK.R
1172	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	148	548.97	1643.88	548.96	1643.87	3	9.74	13.8	17629	33	1	110 - 123	K.LLIQNQDEMLKAGR.L	Oxidation: 9
1172	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	216	681.36	1360.71	680.86	1359.71	2	735.91	15.3	5537	20	6	110 - 120	K.LLIQNQDEMLK.A	Oxidation: 9
1172	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	22	422.74	843.46	422.74	843.46	2	6.89	10	6944	23	5	150 - 157	R.GNTANVIR.Y
1172	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	31	423.23	844.44	422.74	843.46	2	1168.46	10.5	12430	23	5	150 - 157	R.GNTANVIR.Y
1172	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	387	917.59	916.58	917.58	916.57	1	6.11	19.9	6392	39	3	371 - 378	K.LQLIVFGK.K
1172	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	160	796.48	795.47	796.47	795.46	1	7.19	14.1	81505	24	1	175 - 180	R.LFNFKK.D
1172	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	8	558.74	1115.47	558.74	1115.47	2	6.16	9.7	5695	36	3	318 - 327	R.MMMTSGEAVK.Y	Oxidation: 1
1172	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	261	672.87	1343.73	672.86	1343.71	2	10.24	16.4	33321	69	3	110 - 120	K.LLIQNQDEMLK.A
1172	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	13	414.74	827.46	414.73	827.45	2	9.54	9.8	18063	55	3	100 - 107	K.TAAAPIER.V
1172	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	20	422.74	843.46	422.74	843.46	2	5.80	10	11813	43	5	150 - 157	R.GNTANVIR.Y
1172	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	7	475.22	1422.63	475.21	1422.62	3	9.76	9.7	41635	33	1	318 - 329	R.MMMTSGEAVKYK.S	Oxidation: 1
1172	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	65	550.75	1099.48	550.74	1099.47	2	7.44	11.7	4602	67	4	318 - 327	R.MMMTSGEAVK.Y	Oxidation: 2
1172	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	1	558.74	1115.47	558.74	1115.47	2	6.82	9.4	7615	23	4	318 - 327	R.MMMTSGEAVK.Y	Oxidation: 2
1172	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	84	771.45	770.45	771.45	770.44	1	10.07	12.4	8004	25	3	350 - 357	K.GAGANILR.A
1172	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	65	550.75	1099.48	550.74	1099.47	2	7.44	11.7	4602	44	4	318 - 327	R.MMMTSGEAVK.Y	Oxidation: 1
1172	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	32	423.23	844.45	422.74	843.46	2	1171.16	10.5	6392	37	5	150 - 157	R.GNTANVIR.Y
1172	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	2	558.75	1115.48	558.74	1115.47	2	10.35	9.4	165287	31	3	318 - 327	R.MMMTSGEAVK.Y	Oxidation: 1
1172	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	10	414.74	827.46	414.73	827.45	2	8.38	9.8	109988	57	3	100 - 107	K.TAAAPIER.V
1172	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	63	550.75	1099.48	550.74	1099.47	2	5.97	11.6	18795	38	4	318 - 327	R.MMMTSGEAVK.Y	Oxidation: 1
1172	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	9	414.74	827.46	414.73	827.45	2	7.80	9.7	4437	62	3	100 - 107	K.TAAAPIER.V
1172	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	185	680.87	1359.72	680.86	1359.71	2	12.50	14.7	87078	67	6	110 - 120	K.LLIQNQDEMLK.A	Oxidation: 9
1172	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	183	680.87	1359.72	680.86	1359.71	2	10.95	14.6	31254	62	6	110 - 120	K.LLIQNQDEMLK.A	Oxidation: 9
1172	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	3	558.74	1115.47	558.74	1115.47	2	6.86	9.5	149452	34	4	318 - 327	R.MMMTSGEAVK.Y	Oxidation: 2
1172	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	2	558.75	1115.48	558.74	1115.47	2	10.35	9.4	165287	49	4	318 - 327	R.MMMTSGEAVK.Y	Oxidation: 1
1172	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	233	596.32	1190.63	596.32	1190.63	2	4.22	15.7	16023	60	1	358 - 370	R.AVAGAGVLAGYDK.L
1172	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	258	672.87	1343.73	672.86	1343.71	2	10.86	16.3	55394	64	3	110 - 120	K.LLIQNQDEMLK.A
1172	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	66	550.75	1099.48	550.74	1099.47	2	8.48	11.7	3943	19	4	318 - 327	R.MMMTSGEAVK.Y	Oxidation: 3
1172	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	392	917.59	916.58	917.58	916.57	1	7.56	20	15968	43	3	371 - 378	K.LQLIVFGK.K
1172	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	3	558.74	1115.47	558.74	1115.47	2	6.86	9.5	149452	34	4	318 - 327	R.MMMTSGEAVK.Y	Oxidation: 1
1172	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	391	459.30	916.58	459.29	916.57	2	7.55	20	47512	38	3	371 - 378	K.LQLIVFGK.K
1172	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	315	523.34	1044.67	523.34	1044.67	2	5.02	17.7	11986	57	3	371 - 379	K.LQLIVFGKK.Y
1172	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	106	542.75	1083.49	542.75	1083.48	2	8.86	12.9	26578	29	2	318 - 327	R.MMMTSGEAVK.Y
1172	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	389	917.59	916.58	917.58	916.57	1	7.21	19.9	60242	57	3	371 - 378	K.LQLIVFGK.K
1172	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	8	558.74	1115.47	558.74	1115.47	2	6.16	9.7	5695	23	4	318 - 327	R.MMMTSGEAVK.Y	Oxidation: 1
1172	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	2	558.75	1115.48	558.74	1115.47	2	10.35	9.4	165287	35	4	318 - 327	R.MMMTSGEAVK.Y	Oxidation: 2
1172	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	203	529.97	1586.89	529.96	1586.87	3	9.83	15.1	47438	45	2	108 - 120	R.VKLLIQNQDEMLK.A	Oxidation: 11
1172	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	63	550.75	1099.48	550.74	1099.47	2	5.97	11.6	18795	54	4	318 - 327	R.MMMTSGEAVK.Y	Oxidation: 2
1172	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	64	550.75	1099.48	550.74	1099.47	2	9.88	11.6	34321	38	4	318 - 327	R.MMMTSGEAVK.Y	Oxidation: 3
1172	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	1	558.74	1115.47	558.74	1115.47	2	6.82	9.4	7615	23	4	318 - 327	R.MMMTSGEAVK.Y	Oxidation: 1
1172	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	65	550.75	1099.48	550.74	1099.47	2	7.44	11.7	4602	46	4	318 - 327	R.MMMTSGEAVK.Y	Oxidation: 3
1172	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	11	828.46	827.46	828.46	827.45	1	8.40	9.8	12506	21	2	100 - 107	K.TAAAPIER.V
1172	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	263	416.25	1245.73	416.25	1245.72	3	4.63	16.4	71837	40	1	346 - 357	K.SLFKGAGANILR.A
1172	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	212	681.36	1360.71	680.86	1359.71	2	736.31	15.3	32776	22	6	110 - 120	K.LLIQNQDEMLK.A	Oxidation: 9
1172	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	318	523.34	1044.67	523.34	1044.67	2	4.66	17.8	3750	61	3	371 - 379	K.LQLIVFGKK.Y
1172	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	386	459.30	916.58	459.29	916.57	2	6.09	19.9	12430	54	3	371 - 378	K.LQLIVFGK.K
1172	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	388	459.30	916.58	459.29	916.57	2	7.20	19.9	509461	54	3	371 - 378	K.LQLIVFGK.K
1172	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	436	724.37	1446.73	723.87	1445.73	2	688.98	22.4	5998	18	4	158 - 169	R.YFPTQALNFAFK.D
1172	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	262	623.87	1245.73	623.87	1245.72	2	4.64	16.4	13178	21	1	346 - 357	K.SLFKGAGANILR.A
1172	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	33	423.23	844.45	422.74	843.46	2	1173.38	10.6	509461	26	5	150 - 157	R.GNTANVIR.Y
1172	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	66	550.75	1099.48	550.74	1099.47	2	8.48	11.7	3943	33	4	318 - 327	R.MMMTSGEAVK.Y	Oxidation: 2
1172	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	421	723.88	1445.75	723.87	1445.73	2	8.59	21.8	3943	67	4	158 - 169	R.YFPTQALNFAFK.D
1172	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	423	723.88	1445.75	723.87	1445.73	2	9.19	21.9	9255	69	4	158 - 169	R.YFPTQALNFAFK.D
1172	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	78	771.46	770.45	771.45	770.44	1	10.41	12.3	14667	25	3	350 - 357	K.GAGANILR.A
1172	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	188	680.87	1359.72	680.86	1359.71	2	12.84	14.7	14011	71	6	110 - 120	K.LLIQNQDEMLK.A	Oxidation: 9
1172	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	81	771.46	770.45	771.45	770.44	1	11.43	12.3	5998	25	3	350 - 357	K.GAGANILR.A
1172	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	426	723.88	1445.75	723.87	1445.73	2	8.52	21.9	9533	49	4	158 - 169	R.YFPTQALNFAFK.D
1172	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	113	750.41	749.40	750.40	749.40	1	7.81	13.1	96459	18	3	124 - 129	R.LTEPYK.G
1172	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	264	672.87	1343.73	672.86	1343.71	2	10.82	16.4	47706	70	3	110 - 120	K.LLIQNQDEMLK.A
1172	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	109	750.41	749.40	750.40	749.40	1	9.43	12.9	16034	22	3	124 - 129	R.LTEPYK.G
1172	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	210	681.36	1360.71	680.86	1359.71	2	735.32	15.2	46100	33	6	110 - 120	K.LLIQNQDEMLK.A	Oxidation: 9
1172	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	111	750.41	749.40	750.40	749.40	1	7.65	13	17529	25	3	124 - 129	R.LTEPYK.G
1403	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	1	558.73	1115.45	558.74	1115.47	2	-16.82	9	197051	29	5	318 - 327	R.MMMTSGEAVK.Y	Oxidation: 1
1403	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	39	469.88	1406.61	469.88	1406.62	3	-13.76	10.2	20630	28	3	318 - 329	R.MMMTSGEAVKYK.S	Oxidation: 1
1403	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	46	550.74	1099.46	550.74	1099.47	2	-14.13	10.4	8653	49	4	318 - 327	R.MMMTSGEAVK.Y	Oxidation: 3
1403	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	5	558.73	1115.45	558.74	1115.47	2	-13.72	9.2	38188	28	5	318 - 327	R.MMMTSGEAVK.Y	Oxidation: 1
1403	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	2	558.73	1115.45	558.74	1115.47	2	-16.34	9.1	24281	47	5	318 - 327	R.MMMTSGEAVK.Y	Oxidation: 1
1403	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	441	917.57	916.56	917.58	916.57	1	-13.77	19.7	4031	34	2	371 - 378	K.LQLIVFGK.K
1403	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	10	712.31	1422.60	712.32	1422.62	2	-11.85	9.4	13146	19	2	318 - 329	R.MMMTSGEAVKYK.S	Oxidation: 1
1403	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	134	542.74	1083.46	542.75	1083.48	2	-15.80	12.7	7544	37	2	318 - 327	R.MMMTSGEAVK.Y
1403	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	226	794.43	1586.85	794.44	1586.87	2	-13.07	14.7	21465	59	2	108 - 120	R.VKLLIQNQDEMLK.A	Oxidation: 11
1403	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	286	672.85	1343.70	672.86	1343.71	2	-12.54	16.1	47618	75	2	110 - 120	K.LLIQNQDEMLK.A
1403	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	505	482.91	1445.72	482.92	1445.73	3	-10.57	21.7	4992	39	2	158 - 169	R.YFPTQALNFAFK.D
1403	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	215	680.85	1359.69	680.86	1359.71	2	-13.36	14.5	11204	70	3	110 - 120	K.LLIQNQDEMLK.A	Oxidation: 9
1403	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	449	631.32	1260.62	631.33	1260.64	2	-14.91	20	21469	55	3	268 - 278	R.GLYFGLYDSVK.P
1403	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	14	566.73	1131.45	566.74	1131.46	2	-9.56	9.5	4900	32	2	318 - 327	R.MMMTSGEAVK.Y	Oxidation: 1
1403	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	3	558.73	1115.45	558.74	1115.47	2	-16.30	9.1	16720	47	5	318 - 327	R.MMMTSGEAVK.Y	Oxidation: 1
1403	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	438	917.57	916.56	917.58	916.57	1	-15.74	19.6	14369	30	2	371 - 378	K.LQLIVFGK.K
1403	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	83	550.74	1099.46	550.74	1099.47	2	-13.24	11.4	36369	67	4	318 - 327	R.MMMTSGEAVK.Y	Oxidation: 2
1403	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	13	566.73	1131.45	566.74	1131.46	2	-9.08	9.4	13710	41	2	318 - 327	R.MMMTSGEAVK.Y	Oxidation: 1
1403	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	349	468.25	1401.72	468.25	1401.74	3	-11.69	17.6	7301	33	1	138 - 149	R.TIRDEGIGSLWR.G
1403	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	9	712.31	1422.60	712.32	1422.62	2	-12.06	9.3	42386	23	2	318 - 329	R.MMMTSGEAVKYK.S	Oxidation: 1
1403	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	5	558.73	1115.45	558.74	1115.47	2	-13.72	9.2	38188	33	5	318 - 327	R.MMMTSGEAVK.Y	Oxidation: 2
1403	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	4	558.73	1115.45	558.74	1115.47	2	-15.24	9.1	103868	32	5	318 - 327	R.MMMTSGEAVK.Y	Oxidation: 1
1403	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	45	550.73	1099.46	550.74	1099.47	2	-14.45	10.4	71816	15	3	318 - 327	R.MMMTSGEAVK.Y	Oxidation: 1
1403	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	27	422.73	843.44	422.74	843.46	2	-16.27	9.8	97664	38	2	150 - 157	R.GNTANVIR.Y
1403	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	4	558.73	1115.45	558.74	1115.47	2	-15.24	9.1	103868	50	5	318 - 327	R.MMMTSGEAVK.Y	Oxidation: 1
1403	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	1	558.73	1115.45	558.74	1115.47	2	-16.82	9	197051	51	5	318 - 327	R.MMMTSGEAVK.Y	Oxidation: 1
1403	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	310	668.37	667.36	668.38	667.37	1	-9.48	16.7	38188	21	3	175 - 179	R.LFNFK.K
1403	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	6	475.21	1422.61	475.21	1422.62	3	-9.35	9.2	13605	51	3	318 - 329	R.MMMTSGEAVKYK.S	Oxidation: 1
1403	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	8	475.21	1422.60	475.21	1422.62	3	-12.06	9.3	18437	59	3	318 - 329	R.MMMTSGEAVKYK.S	Oxidation: 1
1403	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	15	414.73	827.44	414.73	827.45	2	-12.19	9.5	102787	53	3	100 - 107	K.TAAAPIER.V
1403	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	48	550.74	1099.46	550.74	1099.47	2	-13.82	10.5	23167	62	4	318 - 327	R.MMMTSGEAVK.Y	Oxidation: 3
1403	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	18	414.73	827.44	414.73	827.45	2	-12.24	9.6	561594	57	3	100 - 107	K.TAAAPIER.V
1403	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	228	794.43	1586.85	794.44	1586.87	2	-12.88	14.8	43236	54	2	108 - 120	R.VKLLIQNQDEMLK.A	Oxidation: 11
1403	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	3	558.73	1115.45	558.74	1115.47	2	-16.30	9.1	16720	29	5	318 - 327	R.MMMTSGEAVK.Y	Oxidation: 1
1403	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	224	529.96	1586.85	529.96	1586.87	3	-13.06	14.7	9635	43	2	108 - 120	R.VKLLIQNQDEMLK.A	Oxidation: 11
1403	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	220	454.24	1359.69	454.24	1359.71	3	-13.58	14.6	11145	34	3	110 - 120	K.LLIQNQDEMLK.A	Oxidation: 9
1403	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	452	631.32	1260.62	631.33	1260.64	2	-12.27	20.1	6200	71	3	268 - 278	R.GLYFGLYDSVK.P
1403	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	439	459.29	916.56	459.29	916.57	2	-13.76	19.7	7544	54	3	371 - 378	K.LQLIVFGK.K
1403	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	177	548.96	1643.85	548.96	1643.87	3	-12.85	13.7	26579	41	2	110 - 123	K.LLIQNQDEMLKAGR.L	Oxidation: 9
1403	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	50	469.88	1406.61	469.88	1406.62	3	-12.29	10.6	10377	54	3	318 - 329	R.MMMTSGEAVKYK.S	Oxidation: 1
1403	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	107	771.44	770.43	771.45	770.44	1	-12.16	12	17491	23	3	350 - 357	K.GAGANILR.A
1403	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	436	459.29	916.56	459.29	916.57	2	-15.72	19.6	10159	37	3	371 - 378	K.LQLIVFGK.K
1403	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	45	550.73	1099.46	550.74	1099.47	2	-14.45	10.4	71816	31	4	318 - 327	R.MMMTSGEAVK.Y	Oxidation: 2
1403	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	149	668.30	667.29	668.30	667.30	1	-12.81	13	5927	33	3	183 - 187	K.DGYWK.W
1403	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	500	723.87	1445.72	723.87	1445.73	2	-11.09	21.6	11889	79	3	158 - 169	R.YFPTQALNFAFK.D
1403	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	5	558.73	1115.45	558.74	1115.47	2	-13.72	9.2	38188	47	5	318 - 327	R.MMMTSGEAVK.Y	Oxidation: 1
1403	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	498	723.87	1445.72	723.87	1445.73	2	-11.57	21.5	13521	67	3	158 - 169	R.YFPTQALNFAFK.D
1403	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	313	668.37	667.36	668.38	667.37	1	-9.01	16.7	18437	27	3	175 - 179	R.LFNFK.K
1403	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	307	668.37	667.36	668.38	667.37	1	-13.86	16.6	24281	20	3	175 - 179	R.LFNFK.K
1403	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	21	414.73	827.44	414.73	827.45	2	-12.12	9.6	433057	58	3	100 - 107	K.TAAAPIER.V
1403	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	50	469.88	1406.61	469.88	1406.62	3	-12.29	10.6	10377	43	3	318 - 329	R.MMMTSGEAVKYK.S	Oxidation: 2
1403	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	46	550.74	1099.46	550.74	1099.47	2	-14.13	10.4	8653	27	4	318 - 327	R.MMMTSGEAVK.Y	Oxidation: 2
1403	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	39	469.88	1406.61	469.88	1406.62	3	-13.76	10.2	20630	36	3	318 - 329	R.MMMTSGEAVKYK.S	Oxidation: 2
1403	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	110	771.44	770.43	771.45	770.44	1	-11.73	12.1	4983	26	3	350 - 357	K.GAGANILR.A
1403	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	152	668.30	667.29	668.30	667.30	1	-11.51	13.1	4505	33	3	183 - 187	K.DGYWK.W
1403	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	4	558.73	1115.45	558.74	1115.47	2	-15.24	9.1	103868	36	5	318 - 327	R.MMMTSGEAVK.Y	Oxidation: 2
1403	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	218	680.85	1359.69	680.86	1359.71	2	-13.58	14.6	6279	70	3	110 - 120	K.LLIQNQDEMLK.A	Oxidation: 9
1403	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	49	469.88	1406.61	469.88	1406.62	3	-12.29	10.6	15319	25	3	318 - 329	R.MMMTSGEAVKYK.S	Oxidation: 1
1403	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	503	723.87	1445.72	723.87	1445.73	2	-10.57	21.6	6362	80	3	158 - 169	R.YFPTQALNFAFK.D
1403	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	147	668.30	667.29	668.30	667.30	1	-10.19	13	6200	29	3	183 - 187	K.DGYWK.W
1403	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	227	529.96	1586.85	529.96	1586.87	3	-12.87	14.8	7681	44	2	108 - 120	R.VKLLIQNQDEMLK.A	Oxidation: 11
1403	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	289	672.86	1343.70	672.86	1343.71	2	-11.50	16.2	25169	67	2	110 - 120	K.LLIQNQDEMLK.A
1403	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	216	454.24	1359.69	454.24	1359.71	3	-13.36	14.5	7015	39	3	110 - 120	K.LLIQNQDEMLK.A	Oxidation: 9
1403	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	49	469.88	1406.61	469.88	1406.62	3	-12.29	10.6	15319	25	3	318 - 329	R.MMMTSGEAVKYK.S	Oxidation: 1
1403	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	212	680.85	1359.69	680.86	1359.71	2	-13.08	14.5	6240	60	3	110 - 120	K.LLIQNQDEMLK.A	Oxidation: 9
1403	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	2	558.73	1115.45	558.74	1115.47	2	-16.34	9.1	24281	32	5	318 - 327	R.MMMTSGEAVK.Y	Oxidation: 2
1403	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	7	475.21	1422.60	475.21	1422.62	3	-10.99	9.3	56518	57	3	318 - 329	R.MMMTSGEAVKYK.S	Oxidation: 1
1403	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	45	550.73	1099.46	550.74	1099.47	2	-14.45	10.4	71816	58	4	318 - 327	R.MMMTSGEAVK.Y	Oxidation: 3
1403	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	83	550.74	1099.46	550.74	1099.47	2	-13.24	11.4	36369	41	3	318 - 327	R.MMMTSGEAVK.Y	Oxidation: 1
1403	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	173	548.96	1643.85	548.96	1643.87	3	-12.30	13.6	30542	52	2	110 - 123	K.LLIQNQDEMLKAGR.L	Oxidation: 9
1403	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	451	631.32	1260.62	631.33	1260.64	2	-12.74	20.1	4232	44	3	268 - 278	R.GLYFGLYDSVK.P
1403	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	133	542.74	1083.46	542.75	1083.48	2	-16.79	12.6	14369	61	2	318 - 327	R.MMMTSGEAVK.Y
1403	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	113	771.44	770.43	771.45	770.44	1	-11.89	12.2	8162	21	3	350 - 357	K.GAGANILR.A
1403	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	533	667.33	1998.97	667.34	1998.99	3	-10.74	22.8	43236	59	1	158 - 173	R.YFPTQALNFAFKDYFK.R
1403	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	50	469.88	1406.61	469.88	1406.62	3	-12.29	10.6	10377	43	3	318 - 329	R.MMMTSGEAVKYK.S	Oxidation: 1
1403	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	3	558.73	1115.45	558.74	1115.47	2	-16.30	9.1	16720	33	5	318 - 327	R.MMMTSGEAVK.Y	Oxidation: 2
1403	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	39	469.88	1406.61	469.88	1406.62	3	-13.76	10.2	20630	25	3	318 - 329	R.MMMTSGEAVKYK.S	Oxidation: 1
1403	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	48	550.74	1099.46	550.74	1099.47	2	-13.82	10.5	23167	18	3	318 - 327	R.MMMTSGEAVK.Y	Oxidation: 1
1403	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	435	459.29	916.56	459.29	916.57	2	-17.57	19.6	13954	54	3	371 - 378	K.LQLIVFGK.K
1403	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	1	558.73	1115.45	558.74	1115.47	2	-16.82	9	197051	51	5	318 - 327	R.MMMTSGEAVK.Y	Oxidation: 2
1403	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	175	822.93	1643.85	822.94	1643.87	2	-12.31	13.6	24367	24	1	110 - 123	K.LLIQNQDEMLKAGR.L	Oxidation: 9
1403	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	258	476.25	950.48	476.25	950.48	2	-6.86	15.5	103061	49	1	246 - 254	K.SDGIAGLYR.G
1403	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	502	482.91	1445.72	482.92	1445.73	3	-11.08	21.6	5457	56	2	158 - 169	R.YFPTQALNFAFK.D
1403	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	2	558.73	1115.45	558.74	1115.47	2	-16.34	9.1	24281	29	5	318 - 327	R.MMMTSGEAVK.Y	Oxidation: 1
1403	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	83	550.74	1099.46	550.74	1099.47	2	-13.24	11.4	36369	46	4	318 - 327	R.MMMTSGEAVK.Y	Oxidation: 3
1403	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	24	422.73	843.44	422.74	843.46	2	-13.62	9.7	31728	40	2	150 - 157	R.GNTANVIR.Y
1403	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	49	469.88	1406.61	469.88	1406.62	3	-12.29	10.6	15319	25	3	318 - 329	R.MMMTSGEAVKYK.S	Oxidation: 2
1403	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	213	454.24	1359.69	454.24	1359.71	3	-13.07	14.5	53205	45	3	110 - 120	K.LLIQNQDEMLK.A	Oxidation: 9
1403	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	48	550.74	1099.46	550.74	1099.47	2	-13.82	10.5	23167	36	4	318 - 327	R.MMMTSGEAVK.Y	Oxidation: 2
1454	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	7	558.74	1115.46	558.74	1115.47	2	-4.24	8.7	12827	28	4	318 - 327	R.MMMTSGEAVK.Y	Oxidation: 2
1454	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	257	454.24	1359.70	454.24	1359.71	3	-3.56	14.6	44428	37	3	110 - 120	K.LLIQNQDEMLK.A	Oxidation: 9
1454	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	254	454.25	1359.71	454.24	1359.71	3	4.87	14.5	28855	44	3	110 - 120	K.LLIQNQDEMLK.A	Oxidation: 9
1454	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	116	550.74	1099.47	550.74	1099.47	2	-4.96	11.4	81607	22	1	318 - 327	R.MMMTSGEAVK.Y	Oxidation: 1
1454	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	253	680.86	1359.71	680.86	1359.71	2	4.87	14.5	99465	59	4	110 - 120	K.LLIQNQDEMLK.A	Oxidation: 9
1454	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	296	476.25	950.48	476.25	950.48	2	0.61	15.5	34195	31	2	246 - 254	K.SDGIAGLYR.G
1454	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	484	917.58	916.57	917.58	916.57	1	-6.92	19.7	29448	57	2	371 - 378	K.LQLIVFGK.K
1454	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	43	422.73	843.45	422.74	843.46	2	-5.46	9.8	32105	33	3	150 - 157	R.GNTANVIR.Y
1454	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	458	614.81	1227.61	614.81	1227.61	2	-5.06	19.1	28601	23	1	330 - 340	K.SSFDAFSQIVK.K
1454	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	190	668.30	667.29	668.30	667.30	1	-3.30	13.1	29642	34	2	183 - 187	K.DGYWK.W
1454	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	9	558.74	1115.46	558.74	1115.47	2	-4.20	8.7	7800	32	4	318 - 327	R.MMMTSGEAVK.Y	Oxidation: 1
1454	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	278	681.35	1360.69	680.86	1359.71	2	719.80	15.1	10140	19	4	110 - 120	K.LLIQNQDEMLK.A	Oxidation: 9
1454	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	35	414.73	827.44	414.73	827.45	2	-6.55	9.6	196214	62	3	100 - 107	K.TAAAPIER.V
1454	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	9	558.74	1115.46	558.74	1115.47	2	-4.20	8.7	7800	48	4	318 - 327	R.MMMTSGEAVK.Y	Oxidation: 2
1454	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	148	771.45	770.44	771.45	770.44	1	-1.75	12.2	45999	23	1	350 - 357	K.GAGANILR.A
1454	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	479	459.29	916.56	459.29	916.57	2	-12.83	19.6	46657	49	3	371 - 378	K.LQLIVFGK.K
1454	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	192	668.30	667.30	668.30	667.30	1	-2.02	13.2	52630	30	2	183 - 187	K.DGYWK.W
1454	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	572	723.87	1445.73	723.87	1445.73	2	-3.99	21.7	4813	64	3	158 - 169	R.YFPTQALNFAFK.D
1454	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	10	558.74	1115.46	558.74	1115.47	2	-4.97	8.8	7113	20	4	318 - 327	R.MMMTSGEAVK.Y	Oxidation: 1
1454	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	9	558.74	1115.46	558.74	1115.47	2	-4.20	8.7	7800	17	2	318 - 327	R.MMMTSGEAVK.Y	Oxidation: 1
1454	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	569	723.87	1445.73	723.87	1445.73	2	-3.72	21.6	14085	65	3	158 - 169	R.YFPTQALNFAFK.D
1454	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	8	558.74	1115.46	558.74	1115.47	2	-2.72	8.7	10052	16	2	318 - 327	R.MMMTSGEAVK.Y	Oxidation: 1
1454	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	299	476.25	950.48	476.25	950.48	2	1.81	15.5	27908	17	2	246 - 254	K.SDGIAGLYR.G
1454	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	480	459.29	916.57	459.29	916.57	2	-6.53	19.6	37010	45	3	371 - 378	K.LQLIVFGK.K
1454	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	575	723.87	1445.73	723.87	1445.73	2	-4.30	21.8	6235	48	3	158 - 169	R.YFPTQALNFAFK.D
1454	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	255	680.86	1359.70	680.86	1359.71	2	-3.57	14.6	25738	70	4	110 - 120	K.LLIQNQDEMLK.A	Oxidation: 9
1454	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	37	414.73	827.45	414.73	827.45	2	-4.16	9.6	50097	53	3	100 - 107	K.TAAAPIER.V
1454	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	33	566.74	1131.46	566.74	1131.46	2	-3.04	9.5	74987	15	1	318 - 327	R.MMMTSGEAVK.Y	Oxidation: 1
1454	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	46	422.73	843.45	422.74	843.46	2	-7.07	9.8	12233	37	3	150 - 157	R.GNTANVIR.Y
1454	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	571	482.92	1445.73	482.92	1445.73	3	-3.73	21.7	4682	60	1	158 - 169	R.YFPTQALNFAFK.D
1454	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	40	414.73	827.45	414.73	827.45	2	-3.22	9.7	48403	52	3	100 - 107	K.TAAAPIER.V
1454	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	329	672.86	1343.71	672.86	1343.71	2	-4.34	16.2	39419	43	2	110 - 120	K.LLIQNQDEMLK.A
1454	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	8	558.74	1115.46	558.74	1115.47	2	-2.72	8.7	10052	46	4	318 - 327	R.MMMTSGEAVK.Y	Oxidation: 2
1454	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	260	454.24	1359.70	454.24	1359.71	3	-3.56	14.7	38049	32	3	110 - 120	K.LLIQNQDEMLK.A	Oxidation: 9
1454	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	481	917.58	916.57	917.58	916.57	1	-6.53	19.6	171978	67	2	371 - 378	K.LQLIVFGK.K
1454	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	10	558.74	1115.46	558.74	1115.47	2	-4.97	8.8	7113	35	4	318 - 327	R.MMMTSGEAVK.Y	Oxidation: 2
1454	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	42	422.73	843.45	422.74	843.46	2	-6.01	9.7	60075	37	3	150 - 157	R.GNTANVIR.Y
1454	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	7	558.74	1115.46	558.74	1115.47	2	-4.24	8.7	12827	28	4	318 - 327	R.MMMTSGEAVK.Y	Oxidation: 1
1454	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	356	668.37	667.37	668.38	667.37	1	-3.51	16.8	78143	17	2	175 - 179	R.LFNFK.K
1454	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	326	672.86	1343.71	672.86	1343.71	2	-5.02	16.2	33517	64	2	110 - 120	K.LLIQNQDEMLK.A
1454	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	116	550.74	1099.47	550.74	1099.47	2	-4.96	11.4	81607	38	1	318 - 327	R.MMMTSGEAVK.Y	Oxidation: 2
1454	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	351	668.37	667.37	668.38	667.37	1	-3.49	16.7	12233	21	2	175 - 179	R.LFNFK.K
1454	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	116	550.74	1099.47	550.74	1099.47	2	-4.96	11.4	81607	22	1	318 - 327	R.MMMTSGEAVK.Y	Oxidation: 3
1454	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	8	558.74	1115.46	558.74	1115.47	2	-2.72	8.7	10052	31	4	318 - 327	R.MMMTSGEAVK.Y	Oxidation: 1
1454	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	258	680.86	1359.70	680.86	1359.71	2	-3.57	14.7	15426	79	4	110 - 120	K.LLIQNQDEMLK.A	Oxidation: 9
1454	AT5G13490.1	AAC2 (ADP/ATP carrier 2)	ADP/ATP carrier oligomers	d) transport	mitochondria	483	459.29	916.57	459.29	916.57	2	-6.90	19.7	40428	40	3	371 - 378	K.LQLIVFGK.K
1343	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	8	558.74	1115.46	558.74	1115.47	2	-8.53	8.6	90693	34	10	312 - 321	R.MMMTSGEAVK.Y	Oxidation: 1
1343	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	84	736.38	735.37	736.39	735.38	1	-8.41	10.8	10501	45	3	119 - 124	R.LSEPYK.G
1343	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	565	667.33	1998.98	667.34	1998.99	3	-5.01	22.8	59588	24	3	153 - 168	R.YFPTQALNFAFKDYFK.R
1343	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	13	558.74	1115.46	558.74	1115.47	2	-8.68	8.7	12464	34	10	312 - 321	R.MMMTSGEAVK.Y	Oxidation: 1
1343	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	25	558.74	1115.46	558.74	1115.47	2	-9.21	9.2	47431	32	10	312 - 321	R.MMMTSGEAVK.Y	Oxidation: 2
1343	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	77	550.74	1099.46	550.74	1099.47	2	-9.91	10.5	20293	22	2	312 - 321	R.MMMTSGEAVK.Y	Oxidation: 2
1343	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	76	550.74	1099.46	550.74	1099.47	2	-9.42	10.5	4823	33	3	312 - 321	R.MMMTSGEAVK.Y	Oxidation: 3
1343	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	10	558.74	1115.46	558.74	1115.47	2	-8.80	8.6	7998	47	10	312 - 321	R.MMMTSGEAVK.Y	Oxidation: 2
1343	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	10	558.74	1115.46	558.74	1115.47	2	-8.80	8.6	7998	19	9	312 - 321	R.MMMTSGEAVK.Y	Oxidation: 1
1343	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	13	558.74	1115.46	558.74	1115.47	2	-8.68	8.7	12464	21	9	312 - 321	R.MMMTSGEAVK.Y	Oxidation: 1
1343	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	161	542.74	1083.47	542.75	1083.48	2	-8.31	12.6	7950	53	2	312 - 321	R.MMMTSGEAVK.Y
1343	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	12	558.74	1115.46	558.74	1115.47	2	-9.05	8.7	12583	54	10	312 - 321	R.MMMTSGEAVK.Y	Oxidation: 2
1343	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	12	558.74	1115.46	558.74	1115.47	2	-9.05	8.7	12583	39	10	312 - 321	R.MMMTSGEAVK.Y	Oxidation: 1
1343	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	407	632.84	1263.67	632.85	1263.68	2	-9.74	18.1	78190	60	1	237 - 248	K.TIASDGIVGLYR.G
1343	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	22	558.74	1115.46	558.74	1115.47	2	-7.69	9.1	28892	29	10	312 - 321	R.MMMTSGEAVK.Y	Oxidation: 2
1343	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	23	558.74	1115.46	558.74	1115.47	2	-8.78	9.1	121929	26	10	312 - 321	R.MMMTSGEAVK.Y	Oxidation: 2
1343	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	73	550.74	1099.46	550.74	1099.47	2	-9.99	10.4	9283	32	2	312 - 321	R.MMMTSGEAVK.Y	Oxidation: 2
1343	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	191	668.30	667.29	668.30	667.30	1	-7.08	13.2	66813	26	3	178 - 182	K.DGYWK.W
1343	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	253	680.86	1359.70	680.86	1359.71	2	-6.31	14.6	4235	79	3	105 - 115	K.LLIQNQDEMIK.A	Oxidation: 9
1343	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	73	550.74	1099.46	550.74	1099.47	2	-9.99	10.4	9283	61	3	312 - 321	R.MMMTSGEAVK.Y	Oxidation: 3
1343	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	349	668.37	667.36	668.38	667.37	1	-8.08	16.8	103115	25	3	170 - 174	R.LFNFK.K
1343	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	355	668.37	667.36	668.38	667.37	1	-8.31	16.9	405018	21	3	170 - 174	R.LFNFK.K
1343	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	23	558.74	1115.46	558.74	1115.47	2	-8.78	9.1	121929	41	10	312 - 321	R.MMMTSGEAVK.Y	Oxidation: 1
1343	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	326	448.91	1343.70	448.91	1343.71	3	-7.04	16.3	44318	37	1	105 - 115	K.LLIQNQDEMIK.A
1343	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	87	736.38	735.37	736.39	735.38	1	-7.93	10.9	9566	44	3	119 - 124	R.LSEPYK.G
1343	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	25	558.74	1115.46	558.74	1115.47	2	-9.21	9.2	47431	29	9	312 - 321	R.MMMTSGEAVK.Y	Oxidation: 1
1343	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	9	558.74	1115.46	558.74	1115.47	2	-8.52	8.6	6317	48	10	312 - 321	R.MMMTSGEAVK.Y	Oxidation: 2
1343	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	568	667.33	1998.97	667.34	1998.99	3	-6.53	22.9	31840	37	3	153 - 168	R.YFPTQALNFAFKDYFK.R
1343	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	43	414.73	827.44	414.73	827.45	2	-6.38	9.6	17246	57	4	95 - 102	K.TAAAPIER.V
1343	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	12	558.74	1115.46	558.74	1115.47	2	-9.05	8.7	12583	24	9	312 - 321	R.MMMTSGEAVK.Y	Oxidation: 1
1343	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	256	680.86	1359.70	680.86	1359.71	2	-6.24	14.7	6091	65	3	105 - 115	K.LLIQNQDEMIK.A	Oxidation: 9
1343	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	352	668.37	667.36	668.38	667.37	1	-8.28	16.9	197513	20	3	170 - 174	R.LFNFK.K
1343	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	570	667.33	1998.98	667.34	1998.99	3	-5.55	22.9	21867	28	3	153 - 168	R.YFPTQALNFAFKDYFK.R
1343	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	26	558.73	1115.46	558.74	1115.47	2	-9.59	9.2	101374	31	10	312 - 321	R.MMMTSGEAVK.Y	Oxidation: 2
1343	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	26	558.73	1115.46	558.74	1115.47	2	-9.59	9.2	101374	29	9	312 - 321	R.MMMTSGEAVK.Y	Oxidation: 1
1343	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	49	422.73	843.45	422.74	843.46	2	-8.13	9.8	57629	34	3	145 - 152	R.GNTANVIR.Y
1343	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	141	771.44	770.44	771.45	770.44	1	-5.12	12.1	16915	29	3	344 - 351	K.GAGANILR.A
1343	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	165	542.74	1083.47	542.75	1083.48	2	-10.03	12.6	18994	33	2	312 - 321	R.MMMTSGEAVK.Y
1343	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	251	680.86	1359.70	680.86	1359.71	2	-5.27	14.6	40680	70	3	105 - 115	K.LLIQNQDEMIK.A	Oxidation: 9
1343	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	46	422.73	843.45	422.74	843.46	2	-7.95	9.7	17775	33	3	145 - 152	R.GNTANVIR.Y
1343	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	22	558.74	1115.46	558.74	1115.47	2	-7.69	9.1	28892	46	10	312 - 321	R.MMMTSGEAVK.Y	Oxidation: 1
1343	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	8	558.74	1115.46	558.74	1115.47	2	-8.53	8.6	90693	44	10	312 - 321	R.MMMTSGEAVK.Y	Oxidation: 2
1343	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	324	672.86	1343.70	672.86	1343.71	2	-8.90	16.2	45087	70	3	105 - 115	K.LLIQNQDEMIK.A
1343	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	39	414.73	827.44	414.73	827.45	2	-9.29	9.5	14738	53	4	95 - 102	K.TAAAPIER.V
1343	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	11	558.74	1115.46	558.74	1115.47	2	-8.69	8.7	38870	16	9	312 - 321	R.MMMTSGEAVK.Y	Oxidation: 1
1343	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	50	414.73	827.44	414.73	827.45	2	-9.99	9.8	405018	39	4	95 - 102	K.TAAAPIER.V
1343	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	187	668.30	667.29	668.30	667.30	1	-6.51	13.2	10536	30	3	178 - 182	K.DGYWK.W
1343	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	44	422.73	843.45	422.74	843.46	2	-8.73	9.6	103115	41	3	145 - 152	R.GNTANVIR.Y
1343	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	26	558.73	1115.46	558.74	1115.47	2	-9.59	9.2	101374	48	10	312 - 321	R.MMMTSGEAVK.Y	Oxidation: 1
1343	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	77	550.74	1099.46	550.74	1099.47	2	-9.91	10.5	20293	45	3	312 - 321	R.MMMTSGEAVK.Y	Oxidation: 3
1343	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	517	723.87	1445.72	723.87	1445.73	2	-6.73	21.4	32444	52	3	153 - 164	R.YFPTQALNFAFK.D
1343	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	13	558.74	1115.46	558.74	1115.47	2	-8.68	8.7	12464	47	10	312 - 321	R.MMMTSGEAVK.Y	Oxidation: 2
1343	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	23	558.74	1115.46	558.74	1115.47	2	-8.78	9.1	121929	23	9	312 - 321	R.MMMTSGEAVK.Y	Oxidation: 1
1343	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	328	672.86	1343.70	672.86	1343.71	2	-7.28	16.3	121929	64	3	105 - 115	K.LLIQNQDEMIK.A
1343	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	184	668.30	667.29	668.30	667.30	1	-4.69	13.1	8560	29	3	178 - 182	K.DGYWK.W
1343	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	8	558.74	1115.46	558.74	1115.47	2	-8.53	8.6	90693	19	9	312 - 321	R.MMMTSGEAVK.Y	Oxidation: 1
1343	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	31	475.21	1422.61	475.21	1422.62	3	-7.50	9.4	12210	27	2	312 - 323	R.MMMTSGEAVKYK.S	Oxidation: 1
1343	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	90	736.38	735.37	736.39	735.38	1	-7.53	11	4354	40	3	119 - 124	R.LSEPYK.G
1343	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	36	566.73	1131.45	566.74	1131.46	2	-5.64	9.4	12724	31	1	312 - 321	R.MMMTSGEAVK.Y	Oxidation: 1
1343	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	30	475.21	1422.61	475.21	1422.62	3	-5.79	9.3	42913	28	2	312 - 323	R.MMMTSGEAVKYK.S	Oxidation: 1
1343	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	143	771.44	770.43	771.45	770.44	1	-7.04	12.2	26159	29	3	344 - 351	K.GAGANILR.A
1343	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	567	1000.50	1998.98	1000.50	1998.99	2	-5.01	22.8	15049	86	1	153 - 168	R.YFPTQALNFAFKDYFK.R
1343	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	520	723.87	1445.72	723.87	1445.73	2	-6.86	21.5	33586	63	3	153 - 164	R.YFPTQALNFAFK.D
1343	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	22	558.74	1115.46	558.74	1115.47	2	-7.69	9.1	28892	30	9	312 - 321	R.MMMTSGEAVK.Y	Oxidation: 1
1343	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	40	414.73	827.44	414.73	827.45	2	-7.37	9.6	9636	51	4	95 - 102	K.TAAAPIER.V
1343	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	267	529.96	1586.86	529.96	1586.87	3	-8.25	14.9	22419	32	1	103 - 115	R.VKLLIQNQDEMIK.A	Oxidation: 11
1343	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	10	558.74	1115.46	558.74	1115.47	2	-8.80	8.6	7998	34	10	312 - 321	R.MMMTSGEAVK.Y	Oxidation: 1
1343	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	523	723.87	1445.72	723.87	1445.73	2	-7.37	21.5	16458	77	3	153 - 164	R.YFPTQALNFAFK.D
1343	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	325	672.86	1343.70	672.86	1343.71	2	-7.03	16.3	71378	81	3	105 - 115	K.LLIQNQDEMIK.A
1343	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	11	558.74	1115.46	558.74	1115.47	2	-8.69	8.7	38870	32	10	312 - 321	R.MMMTSGEAVK.Y	Oxidation: 1
1343	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	11	558.74	1115.46	558.74	1115.47	2	-8.69	8.7	38870	44	10	312 - 321	R.MMMTSGEAVK.Y	Oxidation: 2
1343	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	146	771.44	770.43	771.45	770.44	1	-6.99	12.2	80427	21	3	344 - 351	K.GAGANILR.A
1343	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	25	558.74	1115.46	558.74	1115.47	2	-9.21	9.2	47431	46	10	312 - 321	R.MMMTSGEAVK.Y	Oxidation: 1
1343	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	9	558.74	1115.46	558.74	1115.47	2	-8.52	8.6	6317	30	10	312 - 321	R.MMMTSGEAVK.Y	Oxidation: 1
1403	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	83	550.74	1099.46	550.74	1099.47	2	-13.24	11.4	36369	41	3	312 - 321	R.MMMTSGEAVK.Y	Oxidation: 1
1403	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	220	454.24	1359.69	454.24	1359.71	3	-13.58	14.6	11145	34	3	105 - 115	K.LLIQNQDEMIK.A	Oxidation: 9
1403	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	50	469.88	1406.61	469.88	1406.62	3	-12.29	10.6	10377	43	3	312 - 323	R.MMMTSGEAVKYK.S	Oxidation: 1
1403	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	56	736.38	735.37	736.39	735.38	1	-12.43	10.7	13519	17	3	119 - 124	R.LSEPYK.G
1403	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	39	469.88	1406.61	469.88	1406.62	3	-13.76	10.2	20630	25	3	312 - 323	R.MMMTSGEAVKYK.S	Oxidation: 1
1403	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	1	558.73	1115.45	558.74	1115.47	2	-16.82	9	197051	51	5	312 - 321	R.MMMTSGEAVK.Y	Oxidation: 2
1403	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	218	680.85	1359.69	680.86	1359.71	2	-13.58	14.6	6279	70	3	105 - 115	K.LLIQNQDEMIK.A	Oxidation: 9
1403	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	49	469.88	1406.61	469.88	1406.62	3	-12.29	10.6	15319	25	3	312 - 323	R.MMMTSGEAVKYK.S	Oxidation: 2
1403	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	212	680.85	1359.69	680.86	1359.71	2	-13.08	14.5	6240	60	3	105 - 115	K.LLIQNQDEMIK.A	Oxidation: 9
1403	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	18	414.73	827.44	414.73	827.45	2	-12.24	9.6	561594	57	3	95 - 102	K.TAAAPIER.V
1403	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	505	482.91	1445.72	482.92	1445.73	3	-10.57	21.7	4992	39	2	153 - 164	R.YFPTQALNFAFK.D
1403	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	533	667.33	1998.97	667.34	1998.99	3	-10.74	22.8	43236	59	1	153 - 168	R.YFPTQALNFAFKDYFK.R
1403	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	48	550.74	1099.46	550.74	1099.47	2	-13.82	10.5	23167	18	3	312 - 321	R.MMMTSGEAVK.Y	Oxidation: 1
1403	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	149	668.30	667.29	668.30	667.30	1	-12.81	13	5927	33	3	178 - 182	K.DGYWK.W
1403	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	307	668.37	667.36	668.38	667.37	1	-13.86	16.6	24281	20	3	170 - 174	R.LFNFK.K
1403	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	39	469.88	1406.61	469.88	1406.62	3	-13.76	10.2	20630	36	3	312 - 323	R.MMMTSGEAVKYK.S	Oxidation: 2
1403	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	13	566.73	1131.45	566.74	1131.46	2	-9.08	9.4	13710	41	2	312 - 321	R.MMMTSGEAVK.Y	Oxidation: 1
1403	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	500	723.87	1445.72	723.87	1445.73	2	-11.09	21.6	11889	79	3	153 - 164	R.YFPTQALNFAFK.D
1403	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	1	558.73	1115.45	558.74	1115.47	2	-16.82	9	197051	29	5	312 - 321	R.MMMTSGEAVK.Y	Oxidation: 1
1403	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	3	558.73	1115.45	558.74	1115.47	2	-16.30	9.1	16720	29	5	312 - 321	R.MMMTSGEAVK.Y	Oxidation: 1
1403	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	15	414.73	827.44	414.73	827.45	2	-12.19	9.5	102787	53	3	95 - 102	K.TAAAPIER.V
1403	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	175	822.93	1643.85	822.94	1643.87	2	-12.31	13.6	24367	24	1	105 - 118	K.LLIQNQDEMIKAGR.L	Oxidation: 9
1403	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	5	558.73	1115.45	558.74	1115.47	2	-13.72	9.2	38188	33	5	312 - 321	R.MMMTSGEAVK.Y	Oxidation: 2
1403	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	289	672.86	1343.70	672.86	1343.71	2	-11.50	16.2	25169	67	2	105 - 115	K.LLIQNQDEMIK.A
1403	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	227	529.96	1586.85	529.96	1586.87	3	-12.87	14.8	7681	44	2	103 - 115	R.VKLLIQNQDEMIK.A	Oxidation: 11
1403	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	48	550.74	1099.46	550.74	1099.47	2	-13.82	10.5	23167	36	4	312 - 321	R.MMMTSGEAVK.Y	Oxidation: 2
1403	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	313	668.37	667.36	668.38	667.37	1	-9.01	16.7	18437	27	3	170 - 174	R.LFNFK.K
1403	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	215	680.85	1359.69	680.86	1359.71	2	-13.36	14.5	11204	70	3	105 - 115	K.LLIQNQDEMIK.A	Oxidation: 9
1403	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	213	454.24	1359.69	454.24	1359.71	3	-13.07	14.5	53205	45	3	105 - 115	K.LLIQNQDEMIK.A	Oxidation: 9
1403	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	4	558.73	1115.45	558.74	1115.47	2	-15.24	9.1	103868	32	5	312 - 321	R.MMMTSGEAVK.Y	Oxidation: 1
1403	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	110	771.44	770.43	771.45	770.44	1	-11.73	12.1	4983	26	3	344 - 351	K.GAGANILR.A
1403	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	498	723.87	1445.72	723.87	1445.73	2	-11.57	21.5	13521	67	3	153 - 164	R.YFPTQALNFAFK.D
1403	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	45	550.73	1099.46	550.74	1099.47	2	-14.45	10.4	71816	31	4	312 - 321	R.MMMTSGEAVK.Y	Oxidation: 2
1403	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	45	550.73	1099.46	550.74	1099.47	2	-14.45	10.4	71816	15	3	312 - 321	R.MMMTSGEAVK.Y	Oxidation: 1
1403	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	27	422.73	843.44	422.74	843.46	2	-16.27	9.8	97664	38	2	145 - 152	R.GNTANVIR.Y
1403	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	4	558.73	1115.45	558.74	1115.47	2	-15.24	9.1	103868	50	5	312 - 321	R.MMMTSGEAVK.Y	Oxidation: 1
1403	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	50	469.88	1406.61	469.88	1406.62	3	-12.29	10.6	10377	43	3	312 - 323	R.MMMTSGEAVKYK.S	Oxidation: 2
1403	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	49	469.88	1406.61	469.88	1406.62	3	-12.29	10.6	15319	25	3	312 - 323	R.MMMTSGEAVKYK.S	Oxidation: 1
1403	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	14	566.73	1131.45	566.74	1131.46	2	-9.56	9.5	4900	32	2	312 - 321	R.MMMTSGEAVK.Y	Oxidation: 1
1403	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	45	550.73	1099.46	550.74	1099.47	2	-14.45	10.4	71816	58	4	312 - 321	R.MMMTSGEAVK.Y	Oxidation: 3
1403	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	503	723.87	1445.72	723.87	1445.73	2	-10.57	21.6	6362	80	3	153 - 164	R.YFPTQALNFAFK.D
1403	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	107	771.44	770.43	771.45	770.44	1	-12.16	12	17491	23	3	344 - 351	K.GAGANILR.A
1403	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	2	558.73	1115.45	558.74	1115.47	2	-16.34	9.1	24281	29	5	312 - 321	R.MMMTSGEAVK.Y	Oxidation: 1
1403	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	177	548.96	1643.85	548.96	1643.87	3	-12.85	13.7	26579	41	2	105 - 118	K.LLIQNQDEMIKAGR.L	Oxidation: 9
1403	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	4	558.73	1115.45	558.74	1115.47	2	-15.24	9.1	103868	36	5	312 - 321	R.MMMTSGEAVK.Y	Oxidation: 2
1403	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	49	469.88	1406.61	469.88	1406.62	3	-12.29	10.6	15319	25	3	312 - 323	R.MMMTSGEAVKYK.S	Oxidation: 1
1403	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	10	712.31	1422.60	712.32	1422.62	2	-11.85	9.4	13146	19	2	312 - 323	R.MMMTSGEAVKYK.S	Oxidation: 1
1403	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	134	542.74	1083.46	542.75	1083.48	2	-15.80	12.7	7544	37	2	312 - 321	R.MMMTSGEAVK.Y
1403	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	5	558.73	1115.45	558.74	1115.47	2	-13.72	9.2	38188	47	5	312 - 321	R.MMMTSGEAVK.Y	Oxidation: 1
1403	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	6	475.21	1422.61	475.21	1422.62	3	-9.35	9.2	13605	51	3	312 - 323	R.MMMTSGEAVKYK.S	Oxidation: 1
1403	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	83	550.74	1099.46	550.74	1099.47	2	-13.24	11.4	36369	67	4	312 - 321	R.MMMTSGEAVK.Y	Oxidation: 2
1403	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	286	672.85	1343.70	672.86	1343.71	2	-12.54	16.1	47618	75	2	105 - 115	K.LLIQNQDEMIK.A
1403	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	1	558.73	1115.45	558.74	1115.47	2	-16.82	9	197051	51	5	312 - 321	R.MMMTSGEAVK.Y	Oxidation: 1
1403	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	502	482.91	1445.72	482.92	1445.73	3	-11.08	21.6	5457	56	2	153 - 164	R.YFPTQALNFAFK.D
1403	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	46	550.74	1099.46	550.74	1099.47	2	-14.13	10.4	8653	27	4	312 - 321	R.MMMTSGEAVK.Y	Oxidation: 2
1403	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	133	542.74	1083.46	542.75	1083.48	2	-16.79	12.6	14369	61	2	312 - 321	R.MMMTSGEAVK.Y
1403	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	61	736.38	735.37	736.39	735.38	1	-11.56	10.9	55190	37	3	119 - 124	R.LSEPYK.G
1403	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	83	550.74	1099.46	550.74	1099.47	2	-13.24	11.4	36369	46	4	312 - 321	R.MMMTSGEAVK.Y	Oxidation: 3
1403	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	152	668.30	667.29	668.30	667.30	1	-11.51	13.1	4505	33	3	178 - 182	K.DGYWK.W
1403	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	310	668.37	667.36	668.38	667.37	1	-9.48	16.7	38188	21	3	170 - 174	R.LFNFK.K
1403	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	2	558.73	1115.45	558.74	1115.47	2	-16.34	9.1	24281	32	5	312 - 321	R.MMMTSGEAVK.Y	Oxidation: 2
1403	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	48	550.74	1099.46	550.74	1099.47	2	-13.82	10.5	23167	62	4	312 - 321	R.MMMTSGEAVK.Y	Oxidation: 3
1403	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	21	414.73	827.44	414.73	827.45	2	-12.12	9.6	433057	58	3	95 - 102	K.TAAAPIER.V
1403	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	2	558.73	1115.45	558.74	1115.47	2	-16.34	9.1	24281	47	5	312 - 321	R.MMMTSGEAVK.Y	Oxidation: 1
1403	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	147	668.30	667.29	668.30	667.30	1	-10.19	13	6200	29	3	178 - 182	K.DGYWK.W
1403	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	173	548.96	1643.85	548.96	1643.87	3	-12.30	13.6	30542	52	2	105 - 118	K.LLIQNQDEMIKAGR.L	Oxidation: 9
1403	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	228	794.43	1586.85	794.44	1586.87	2	-12.88	14.8	43236	54	2	103 - 115	R.VKLLIQNQDEMIK.A	Oxidation: 11
1403	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	9	712.31	1422.60	712.32	1422.62	2	-12.06	9.3	42386	23	2	312 - 323	R.MMMTSGEAVKYK.S	Oxidation: 1
1403	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	8	475.21	1422.60	475.21	1422.62	3	-12.06	9.3	18437	59	3	312 - 323	R.MMMTSGEAVKYK.S	Oxidation: 1
1403	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	46	550.74	1099.46	550.74	1099.47	2	-14.13	10.4	8653	49	4	312 - 321	R.MMMTSGEAVK.Y	Oxidation: 3
1403	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	7	475.21	1422.60	475.21	1422.62	3	-10.99	9.3	56518	57	3	312 - 323	R.MMMTSGEAVKYK.S	Oxidation: 1
1403	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	24	422.73	843.44	422.74	843.46	2	-13.62	9.7	31728	40	2	145 - 152	R.GNTANVIR.Y
1403	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	57	736.38	735.37	736.39	735.38	1	-12.39	10.8	289555	44	3	119 - 124	R.LSEPYK.G
1403	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	113	771.44	770.43	771.45	770.44	1	-11.89	12.2	8162	21	3	344 - 351	K.GAGANILR.A
1403	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	3	558.73	1115.45	558.74	1115.47	2	-16.30	9.1	16720	33	5	312 - 321	R.MMMTSGEAVK.Y	Oxidation: 2
1403	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	50	469.88	1406.61	469.88	1406.62	3	-12.29	10.6	10377	54	3	312 - 323	R.MMMTSGEAVKYK.S	Oxidation: 1
1403	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	226	794.43	1586.85	794.44	1586.87	2	-13.07	14.7	21465	59	2	103 - 115	R.VKLLIQNQDEMIK.A	Oxidation: 11
1403	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	3	558.73	1115.45	558.74	1115.47	2	-16.30	9.1	16720	47	5	312 - 321	R.MMMTSGEAVK.Y	Oxidation: 1
1403	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	5	558.73	1115.45	558.74	1115.47	2	-13.72	9.2	38188	28	5	312 - 321	R.MMMTSGEAVK.Y	Oxidation: 1
1403	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	39	469.88	1406.61	469.88	1406.62	3	-13.76	10.2	20630	28	3	312 - 323	R.MMMTSGEAVKYK.S	Oxidation: 1
1403	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	363	632.84	1263.67	632.85	1263.68	2	-13.17	17.9	146838	70	1	237 - 248	K.TIASDGIVGLYR.G
1403	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	224	529.96	1586.85	529.96	1586.87	3	-13.06	14.7	9635	43	2	103 - 115	R.VKLLIQNQDEMIK.A	Oxidation: 11
1403	AT4G28390.1	AAC3 (ADP/ATP carrier 3)	ADP/ATP carrier oligomers	d) transport	mitochondria	216	454.24	1359.69	454.24	1359.71	3	-13.36	14.5	7015	39	3	105 - 115	K.LLIQNQDEMIK.A	Oxidation: 9
1216	AT4G26970.1	aconitate hydratase-1	aconitase	c) pyruvate metabolism & TCA cycle	mitochondria	11	495.79	989.56	495.78	989.55	2	6.68	11.1	3679	17	1	586 - 594	R.SGLRESLTK.Q
1216	AT4G26970.1	aconitate hydratase-1	aconitase	c) pyruvate metabolism & TCA cycle	mitochondria	177	457.79	913.56	457.79	913.56	2	0.94	16.9	7908	17	3	142 - 149	R.ILLESAIR.N
1216	AT4G26970.1	aconitate hydratase-1	aconitase	c) pyruvate metabolism & TCA cycle	mitochondria	175	457.79	913.56	457.79	913.56	2	1.90	16.8	3719	24	3	142 - 149	R.ILLESAIR.N
1216	AT4G26970.1	aconitate hydratase-1	aconitase	c) pyruvate metabolism & TCA cycle	mitochondria	176	457.79	913.56	457.79	913.56	2	-0.13	16.9	7002	27	3	142 - 149	R.ILLESAIR.N
1158	AT2G05710.1	aconitate hydratase-2	aconitase	c) pyruvate metabolism & TCA cycle	mitochondria	32	456.74	911.47	456.74	911.46	2	12.69	11.7	13134	31	2	707 - 714	R.ATYESITK.G
1158	AT2G05710.1	aconitate hydratase-2	aconitase	c) pyruvate metabolism & TCA cycle	mitochondria	213	775.91	1549.80	775.90	1549.78	2	14.12	18.7	4571	59	4	508 - 521	K.VVNFSFDGQPAELK.H
1158	AT2G05710.1	aconitate hydratase-2	aconitase	c) pyruvate metabolism & TCA cycle	mitochondria	216	775.91	1549.80	775.90	1549.78	2	13.81	18.8	10783	73	4	508 - 521	K.VVNFSFDGQPAELK.H
1158	AT2G05710.1	aconitate hydratase-2	aconitase	c) pyruvate metabolism & TCA cycle	mitochondria	57	558.82	1115.63	558.82	1115.62	2	9.30	12.6	7874	60	4	565 - 576	K.TSLAPGSGVVTK.Y
1158	AT2G05710.1	aconitate hydratase-2	aconitase	c) pyruvate metabolism & TCA cycle	mitochondria	159	513.26	1024.51	513.26	1024.50	2	12.14	16.4	8774	54	3	847 - 855	K.LSVFDAAMR.Y	Oxidation: 8
1158	AT2G05710.1	aconitate hydratase-2	aconitase	c) pyruvate metabolism & TCA cycle	mitochondria	155	513.26	1024.51	513.26	1024.50	2	9.80	16.3	10771	66	3	847 - 855	K.LSVFDAAMR.Y	Oxidation: 8
1158	AT2G05710.1	aconitate hydratase-2	aconitase	c) pyruvate metabolism & TCA cycle	mitochondria	215	775.91	1549.80	775.90	1549.78	2	15.01	18.7	11108	88	4	508 - 521	K.VVNFSFDGQPAELK.H
1158	AT2G05710.1	aconitate hydratase-2	aconitase	c) pyruvate metabolism & TCA cycle	mitochondria	33	435.72	869.42	435.71	869.41	2	17.11	11.7	4977	23	1	958 - 964	K.SFTCTVR.F	Carbamidomethyl: 4
1158	AT2G05710.1	aconitate hydratase-2	aconitase	c) pyruvate metabolism & TCA cycle	mitochondria	20	423.24	844.46	423.23	844.45	2	14.97	11.3	10869	31	3	883 - 890	K.GPMLQGVK.A	Oxidation: 3
1158	AT2G05710.1	aconitate hydratase-2	aconitase	c) pyruvate metabolism & TCA cycle	mitochondria	83	519.92	1556.73	519.91	1556.71	3	14.40	13.5	6183	23	2	917 - 931	K.SGEDADTLGLTGHER.Y
1158	AT2G05710.1	aconitate hydratase-2	aconitase	c) pyruvate metabolism & TCA cycle	mitochondria	60	558.82	1115.63	558.82	1115.62	2	13.02	12.7	40469	52	4	565 - 576	K.TSLAPGSGVVTK.Y
1158	AT2G05710.1	aconitate hydratase-2	aconitase	c) pyruvate metabolism & TCA cycle	mitochondria	58	558.82	1115.63	558.82	1115.62	2	11.14	12.7	33342	64	4	565 - 576	K.TSLAPGSGVVTK.Y
1158	AT2G05710.1	aconitate hydratase-2	aconitase	c) pyruvate metabolism & TCA cycle	mitochondria	78	519.92	1556.73	519.91	1556.71	3	14.40	13.4	8314	61	2	917 - 931	K.SGEDADTLGLTGHER.Y
1158	AT2G05710.1	aconitate hydratase-2	aconitase	c) pyruvate metabolism & TCA cycle	mitochondria	176	457.79	913.56	457.79	913.56	2	1.33	16.9	10620	33	3	137 - 144	R.ILLESAIR.N
1158	AT2G05710.1	aconitate hydratase-2	aconitase	c) pyruvate metabolism & TCA cycle	mitochondria	35	456.74	911.47	456.74	911.46	2	13.09	11.8	26295	36	2	707 - 714	R.ATYESITK.G
1158	AT2G05710.1	aconitate hydratase-2	aconitase	c) pyruvate metabolism & TCA cycle	mitochondria	202	505.27	1008.52	505.26	1008.51	2	18.16	18.2	7858	47	2	847 - 855	K.LSVFDAAMR.Y
1158	AT2G05710.1	aconitate hydratase-2	aconitase	c) pyruvate metabolism & TCA cycle	mitochondria	11	484.27	966.53	484.26	966.51	2	13.26	10.9	6496	37	2	838 - 846	K.TVHIPSGEK.L
1158	AT2G05710.1	aconitate hydratase-2	aconitase	c) pyruvate metabolism & TCA cycle	mitochondria	19	423.24	844.46	423.23	844.45	2	13.06	11.3	6531	29	3	883 - 890	K.GPMLQGVK.A	Oxidation: 3
1158	AT2G05710.1	aconitate hydratase-2	aconitase	c) pyruvate metabolism & TCA cycle	mitochondria	154	513.26	1024.51	513.26	1024.50	2	8.28	16.2	5502	32	3	847 - 855	K.LSVFDAAMR.Y	Oxidation: 8
1158	AT2G05710.1	aconitate hydratase-2	aconitase	c) pyruvate metabolism & TCA cycle	mitochondria	174	457.79	913.57	457.79	913.56	2	5.96	16.9	13036	34	3	137 - 144	R.ILLESAIR.N
1158	AT2G05710.1	aconitate hydratase-2	aconitase	c) pyruvate metabolism & TCA cycle	mitochondria	205	505.27	1008.52	505.26	1008.51	2	14.15	18.3	7166	43	2	847 - 855	K.LSVFDAAMR.Y
1158	AT2G05710.1	aconitate hydratase-2	aconitase	c) pyruvate metabolism & TCA cycle	mitochondria	5	481.24	960.47	480.74	959.47	2	1035.70	10.1	5154	21	2	829 - 837	K.LMNGEVGPK.T	Oxidation: 2
1158	AT2G05710.1	aconitate hydratase-2	aconitase	c) pyruvate metabolism & TCA cycle	mitochondria	173	457.79	913.57	457.79	913.56	2	9.87	16.8	6524	30	3	137 - 144	R.ILLESAIR.N
1158	AT2G05710.1	aconitate hydratase-2	aconitase	c) pyruvate metabolism & TCA cycle	mitochondria	40	473.21	944.41	473.21	944.40	2	16.61	12.1	9146	35	1	801 - 808	K.DFNSYGSR.R
1158	AT2G05710.1	aconitate hydratase-2	aconitase	c) pyruvate metabolism & TCA cycle	mitochondria	4	481.24	960.47	480.74	959.47	2	1033.03	10	4455	19	2	829 - 837	K.LMNGEVGPK.T	Oxidation: 2
1158	AT2G05710.1	aconitate hydratase-2	aconitase	c) pyruvate metabolism & TCA cycle	mitochondria	21	423.24	844.46	423.23	844.45	2	12.14	11.4	9511	39	3	883 - 890	K.GPMLQGVK.A	Oxidation: 3
1158	AT2G05710.1	aconitate hydratase-2	aconitase	c) pyruvate metabolism & TCA cycle	mitochondria	214	775.91	1549.80	775.90	1549.78	2	14.03	18.7	8970	75	4	508 - 521	K.VVNFSFDGQPAELK.H
1158	AT2G05710.1	aconitate hydratase-2	aconitase	c) pyruvate metabolism & TCA cycle	mitochondria	62	558.82	1115.63	558.82	1115.62	2	13.29	12.8	17596	53	4	565 - 576	K.TSLAPGSGVVTK.Y
1158	AT2G05710.1	aconitate hydratase-2	aconitase	c) pyruvate metabolism & TCA cycle	mitochondria	10	484.27	966.53	484.26	966.51	2	12.76	10.8	4658	24	2	838 - 846	K.TVHIPSGEK.L
1161	AT5G61810.1	ACP1 (ATP-phosphate carrier 1)	other transporters	d) transport	cytosol,plasma membrane	127	407.25	812.49	407.25	812.49	2	9.57	12.4	146011	47	2	230 - 236	K.VALQVQR.T
1161	AT5G61810.1	ACP1 (ATP-phosphate carrier 1)	other transporters	d) transport	cytosol,plasma membrane	60	407.74	813.46	407.74	813.46	2	2.61	10.9	12607	36	2	268 - 275	K.VAPESAIK.F
1161	AT5G61810.1	ACP1 (ATP-phosphate carrier 1)	other transporters	d) transport	cytosol,plasma membrane	130	407.25	812.49	407.25	812.49	2	6.05	12.4	129659	32	2	230 - 236	K.VALQVQR.T
1161	AT5G61810.1	ACP1 (ATP-phosphate carrier 1)	other transporters	d) transport	cytosol,plasma membrane	65	407.74	813.46	407.74	813.46	2	3.86	10.9	53732	24	2	268 - 275	K.VAPESAIK.F
1220	AT5G61810.1	ACP1 (ATP-phosphate carrier 1)	other transporters	d) transport	cytosol,plasma membrane	25	422.73	843.45	422.73	843.45	2	1.30	10.3	3992	18	3	220 - 227	R.TATAPLDR.L
1220	AT5G61810.1	ACP1 (ATP-phosphate carrier 1)	other transporters	d) transport	cytosol,plasma membrane	28	422.73	843.45	422.73	843.45	2	8.23	10.4	3837	23	3	220 - 227	R.TATAPLDR.L
1220	AT5G61810.1	ACP1 (ATP-phosphate carrier 1)	other transporters	d) transport	cytosol,plasma membrane	27	422.73	843.45	422.73	843.45	2	6.95	10.3	5081	47	3	220 - 227	R.TATAPLDR.L
1220	AT5G61810.1	ACP1 (ATP-phosphate carrier 1)	other transporters	d) transport	cytosol,plasma membrane	352	599.37	1196.72	599.37	1196.72	2	-0.83	18.8	7215	62	1	207 - 219	K.LLLAGGIAGAVSR.T
1220	AT5G61810.1	ACP1 (ATP-phosphate carrier 1)	other transporters	d) transport	cytosol,plasma membrane	85	407.25	812.49	407.25	812.49	2	0.70	12	17610	47	1	230 - 236	K.VALQVQR.T
1220	AT5G61810.1	ACP1 (ATP-phosphate carrier 1)	other transporters	d) transport	cytosol,plasma membrane	32	407.74	813.46	407.74	813.46	2	4.74	10.7	4104	33	2	268 - 275	K.VAPESAIK.F
1220	AT5G61810.1	ACP1 (ATP-phosphate carrier 1)	other transporters	d) transport	cytosol,plasma membrane	31	407.74	813.46	407.74	813.46	2	5.99	10.6	6795	37	2	268 - 275	K.VAPESAIK.F
769	AT3G12110.1	actin 11	structure	g) other metabolic pathways	cytosol	360	499.75	997.48	499.75	997.48	2	-3.51	19.2	14438	36	2	186 - 193	R.DLTDYLMK.I
769	AT3G12110.1	actin 11	structure	g) other metabolic pathways	cytosol	356	499.74	997.47	499.75	997.48	2	-4.31	19.1	22060	36	2	186 - 193	R.DLTDYLMK.I
769	AT3G12110.1	actin 11	structure	g) other metabolic pathways	cytosol	200	505.92	1514.73	505.92	1514.74	3	-5.71	14.2	52000	55	1	87 - 97	K.IWHHTFYNELR.V
769	AT3G12110.1	actin 11	structure	g) other metabolic pathways	cytosol	270	652.02	1953.03	652.03	1953.06	3	-13.63	16.4	5784	61	2	98 - 115	R.VAPEEHPVLLTEAPLNPK.A
769	AT3G12110.1	actin 11	structure	g) other metabolic pathways	cytosol	230	644.43	643.42	644.43	643.43	1	-4.62	15.2	52644	27	1	65 - 70	R.GILTLK.Y
769	AT3G12110.1	actin 11	structure	g) other metabolic pathways	cytosol	271	652.02	1953.05	652.03	1953.06	3	-4.98	16.5	48450	61	2	98 - 115	R.VAPEEHPVLLTEAPLNPK.A
769	AT3G12110.1	actin 11	structure	g) other metabolic pathways	cytosol	104	488.73	975.44	488.73	975.44	2	3.58	11.2	156940	48	1	21 - 30	K.AGFAGDDAPR.A
769	AT3G46520.1	actin 12	structure	g) other metabolic pathways	cytosol	271	652.02	1953.05	652.03	1953.06	3	-4.98	16.5	48450	61	2	98 - 115	R.VAPEEHPVLLTEAPLNPK.A
769	AT3G46520.1	actin 12	structure	g) other metabolic pathways	cytosol	200	505.92	1514.73	505.92	1514.74	3	-5.71	14.2	52000	55	1	87 - 97	K.IWHHTFYNELR.V
769	AT3G46520.1	actin 12	structure	g) other metabolic pathways	cytosol	104	488.73	975.44	488.73	975.44	2	3.58	11.2	156940	48	1	21 - 30	K.AGFAGDDAPR.A
769	AT3G46520.1	actin 12	structure	g) other metabolic pathways	cytosol	270	652.02	1953.03	652.03	1953.06	3	-13.63	16.4	5784	61	2	98 - 115	R.VAPEEHPVLLTEAPLNPK.A
769	AT3G46520.1	actin 12	structure	g) other metabolic pathways	cytosol	176	566.76	1131.52	566.77	1131.52	2	-4.08	13.5	80018	46	1	199 - 208	R.GYSFTTTAER.E
769	AT3G46520.1	actin 12	structure	g) other metabolic pathways	cytosol	230	644.43	643.42	644.43	643.43	1	-4.62	15.2	52644	27	1	65 - 70	R.GILTLK.Y
1343	AT5G63400.1	adenylate kinase 1	other processes	g) other metabolic pathways	mitochondria	209	507.93	1520.77	507.93	1520.78	3	-5.65	13.6	38217	26	1	122 - 134	R.TVTQAEKLDEMLK.R	Oxidation: 11
1343	AT5G63400.1	adenylate kinase 1	other processes	g) other metabolic pathways	mitochondria	374	805.92	1609.82	805.92	1609.83	2	-8.19	17.4	19092	40	3	179 - 193	K.TPGVDDITGEPLIQR.K
1343	AT5G63400.1	adenylate kinase 1	other processes	g) other metabolic pathways	mitochondria	379	805.91	1609.81	805.92	1609.83	2	-10.49	17.5	13045	21	3	179 - 193	K.TPGVDDITGEPLIQR.K
1343	AT5G63400.1	adenylate kinase 1	other processes	g) other metabolic pathways	mitochondria	470	511.27	1020.53	511.28	1020.54	2	-12.50	20	18994	41	6	113 - 121	K.GFILDGFPR.T
1343	AT5G63400.1	adenylate kinase 1	other processes	g) other metabolic pathways	mitochondria	463	511.27	1020.53	511.28	1020.54	2	-6.79	19.8	5265	36	6	113 - 121	K.GFILDGFPR.T
1343	AT5G63400.1	adenylate kinase 1	other processes	g) other metabolic pathways	mitochondria	376	805.92	1609.82	805.92	1609.83	2	-9.11	17.4	13582	50	3	179 - 193	K.TPGVDDITGEPLIQR.K
1343	AT5G63400.1	adenylate kinase 1	other processes	g) other metabolic pathways	mitochondria	464	511.27	1020.53	511.28	1020.54	2	-8.47	19.8	183547	41	6	113 - 121	K.GFILDGFPR.T
1343	AT5G63400.1	adenylate kinase 1	other processes	g) other metabolic pathways	mitochondria	462	511.27	1020.53	511.28	1020.54	2	-6.67	19.8	102722	40	6	113 - 121	K.GFILDGFPR.T
1343	AT5G63400.1	adenylate kinase 1	other processes	g) other metabolic pathways	mitochondria	513	809.42	1616.83	809.43	1616.84	2	-5.36	21.3	6915	54	2	143 - 156	K.VLNFAIDDAILEER.I
1343	AT5G63400.1	adenylate kinase 1	other processes	g) other metabolic pathways	mitochondria	405	543.32	1084.62	543.32	1084.63	2	-9.57	18.1	71168	60	3	36 - 46	R.LIFIGPPGSGK.G
1343	AT5G63400.1	adenylate kinase 1	other processes	g) other metabolic pathways	mitochondria	402	543.31	1084.62	543.32	1084.63	2	-11.77	18	69186	65	3	36 - 46	R.LIFIGPPGSGK.G
1343	AT5G63400.1	adenylate kinase 1	other processes	g) other metabolic pathways	mitochondria	378	537.61	1609.82	537.62	1609.83	3	-9.11	17.4	9283	39	1	179 - 193	K.TPGVDDITGEPLIQR.K
1343	AT5G63400.1	adenylate kinase 1	other processes	g) other metabolic pathways	mitochondria	469	511.27	1020.53	511.28	1020.54	2	-12.01	20	9260	41	6	113 - 121	K.GFILDGFPR.T
1343	AT5G63400.1	adenylate kinase 1	other processes	g) other metabolic pathways	mitochondria	38	405.89	1214.64	405.89	1214.65	3	-7.03	9.5	34082	49	1	233 - 243	K.APQEVTSEVKK.A
1343	AT5G63400.1	adenylate kinase 1	other processes	g) other metabolic pathways	mitochondria	394	717.71	2150.12	717.72	2150.14	3	-7.02	17.8	18256	32	1	174 - 193	K.FAPPKTPGVDDITGEPLIQR.K
1343	AT5G63400.1	adenylate kinase 1	other processes	g) other metabolic pathways	mitochondria	515	809.42	1616.83	809.43	1616.84	2	-5.88	21.3	22359	66	2	143 - 156	K.VLNFAIDDAILEER.I
1343	AT5G63400.1	adenylate kinase 1	other processes	g) other metabolic pathways	mitochondria	401	543.31	1084.62	543.32	1084.63	2	-11.70	18	83125	53	3	36 - 46	R.LIFIGPPGSGK.G
1343	AT5G63400.1	adenylate kinase 1	other processes	g) other metabolic pathways	mitochondria	468	511.27	1020.53	511.28	1020.54	2	-10.42	19.9	15461	41	6	113 - 121	K.GFILDGFPR.T
1403	AT5G63400.1	adenylate kinase 1	other processes	g) other metabolic pathways	mitochondria	353	717.71	2150.12	717.72	2150.14	3	-8.40	17.7	23167	68	1	174 - 193	K.FAPPKTPGVDDITGEPLIQR.K
1403	AT5G63400.1	adenylate kinase 1	other processes	g) other metabolic pathways	mitochondria	461	511.27	1020.52	511.28	1020.54	2	-14.10	20.4	41963	41	3	113 - 121	K.GFILDGFPR.T
1403	AT5G63400.1	adenylate kinase 1	other processes	g) other metabolic pathways	mitochondria	458	511.27	1020.52	511.28	1020.54	2	-14.79	20.3	34011	33	3	113 - 121	K.GFILDGFPR.T
1403	AT5G63400.1	adenylate kinase 1	other processes	g) other metabolic pathways	mitochondria	361	543.31	1084.61	543.32	1084.63	2	-17.37	17.9	13519	49	2	36 - 46	R.LIFIGPPGSGK.G
1403	AT5G63400.1	adenylate kinase 1	other processes	g) other metabolic pathways	mitochondria	16	405.89	1214.64	405.89	1214.65	3	-10.03	9.5	77221	44	1	233 - 243	K.APQEVTSEVKK.A
1403	AT5G63400.1	adenylate kinase 1	other processes	g) other metabolic pathways	mitochondria	366	543.31	1084.61	543.32	1084.63	2	-15.20	18	55190	30	2	36 - 46	R.LIFIGPPGSGK.G
1403	AT5G63400.1	adenylate kinase 1	other processes	g) other metabolic pathways	mitochondria	338	805.91	1609.80	805.92	1609.83	2	-17.17	17.3	121514	79	1	179 - 193	K.TPGVDDITGEPLIQR.K
1403	AT5G63400.1	adenylate kinase 1	other processes	g) other metabolic pathways	mitochondria	455	511.27	1020.52	511.28	1020.54	2	-14.26	20.2	15338	36	3	113 - 121	K.GFILDGFPR.T
1455	AT5G63400.1	adenylate kinase 1	other processes	g) other metabolic pathways	mitochondria	545	809.42	1616.84	809.43	1616.84	2	-3.55	21.6	7578	68	2	143 - 156	K.VLNFAIDDAILEER.I
1455	AT5G63400.1	adenylate kinase 1	other processes	g) other metabolic pathways	mitochondria	541	809.42	1616.83	809.43	1616.84	2	-4.46	21.5	7921	84	2	143 - 156	K.VLNFAIDDAILEER.I
1455	AT5G63400.1	adenylate kinase 1	other processes	g) other metabolic pathways	mitochondria	120	405.57	1213.70	405.57	1213.70	3	-5.09	11.9	21510	29	1	222 - 232	K.KAVLTNIQAEK.A
1455	AT5G63400.1	adenylate kinase 1	other processes	g) other metabolic pathways	mitochondria	363	537.62	1609.83	537.62	1609.83	3	-2.86	17.3	9986	36	3	179 - 193	K.TPGVDDITGEPLIQR.K
1455	AT5G63400.1	adenylate kinase 1	other processes	g) other metabolic pathways	mitochondria	79	470.24	938.47	470.24	938.47	2	-4.26	10.9	3759	23	1	161 - 168	R.WIHPSSGR.S
1455	AT5G63400.1	adenylate kinase 1	other processes	g) other metabolic pathways	mitochondria	388	543.32	1084.62	543.32	1084.63	2	-7.47	17.9	18303	56	3	36 - 46	R.LIFIGPPGSGK.G
1455	AT5G63400.1	adenylate kinase 1	other processes	g) other metabolic pathways	mitochondria	495	511.27	1020.53	511.28	1020.54	2	-5.87	20.4	20217	54	3	113 - 121	K.GFILDGFPR.T
1455	AT5G63400.1	adenylate kinase 1	other processes	g) other metabolic pathways	mitochondria	498	511.27	1020.54	511.28	1020.54	2	-3.93	20.4	25567	49	3	113 - 121	K.GFILDGFPR.T
1455	AT5G63400.1	adenylate kinase 1	other processes	g) other metabolic pathways	mitochondria	369	537.62	1609.83	537.62	1609.83	3	-2.85	17.5	16386	37	3	179 - 193	K.TPGVDDITGEPLIQR.K
1455	AT5G63400.1	adenylate kinase 1	other processes	g) other metabolic pathways	mitochondria	391	543.32	1084.62	543.32	1084.63	2	-4.76	18	26084	49	3	36 - 46	R.LIFIGPPGSGK.G
1455	AT5G63400.1	adenylate kinase 1	other processes	g) other metabolic pathways	mitochondria	387	543.32	1084.62	543.32	1084.63	2	-4.37	17.9	9153	55	3	36 - 46	R.LIFIGPPGSGK.G
1455	AT5G63400.1	adenylate kinase 1	other processes	g) other metabolic pathways	mitochondria	30	405.89	1214.65	405.89	1214.65	3	-3.50	9.6	6266	58	2	233 - 243	K.APQEVTSEVKK.A
1455	AT5G63400.1	adenylate kinase 1	other processes	g) other metabolic pathways	mitochondria	32	405.89	1214.65	405.89	1214.65	3	-3.50	9.6	20971	52	2	233 - 243	K.APQEVTSEVKK.A
1455	AT5G63400.1	adenylate kinase 1	other processes	g) other metabolic pathways	mitochondria	191	543.81	1085.60	543.81	1085.61	2	-10.47	13.5	326345	46	2	223 - 232	K.AVLTNIQAEK.A
1455	AT5G63400.1	adenylate kinase 1	other processes	g) other metabolic pathways	mitochondria	102	445.22	888.42	445.22	888.42	2	-0.84	11.4	23444	27	1	195 - 202	K.DDNADVLK.S
1455	AT5G63400.1	adenylate kinase 1	other processes	g) other metabolic pathways	mitochondria	201	507.93	1520.77	507.93	1520.78	3	-5.73	13.7	7467	47	2	122 - 134	R.TVTQAEKLDEMLK.R	Oxidation: 11
1455	AT5G63400.1	adenylate kinase 1	other processes	g) other metabolic pathways	mitochondria	364	805.92	1609.83	805.92	1609.83	2	-2.88	17.4	40898	83	3	179 - 193	K.TPGVDDITGEPLIQR.K
1455	AT5G63400.1	adenylate kinase 1	other processes	g) other metabolic pathways	mitochondria	367	805.92	1609.83	805.92	1609.83	2	-2.84	17.4	47844	44	3	179 - 193	K.TPGVDDITGEPLIQR.K
1455	AT5G63400.1	adenylate kinase 1	other processes	g) other metabolic pathways	mitochondria	384	717.72	2150.13	717.72	2150.14	3	-2.66	17.8	3759	15	1	174 - 193	K.FAPPKTPGVDDITGEPLIQR.K
1455	AT5G63400.1	adenylate kinase 1	other processes	g) other metabolic pathways	mitochondria	366	537.62	1609.83	537.62	1609.83	3	-2.88	17.4	4925	59	3	179 - 193	K.TPGVDDITGEPLIQR.K
1455	AT5G63400.1	adenylate kinase 1	other processes	g) other metabolic pathways	mitochondria	546	539.95	1616.84	539.95	1616.84	3	-3.54	21.6	6756	22	2	143 - 156	K.VLNFAIDDAILEER.I
1455	AT5G63400.1	adenylate kinase 1	other processes	g) other metabolic pathways	mitochondria	190	543.81	1085.60	543.81	1085.61	2	-5.87	13.4	20217	65	2	223 - 232	K.AVLTNIQAEK.A
1455	AT5G63400.1	adenylate kinase 1	other processes	g) other metabolic pathways	mitochondria	543	539.95	1616.83	539.95	1616.84	3	-4.47	21.5	38939	62	2	143 - 156	K.VLNFAIDDAILEER.I
1455	AT5G63400.1	adenylate kinase 1	other processes	g) other metabolic pathways	mitochondria	362	805.92	1609.83	805.92	1609.83	2	-2.87	17.3	23820	59	3	179 - 193	K.TPGVDDITGEPLIQR.K
1455	AT5G63400.1	adenylate kinase 1	other processes	g) other metabolic pathways	mitochondria	333	651.33	1950.98	651.34	1950.98	3	-2.03	16.6	5729	43	1	205 - 221	R.LAAFHSQTQPVIDYYAK.K
1455	AT5G63400.1	adenylate kinase 1	other processes	g) other metabolic pathways	mitochondria	77	544.28	1086.55	544.29	1086.56	2	-8.36	10.9	10736	58	1	233 - 242	K.APQEVTSEVK.K
1455	AT5G63400.1	adenylate kinase 1	other processes	g) other metabolic pathways	mitochondria	124	607.86	1213.70	607.86	1213.70	2	-4.35	11.9	22713	22	1	222 - 232	K.KAVLTNIQAEK.A
1455	AT5G63400.1	adenylate kinase 1	other processes	g) other metabolic pathways	mitochondria	492	511.27	1020.53	511.28	1020.54	2	-5.34	20.3	23192	48	3	113 - 121	K.GFILDGFPR.T
1455	AT5G63400.1	adenylate kinase 1	other processes	g) other metabolic pathways	mitochondria	588	811.73	2432.17	811.73	2432.17	3	-1.64	22.7	7894	68	1	2 - 24	M.ATGGAAADLEDVQTVDLMSELLR.R	Acetyl: 1
1455	AT5G63400.1	adenylate kinase 1	other processes	g) other metabolic pathways	mitochondria	204	507.93	1520.77	507.93	1520.78	3	-4.51	13.7	16898	20	2	122 - 134	R.TVTQAEKLDEMLK.R	Oxidation: 11
1507	AT5G63400.1	adenylate kinase 1	other processes	g) other metabolic pathways	mitochondria	192	651.32	1950.95	651.34	1950.98	3	-19.07	16.8	5720	36	2	205 - 221	R.LAAFHSQTQPVIDYYAK.K
1507	AT5G63400.1	adenylate kinase 1	other processes	g) other metabolic pathways	mitochondria	252	511.27	1020.52	511.28	1020.54	2	-17.50	20.4	4081	36	4	113 - 121	K.GFILDGFPR.T
1507	AT5G63400.1	adenylate kinase 1	other processes	g) other metabolic pathways	mitochondria	254	511.27	1020.52	511.28	1020.54	2	-19.40	20.5	13480	48	4	113 - 121	K.GFILDGFPR.T
1507	AT5G63400.1	adenylate kinase 1	other processes	g) other metabolic pathways	mitochondria	5	405.88	1214.63	405.89	1214.65	3	-19.81	9.8	16746	59	2	233 - 243	K.APQEVTSEVKK.A
1507	AT5G63400.1	adenylate kinase 1	other processes	g) other metabolic pathways	mitochondria	21	544.27	1086.53	544.29	1086.56	2	-19.64	11	3456	28	1	233 - 242	K.APQEVTSEVK.K
1507	AT5G63400.1	adenylate kinase 1	other processes	g) other metabolic pathways	mitochondria	253	511.27	1020.52	511.28	1020.54	2	-19.91	20.4	7623	41	4	113 - 121	K.GFILDGFPR.T
1507	AT5G63400.1	adenylate kinase 1	other processes	g) other metabolic pathways	mitochondria	195	651.32	1950.95	651.34	1950.98	3	-19.47	16.8	9259	49	2	205 - 221	R.LAAFHSQTQPVIDYYAK.K
1507	AT5G63400.1	adenylate kinase 1	other processes	g) other metabolic pathways	mitochondria	42	607.85	1213.68	607.86	1213.70	2	-18.17	12.1	4268	47	1	222 - 232	K.KAVLTNIQAEK.A
1507	AT5G63400.1	adenylate kinase 1	other processes	g) other metabolic pathways	mitochondria	41	405.57	1213.68	405.57	1213.70	3	-18.16	12.1	10100	39	1	222 - 232	K.KAVLTNIQAEK.A
1507	AT5G63400.1	adenylate kinase 1	other processes	g) other metabolic pathways	mitochondria	255	511.27	1020.52	511.28	1020.54	2	-19.89	20.5	17126	54	4	113 - 121	K.GFILDGFPR.T
1507	AT5G63400.1	adenylate kinase 1	other processes	g) other metabolic pathways	mitochondria	3	405.88	1214.63	405.89	1214.65	3	-18.58	9.7	5657	48	2	233 - 243	K.APQEVTSEVKK.A
1455	AT5G50370.1	adenylate kinase family	other processes	g) other metabolic pathways	mitochondria	492	511.27	1020.53	511.28	1020.54	2	-5.34	20.3	23192	48	3	114 - 122	K.GFILDGFPR.T
1455	AT5G50370.1	adenylate kinase family	other processes	g) other metabolic pathways	mitochondria	498	511.27	1020.54	511.28	1020.54	2	-3.93	20.4	25567	49	3	114 - 122	K.GFILDGFPR.T
1455	AT5G50370.1	adenylate kinase family	other processes	g) other metabolic pathways	mitochondria	355	536.31	1070.60	536.31	1070.61	2	-7.57	17.1	124021	39	2	37 - 47	R.LVFIGPPGSGK.G
1455	AT5G50370.1	adenylate kinase family	other processes	g) other metabolic pathways	mitochondria	79	470.24	938.47	470.24	938.47	2	-4.26	10.9	3759	23	1	162 - 169	R.WIHPSSGR.S
1455	AT5G50370.1	adenylate kinase family	other processes	g) other metabolic pathways	mitochondria	506	810.42	1618.82	810.42	1618.82	2	-2.25	20.6	7467	45	3	144 - 157	K.VLNFAIDDSVLEER.I
1455	AT5G50370.1	adenylate kinase family	other processes	g) other metabolic pathways	mitochondria	350	536.31	1070.60	536.31	1070.61	2	-8.39	17	13891	55	2	37 - 47	R.LVFIGPPGSGK.G
1455	AT5G50370.1	adenylate kinase family	other processes	g) other metabolic pathways	mitochondria	503	810.41	1618.81	810.42	1618.82	2	-3.42	20.5	9296	54	3	144 - 157	K.VLNFAIDDSVLEER.I
1455	AT5G50370.1	adenylate kinase family	other processes	g) other metabolic pathways	mitochondria	495	511.27	1020.53	511.28	1020.54	2	-5.87	20.4	20217	54	3	114 - 122	K.GFILDGFPR.T
1455	AT5G50370.1	adenylate kinase family	other processes	g) other metabolic pathways	mitochondria	501	810.42	1618.82	810.42	1618.82	2	-2.78	20.5	14583	67	3	144 - 157	K.VLNFAIDDSVLEER.I
163	AT1G76200.1	AGGG	complex I	a) oxidative phosphorylation	mitochondria	17	419.74	837.46	419.74	837.47	2	-17.11	9.4	13113	34	3	14 - 21	K.GVTVHTPK.T
163	AT1G76200.1	AGGG	complex I	a) oxidative phosphorylation	mitochondria	16	419.74	837.46	419.74	837.47	2	-17.18	9.4	8165	28	3	14 - 21	K.GVTVHTPK.T
163	AT1G76200.1	AGGG	complex I	a) oxidative phosphorylation	mitochondria	2	425.17	1696.63	425.17	1696.66	4	-17.11	8.2	6425	26	1	55 - 69	R.HPWDGHGDHGHGDHH.-
163	AT1G76200.1	AGGG	complex I	a) oxidative phosphorylation	mitochondria	13	530.75	1059.49	530.76	1059.51	2	-16.76	9.1	4765	51	2	2 - 13	M.GGGGHGGGITYK.G
163	AT1G76200.1	AGGG	complex I	a) oxidative phosphorylation	mitochondria	103	580.77	1159.53	580.78	1159.54	2	-10.88	15.1	4793	20	1	45 - 54	K.QDGPVVMGWR.H	Oxidation: 7
163	AT1G76200.1	AGGG	complex I	a) oxidative phosphorylation	mitochondria	18	419.74	837.46	419.74	837.47	2	-17.66	9.4	15405	26	3	14 - 21	K.GVTVHTPK.T
163	AT1G76200.1	AGGG	complex I	a) oxidative phosphorylation	mitochondria	14	530.75	1059.49	530.76	1059.51	2	-15.18	9.2	10069	47	2	2 - 13	M.GGGGHGGGITYK.G
240	AT1G76200.1	AGGG	complex I	a) oxidative phosphorylation	mitochondria	142	580.77	1159.53	580.78	1159.54	2	-9.97	15.087525	16328	54	1	45 - 54	K.QDGPVVMGWR.H	Oxidation: 7
240	AT1G76200.1	AGGG	complex I	a) oxidative phosphorylation	mitochondria	45	465.24	928.46	465.25	928.48	2	-13.78	10.48523333	4751	27	1	22 - 29	K.TWHTVTGK.G
379	AT1G76200.1	AGGG	complex I	a) oxidative phosphorylation	mitochondria	17	530.76	1059.50	530.76	1059.51	2	-8.36	10.7	8113	22	4	2 - 13	M.GGGGHGGGITYK.G
379	AT1G76200.1	AGGG	complex I	a) oxidative phosphorylation	mitochondria	147	580.78	1159.54	580.78	1159.54	2	-3.77	17	4845	35	2	45 - 54	K.QDGPVVMGWR.H	Oxidation: 7
379	AT1G76200.1	AGGG	complex I	a) oxidative phosphorylation	mitochondria	42	465.24	928.47	465.25	928.48	2	-10.25	12.2	7626	35	1	22 - 29	K.TWHTVTGK.G
379	AT1G76200.1	AGGG	complex I	a) oxidative phosphorylation	mitochondria	19	419.74	837.46	419.74	837.47	2	-10.06	10.8	7290	18	2	14 - 21	K.GVTVHTPK.T
379	AT1G76200.1	AGGG	complex I	a) oxidative phosphorylation	mitochondria	14	530.76	1059.50	530.76	1059.51	2	-6.77	10.6	4054	20	4	2 - 13	M.GGGGHGGGITYK.G
379	AT1G76200.1	AGGG	complex I	a) oxidative phosphorylation	mitochondria	15	530.76	1059.50	530.76	1059.51	2	-9.09	10.6	11093	47	4	2 - 13	M.GGGGHGGGITYK.G
379	AT1G76200.1	AGGG	complex I	a) oxidative phosphorylation	mitochondria	16	530.76	1059.50	530.76	1059.51	2	-8.64	10.7	13175	33	4	2 - 13	M.GGGGHGGGITYK.G
379	AT1G76200.1	AGGG	complex I	a) oxidative phosphorylation	mitochondria	22	419.74	837.46	419.74	837.47	2	-9.13	11	14389	43	2	14 - 21	K.GVTVHTPK.T
379	AT1G76200.1	AGGG	complex I	a) oxidative phosphorylation	mitochondria	149	580.78	1159.54	580.78	1159.54	2	-6.91	17.1	14357	39	2	45 - 54	K.QDGPVVMGWR.H	Oxidation: 7
784	AT2G13360.1	AGT (alanine glyoxylate aminotransferase)	amino acid metabolism	g) other metabolic pathways	peroxisome	213	493.78	985.55	493.79	985.56	2	-7.84	18.6	7648	50	1	287 - 295	R.LAVEAWGLK.N
784	AT2G13360.1	AGT (alanine glyoxylate aminotransferase)	amino acid metabolism	g) other metabolic pathways	peroxisome	216	641.03	1920.06	641.03	1920.07	3	-6.47	18.7	5961	27	1	10 - 26	R.HHLFVPGPVNIPEPVIR.A
784	AT2G13360.1	AGT (alanine glyoxylate aminotransferase)	amino acid metabolism	g) other metabolic pathways	peroxisome	224	596.34	1190.66	596.34	1190.67	2	-5.08	19.3	3419	52	1	330 - 340	R.YNLSLGLGLNK.V
784	AT2G13360.1	AGT (alanine glyoxylate aminotransferase)	amino acid metabolism	g) other metabolic pathways	peroxisome	71	473.28	944.55	473.28	944.55	2	-9.09	13.2	5839	20	1	46 - 53	K.TLLEDVKK.I
884	AT2G13360.1	AGT (alanine glyoxylate aminotransferase)	amino acid metabolism	g) other metabolic pathways	peroxisome	191	481.02	1920.05	481.03	1920.07	4	-12.02	18.4	3789	28	1	10 - 26	R.HHLFVPGPVNIPEPVIR.A
884	AT2G13360.1	AGT (alanine glyoxylate aminotransferase)	amino acid metabolism	g) other metabolic pathways	peroxisome	49	473.28	944.54	473.28	944.55	2	-13.90	13	6241	23	3	46 - 53	K.TLLEDVKK.I
884	AT2G13360.1	AGT (alanine glyoxylate aminotransferase)	amino acid metabolism	g) other metabolic pathways	peroxisome	202	596.33	1190.65	596.34	1190.67	2	-12.72	19	3708	19	1	330 - 340	R.YNLSLGLGLNK.V
884	AT2G13360.1	AGT (alanine glyoxylate aminotransferase)	amino acid metabolism	g) other metabolic pathways	peroxisome	192	493.78	985.54	493.79	985.56	2	-19.46	18.4	3774	57	3	287 - 295	R.LAVEAWGLK.N
884	AT2G13360.1	AGT (alanine glyoxylate aminotransferase)	amino acid metabolism	g) other metabolic pathways	peroxisome	113	449.27	896.52	449.27	896.53	2	-13.08	15.1	7449	29	3	37 - 45	R.SPAIPALTK.T
884	AT2G13360.1	AGT (alanine glyoxylate aminotransferase)	amino acid metabolism	g) other metabolic pathways	peroxisome	48	473.28	944.54	473.28	944.55	2	-13.31	13	4307	16	3	46 - 53	K.TLLEDVKK.I
884	AT2G13360.1	AGT (alanine glyoxylate aminotransferase)	amino acid metabolism	g) other metabolic pathways	peroxisome	107	449.27	896.52	449.27	896.53	2	-12.94	15	5035	25	3	37 - 45	R.SPAIPALTK.T
884	AT2G13360.1	AGT (alanine glyoxylate aminotransferase)	amino acid metabolism	g) other metabolic pathways	peroxisome	193	493.78	985.55	493.79	985.56	2	-13.31	18.4	12661	58	3	287 - 295	R.LAVEAWGLK.N
884	AT2G13360.1	AGT (alanine glyoxylate aminotransferase)	amino acid metabolism	g) other metabolic pathways	peroxisome	189	641.02	1920.05	641.03	1920.07	3	-14.38	18.3	2878	42	1	10 - 26	R.HHLFVPGPVNIPEPVIR.A
884	AT2G13360.1	AGT (alanine glyoxylate aminotransferase)	amino acid metabolism	g) other metabolic pathways	peroxisome	194	493.78	985.55	493.79	985.56	2	-13.97	18.5	10475	56	3	287 - 295	R.LAVEAWGLK.N
884	AT2G13360.1	AGT (alanine glyoxylate aminotransferase)	amino acid metabolism	g) other metabolic pathways	peroxisome	50	473.28	944.54	473.28	944.55	2	-12.80	13	6657	31	3	46 - 53	K.TLLEDVKK.I
884	AT2G13360.1	AGT (alanine glyoxylate aminotransferase)	amino acid metabolism	g) other metabolic pathways	peroxisome	110	449.27	896.52	449.27	896.53	2	-13.41	15.1	6971	16	3	37 - 45	R.SPAIPALTK.T
937	AT2G13360.1	AGT (alanine glyoxylate aminotransferase)	amino acid metabolism	g) other metabolic pathways	peroxisome	222	493.79	985.57	493.79	985.56	2	7.66	18.9	23030	63	3	287 - 295	R.LAVEAWGLK.N
937	AT2G13360.1	AGT (alanine glyoxylate aminotransferase)	amino acid metabolism	g) other metabolic pathways	peroxisome	124	449.28	896.54	449.27	896.53	2	7.13	15.5	6076	27	3	37 - 45	R.SPAIPALTK.T
937	AT2G13360.1	AGT (alanine glyoxylate aminotransferase)	amino acid metabolism	g) other metabolic pathways	peroxisome	219	493.79	985.57	493.79	985.56	2	7.07	18.8	21987	56	3	287 - 295	R.LAVEAWGLK.N
937	AT2G13360.1	AGT (alanine glyoxylate aminotransferase)	amino acid metabolism	g) other metabolic pathways	peroxisome	252	673.83	1345.65	673.82	1345.63	2	9.22	23.1	6414	40	4	230 - 239	K.VFFDWNDYLK.F
937	AT2G13360.1	AGT (alanine glyoxylate aminotransferase)	amino acid metabolism	g) other metabolic pathways	peroxisome	249	673.83	1345.65	673.82	1345.63	2	13.98	23	4123	36	4	230 - 239	K.VFFDWNDYLK.F
937	AT2G13360.1	AGT (alanine glyoxylate aminotransferase)	amino acid metabolism	g) other metabolic pathways	peroxisome	240	792.45	1582.89	792.44	1582.88	2	10.61	20.6	10191	65	3	202 - 217	K.ALSLPTGLGIVCASPK.A	Carbamidomethyl: 12
937	AT2G13360.1	AGT (alanine glyoxylate aminotransferase)	amino acid metabolism	g) other metabolic pathways	peroxisome	221	481.03	1920.09	481.03	1920.07	4	9.02	18.9	7056	45	2	10 - 26	R.HHLFVPGPVNIPEPVIR.A
937	AT2G13360.1	AGT (alanine glyoxylate aminotransferase)	amino acid metabolism	g) other metabolic pathways	peroxisome	223	493.79	985.57	493.79	985.56	2	9.40	18.9	12421	69	3	287 - 295	R.LAVEAWGLK.N
937	AT2G13360.1	AGT (alanine glyoxylate aminotransferase)	amino acid metabolism	g) other metabolic pathways	peroxisome	226	596.35	1190.68	596.34	1190.67	2	11.67	19.4	5888	35	2	330 - 340	R.YNLSLGLGLNK.V
937	AT2G13360.1	AGT (alanine glyoxylate aminotransferase)	amino acid metabolism	g) other metabolic pathways	peroxisome	239	792.45	1582.89	792.44	1582.88	2	11.27	20.6	5447	46	3	202 - 217	K.ALSLPTGLGIVCASPK.A	Carbamidomethyl: 12
937	AT2G13360.1	AGT (alanine glyoxylate aminotransferase)	amino acid metabolism	g) other metabolic pathways	peroxisome	218	481.03	1920.09	481.03	1920.07	4	10.87	18.8	3423	52	2	10 - 26	R.HHLFVPGPVNIPEPVIR.A
937	AT2G13360.1	AGT (alanine glyoxylate aminotransferase)	amino acid metabolism	g) other metabolic pathways	peroxisome	50	473.29	944.56	473.28	944.55	2	10.44	13.5	14041	46	1	46 - 53	K.TLLEDVKK.I
937	AT2G13360.1	AGT (alanine glyoxylate aminotransferase)	amino acid metabolism	g) other metabolic pathways	peroxisome	126	449.28	896.54	449.27	896.53	2	10.47	15.6	15855	45	3	37 - 45	R.SPAIPALTK.T
937	AT2G13360.1	AGT (alanine glyoxylate aminotransferase)	amino acid metabolism	g) other metabolic pathways	peroxisome	251	673.83	1345.65	673.82	1345.63	2	10.24	23	9089	49	4	230 - 239	K.VFFDWNDYLK.F
937	AT2G13360.1	AGT (alanine glyoxylate aminotransferase)	amino acid metabolism	g) other metabolic pathways	peroxisome	250	673.83	1345.65	673.82	1345.63	2	12.03	23	6421	41	4	230 - 239	K.VFFDWNDYLK.F
937	AT2G13360.1	AGT (alanine glyoxylate aminotransferase)	amino acid metabolism	g) other metabolic pathways	peroxisome	220	641.04	1920.09	641.03	1920.07	3	9.02	18.8	7982	47	2	10 - 26	R.HHLFVPGPVNIPEPVIR.A
937	AT2G13360.1	AGT (alanine glyoxylate aminotransferase)	amino acid metabolism	g) other metabolic pathways	peroxisome	125	449.28	896.54	449.27	896.53	2	8.05	15.5	12477	38	3	37 - 45	R.SPAIPALTK.T
937	AT2G13360.1	AGT (alanine glyoxylate aminotransferase)	amino acid metabolism	g) other metabolic pathways	peroxisome	164	747.72	2240.15	747.71	2240.12	3	11.00	17	3175	102	2	140 - 160	K.AICIVHNETATGVTNDISAVR.T	Carbamidomethyl: 3
937	AT2G13360.1	AGT (alanine glyoxylate aminotransferase)	amino acid metabolism	g) other metabolic pathways	peroxisome	241	792.45	1582.89	792.44	1582.88	2	10.30	20.7	12137	72	3	202 - 217	K.ALSLPTGLGIVCASPK.A	Carbamidomethyl: 12
937	AT2G13360.1	AGT (alanine glyoxylate aminotransferase)	amino acid metabolism	g) other metabolic pathways	peroxisome	165	747.72	2240.15	747.71	2240.12	3	10.58	17.1	8561	50	2	140 - 160	K.AICIVHNETATGVTNDISAVR.T	Carbamidomethyl: 3
937	AT2G13360.1	AGT (alanine glyoxylate aminotransferase)	amino acid metabolism	g) other metabolic pathways	peroxisome	228	596.35	1190.68	596.34	1190.67	2	12.73	19.5	8496	33	2	330 - 340	R.YNLSLGLGLNK.V
937	AT2G13360.1	AGT (alanine glyoxylate aminotransferase)	amino acid metabolism	g) other metabolic pathways	peroxisome	217	641.04	1920.09	641.03	1920.07	3	10.88	18.8	4704	44	2	10 - 26	R.HHLFVPGPVNIPEPVIR.A
882	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	22	486.55	1456.64	486.56	1456.66	3	-12.69	10.8	4518	24	2	238 - 250	K.DVHDHIEYGTSGK.V
882	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	300	699.86	1397.71	699.87	1397.72	2	-11.03	18.5	4828	63	4	176 - 187	R.LYTGSLEMISLR.N	Oxidation: 8
882	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	282	875.91	1749.80	875.91	1749.81	2	-7.21	18	3746	73	1	282 - 298	R.NAGGVCIADEVQTGFGR.T	Carbamidomethyl: 6
882	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	65	478.75	955.49	478.76	955.50	2	-10.98	12.4	4433	29	1	442 - 450	K.GGLHGNVFR.I
882	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	344	832.73	2495.16	832.73	2495.18	3	-9.42	20	6236	50	1	299 - 320	R.TGSHYWGFQTQDVVPDIVTMAK.G	Oxidation: 20
882	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	348	691.86	1381.71	691.87	1381.73	2	-10.05	20.1	7543	87	3	176 - 187	R.LYTGSLEMISLR.N
882	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	311	646.84	1291.66	646.85	1291.68	2	-12.78	19.1	14458	50	2	423 - 433	K.AETSVLFEQLR.E
882	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	229	600.79	1199.57	600.80	1199.58	2	-12.82	16.5	8615	51	3	226 - 237	R.GVFGSDGSLYAK.D
882	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	228	600.79	1199.57	600.80	1199.58	2	-11.51	16.5	17955	55	3	226 - 237	R.GVFGSDGSLYAK.D
882	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	346	691.86	1381.71	691.87	1381.73	2	-12.06	20.1	5279	69	3	176 - 187	R.LYTGSLEMISLR.N
882	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	120	473.22	1416.63	473.22	1416.65	3	-14.17	13.9	9616	32	2	86 - 96	K.MQYLYDESGRR.Y
882	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	314	646.84	1291.66	646.85	1291.68	2	-12.02	19.1	18531	61	2	423 - 433	K.AETSVLFEQLR.E
882	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	299	699.86	1397.70	699.87	1397.72	2	-12.53	18.5	4957	103	4	176 - 187	R.LYTGSLEMISLR.N	Oxidation: 8
882	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	298	699.86	1397.71	699.87	1397.72	2	-10.71	18.5	5083	92	4	176 - 187	R.LYTGSLEMISLR.N	Oxidation: 8
882	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	118	473.22	1416.63	473.22	1416.65	3	-10.45	13.8	7005	34	2	86 - 96	K.MQYLYDESGRR.Y
882	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	82	462.74	923.47	462.75	923.48	2	-14.69	12.8	15959	34	1	394 - 401	R.HDIIGDVR.G
882	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	160	433.24	864.46	433.24	864.47	2	-8.00	14.8	18526	17	2	275 - 281	K.SVYEIVR.N
882	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	232	600.79	1199.57	600.80	1199.58	2	-11.36	16.6	5062	73	3	226 - 237	R.GVFGSDGSLYAK.D
882	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	297	699.86	1397.70	699.87	1397.72	2	-14.02	18.4	6176	41	4	176 - 187	R.LYTGSLEMISLR.N	Oxidation: 8
882	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	25	486.55	1456.64	486.56	1456.66	3	-11.06	10.9	4976	22	2	238 - 250	K.DVHDHIEYGTSGK.V
882	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	350	691.86	1381.71	691.87	1381.73	2	-11.45	20.2	5983	55	3	176 - 187	R.LYTGSLEMISLR.N
882	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	162	433.24	864.46	433.24	864.47	2	-10.81	14.9	4021	24	2	275 - 281	K.SVYEIVR.N
882	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	73	478.55	1432.62	478.55	1432.64	3	-12.21	12.5	12195	38	2	86 - 96	K.MQYLYDESGRR.Y	Oxidation: 1
882	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	74	478.55	1432.63	478.55	1432.64	3	-10.50	12.6	6004	29	2	86 - 96	K.MQYLYDESGRR.Y	Oxidation: 1
1334	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	382	756.34	2266.01	756.34	2266.01	3	-0.17	17.6	7418	48	2	156 - 175	K.VVYFVNSGSEANELAMMMAR.L	Oxidation: 16
1334	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	418	699.86	1397.71	699.87	1397.72	2	-7.69	18.4	9477	88	2	176 - 187	R.LYTGSLEMISLR.N	Oxidation: 8
1334	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	422	466.91	1397.71	466.91	1397.72	3	-6.94	18.5	4880	43	1	176 - 187	R.LYTGSLEMISLR.N	Oxidation: 8
1334	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	144	478.75	955.49	478.76	955.50	2	-6.26	12.2	133071	31	1	442 - 450	K.GGLHGNVFR.I
1334	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	84	455.73	1818.87	455.73	1818.89	4	-9.36	10.9	32425	26	1	372 - 386	K.RQEHCAEVGSHLIQR.L	Carbamidomethyl: 5
1334	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	151	478.55	1432.63	478.55	1432.64	3	-5.86	12.4	4118	39	2	86 - 96	K.MQYLYDESGRR.Y	Oxidation: 1
1334	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	156	478.55	1432.63	478.55	1432.64	3	-6.78	12.5	23388	27	2	86 - 96	K.MQYLYDESGRR.Y	Oxidation: 1
1334	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	353	828.51	827.50	828.52	827.51	1	-12.20	17	6951	41	2	434 - 441	R.ELGILVGK.G
1334	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	120	416.70	1662.79	416.70	1662.79	4	-2.22	11.7	10299	44	1	373 - 386	R.QEHCAEVGSHLIQR.L	Carbamidomethyl: 4
1334	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	549	1133.13	2264.25	1132.65	2263.28	2	428.76	23.7	7079	47	4	321 - 344	K.GIGNGLPLGAVVTTPEIASVLASK.I
1334	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	81	486.56	1456.65	486.56	1456.66	3	-4.22	10.8	34445	30	3	238 - 250	K.DVHDHIEYGTSGK.V
1334	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	254	433.24	864.46	433.24	864.47	2	-7.84	14.7	54275	22	3	275 - 281	K.SVYEIVR.N
1334	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	550	755.76	2264.25	755.43	2263.28	3	428.57	23.7	18251	27	1	321 - 344	K.GIGNGLPLGAVVTTPEIASVLASK.I
1334	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	548	1133.13	2264.25	1132.65	2263.28	2	429.49	23.6	22681	21	4	321 - 344	K.GIGNGLPLGAVVTTPEIASVLASK.I
1334	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	405	875.91	1749.80	875.91	1749.81	2	-3.18	18.1	5663	29	2	282 - 298	R.NAGGVCIADEVQTGFGR.T	Carbamidomethyl: 6
1334	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	290	533.52	2130.05	533.52	2130.06	4	-6.21	15.5	15659	25	2	208 - 225	K.YPLPQGEIHHVVNPDPYR.G
1334	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	543	1132.64	2263.26	1132.65	2263.28	2	-7.11	23.3	6759	43	4	321 - 344	K.GIGNGLPLGAVVTTPEIASVLASK.I
1334	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	421	699.86	1397.71	699.87	1397.72	2	-6.95	18.5	25128	93	2	176 - 187	R.LYTGSLEMISLR.N	Oxidation: 8
1334	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	352	414.76	827.50	414.76	827.51	2	-12.18	16.9	3482	45	2	434 - 441	R.ELGILVGK.G
1334	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	258	433.24	864.46	433.24	864.47	2	-8.28	14.8	72772	25	3	275 - 281	K.SVYEIVR.N
1334	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	334	600.79	1199.57	600.80	1199.58	2	-8.04	16.5	4616	51	2	226 - 237	R.GVFGSDGSLYAK.D
1334	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	452	646.84	1291.67	646.85	1291.68	2	-9.17	19.2	5700	63	2	423 - 433	K.AETSVLFEQLR.E
1334	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	210	473.22	1416.64	473.22	1416.65	3	-2.74	13.7	20513	33	1	86 - 96	K.MQYLYDESGRR.Y
1334	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	448	646.84	1291.67	646.85	1291.68	2	-8.70	19.1	158953	59	2	423 - 433	K.AETSVLFEQLR.E
1334	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	85	729.33	1456.65	729.34	1456.66	2	-5.83	10.9	9003	16	1	238 - 250	K.DVHDHIEYGTSGK.V
1334	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	86	486.56	1456.65	486.56	1456.66	3	-5.58	11	6791	22	3	238 - 250	K.DVHDHIEYGTSGK.V
1334	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	252	433.24	864.47	433.24	864.47	2	-3.73	14.7	30467	15	3	275 - 281	K.SVYEIVR.N
1334	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	83	486.56	1456.65	486.56	1456.66	3	-5.82	10.9	7073	39	3	238 - 250	K.DVHDHIEYGTSGK.V
1334	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	164	462.74	923.47	462.75	923.48	2	-10.73	12.7	100734	29	1	394 - 401	R.HDIIGDVR.G
1334	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	286	533.52	2130.05	533.52	2130.06	4	-6.66	15.4	5574	18	2	208 - 225	K.YPLPQGEIHHVVNPDPYR.G
1334	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	402	875.91	1749.81	875.91	1749.81	2	-1.10	18	6308	87	2	282 - 298	R.NAGGVCIADEVQTGFGR.T	Carbamidomethyl: 6
1334	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	414	702.35	2104.02	702.35	2104.03	3	-7.92	18.3	17125	46	1	188 - 207	R.NAYHGGSSNTIGLTALNTWK.Y
1334	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	350	828.51	827.50	828.52	827.51	1	-11.41	16.9	5452	31	2	434 - 441	R.ELGILVGK.G
1334	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	545	1132.64	2263.26	1132.65	2263.28	2	-6.48	23.3	9764	18	4	321 - 344	K.GIGNGLPLGAVVTTPEIASVLASK.I
1334	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	386	756.34	2266.00	756.34	2266.01	3	-2.15	17.7	34445	35	2	156 - 175	K.VVYFVNSGSEANELAMMMAR.L	Oxidation: 16
1334	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	349	414.76	827.50	414.76	827.51	2	-11.39	16.9	6982	39	2	434 - 441	R.ELGILVGK.G
1334	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	339	600.79	1199.57	600.80	1199.58	2	-7.71	16.6	13985	36	2	226 - 237	R.GVFGSDGSLYAK.D
1389	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	385	699.87	1397.72	699.87	1397.72	2	-1.05	18.6	5630	88	2	176 - 187	R.LYTGSLEMISLR.N	Oxidation: 8
1389	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	450	691.87	1381.72	691.87	1381.73	2	-5.88	20.2	17083	24	2	176 - 187	R.LYTGSLEMISLR.N
1389	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	267	533.52	2130.06	533.52	2130.06	4	-2.84	15.5	26297	17	2	208 - 225	K.YPLPQGEIHHVVNPDPYR.G
1389	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	327	828.51	827.50	828.52	827.51	1	-8.30	17.1	6691	16	2	434 - 441	R.ELGILVGK.G
1389	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	154	462.75	923.48	462.75	923.48	2	-6.13	13	16996	41	1	394 - 401	R.HDIIGDVR.G
1389	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	370	875.91	1749.81	875.91	1749.81	2	1.08	18.2	8796	53	1	282 - 298	R.NAGGVCIADEVQTGFGR.T	Carbamidomethyl: 6
1389	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	448	691.87	1381.72	691.87	1381.73	2	-3.61	20.2	14773	46	2	176 - 187	R.LYTGSLEMISLR.N
1389	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	141	478.55	1432.64	478.55	1432.64	3	0.35	12.7	9433	32	2	86 - 96	K.MQYLYDESGRR.Y	Oxidation: 1
1389	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	323	414.76	827.51	414.76	827.51	2	-4.54	17	11877	23	2	434 - 441	R.ELGILVGK.G
1389	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	245	433.24	864.47	433.24	864.47	2	-5.74	15	42895	20	2	275 - 281	K.SVYEIVR.N
1389	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	388	699.87	1397.72	699.87	1397.72	2	-2.22	18.6	7865	82	2	176 - 187	R.LYTGSLEMISLR.N	Oxidation: 8
1389	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	381	702.35	2104.03	702.35	2104.03	3	-3.72	18.4	11107	26	1	188 - 207	R.NAYHGGSSNTIGLTALNTWK.Y
1389	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	78	486.56	1456.65	486.56	1456.66	3	-2.47	11.3	6466	21	2	238 - 250	K.DVHDHIEYGTSGK.V
1389	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	136	478.76	955.50	478.76	955.50	2	-3.02	12.5	4974	22	1	442 - 450	K.GGLHGNVFR.I
1389	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	309	600.80	1199.58	600.80	1199.58	2	-2.42	16.7	33302	63	2	226 - 237	R.GVFGSDGSLYAK.D
1389	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	145	478.55	1432.64	478.55	1432.64	3	-2.91	12.8	17083	38	2	86 - 96	K.MQYLYDESGRR.Y	Oxidation: 1
1389	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	354	756.35	2266.01	756.34	2266.01	3	2.95	17.7	23090	21	1	156 - 175	K.VVYFVNSGSEANELAMMMAR.L	Oxidation: 16
1389	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	305	600.80	1199.58	600.80	1199.58	2	-1.69	16.6	53779	48	2	226 - 237	R.GVFGSDGSLYAK.D
1389	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	413	646.84	1291.67	646.85	1291.68	2	-3.75	19.3	11159	68	2	423 - 433	K.AETSVLFEQLR.E
1389	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	270	533.52	2130.06	533.52	2130.06	4	-1.11	15.6	21900	26	2	208 - 225	K.YPLPQGEIHHVVNPDPYR.G
1389	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	410	646.84	1291.67	646.85	1291.68	2	-3.78	19.2	6593	65	2	423 - 433	K.AETSVLFEQLR.E
1389	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	324	828.52	827.51	828.52	827.51	1	-4.54	17	10783	33	2	434 - 441	R.ELGILVGK.G
1389	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	77	455.73	1818.88	455.73	1818.89	4	-5.32	11.2	3580	23	1	372 - 386	K.RQEHCAEVGSHLIQR.L	Carbamidomethyl: 5
1389	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	325	414.76	827.50	414.76	827.51	2	-8.30	17.1	7830	20	2	434 - 441	R.ELGILVGK.G
1389	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	76	486.56	1456.66	486.56	1456.66	3	2.85	11.2	11107	35	2	238 - 250	K.DVHDHIEYGTSGK.V
1389	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	241	433.24	864.47	433.24	864.47	2	-4.47	14.9	12859	19	2	275 - 281	K.SVYEIVR.N
1445	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	455	691.87	1381.72	691.87	1381.73	2	-4.59	20	21743	18	2	176 - 187	R.LYTGSLEMISLR.N
1445	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	138	462.74	923.47	462.75	923.48	2	-8.29	12.7	3343	32	1	394 - 401	R.HDIIGDVR.G
1445	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	124	478.55	1432.64	478.55	1432.64	3	0.14	12.4	18850	39	2	86 - 96	K.MQYLYDESGRR.Y	Oxidation: 1
1445	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	411	646.84	1291.67	646.85	1291.68	2	-4.66	19	26711	67	2	423 - 433	K.AETSVLFEQLR.E
1445	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	222	433.24	864.47	433.24	864.47	2	-0.59	14.6	9809	16	2	275 - 281	K.SVYEIVR.N
1445	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	527	1133.14	2264.26	1132.65	2263.28	2	431.71	23.6	9809	28	2	321 - 344	K.GIGNGLPLGAVVTTPEIASVLASK.I
1445	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	225	433.24	864.47	433.24	864.47	2	-3.01	14.7	7486	19	2	275 - 281	K.SVYEIVR.N
1445	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	383	699.87	1397.72	699.87	1397.72	2	-2.96	18.3	6205	83	2	176 - 187	R.LYTGSLEMISLR.N	Oxidation: 8
1445	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	58	486.56	1456.66	486.56	1456.66	3	2.83	10.8	15338	33	2	238 - 250	K.DVHDHIEYGTSGK.V
1445	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	303	600.80	1199.58	600.80	1199.58	2	-2.72	16.4	10349	44	2	226 - 237	R.GVFGSDGSLYAK.D
1445	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	524	755.76	2264.26	755.43	2263.28	3	431.85	23.6	3988	18	2	321 - 344	K.GIGNGLPLGAVVTTPEIASVLASK.I
1445	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	453	691.87	1381.72	691.87	1381.73	2	-5.57	20	7063	37	2	176 - 187	R.LYTGSLEMISLR.N
1445	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	526	755.76	2264.26	755.43	2263.28	3	431.52	23.6	17744	44	2	321 - 344	K.GIGNGLPLGAVVTTPEIASVLASK.I
1445	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	319	828.51	827.51	828.52	827.51	1	-5.53	16.8	18536	20	1	434 - 441	R.ELGILVGK.G
1445	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	61	486.56	1456.67	486.56	1456.66	3	5.73	10.9	56929	26	2	238 - 250	K.DVHDHIEYGTSGK.V
1445	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	413	646.84	1291.67	646.85	1291.68	2	-5.79	19	4165	51	2	423 - 433	K.AETSVLFEQLR.E
1445	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	386	699.87	1397.72	699.87	1397.72	2	-2.96	18.4	9540	58	2	176 - 187	R.LYTGSLEMISLR.N	Oxidation: 8
1445	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	349	756.34	2266.00	756.34	2266.01	3	-0.97	17.5	29372	58	1	156 - 175	K.VVYFVNSGSEANELAMMMAR.L	Oxidation: 16
1445	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	255	533.52	2130.06	533.52	2130.06	4	-2.41	15.3	9484	26	1	208 - 225	K.YPLPQGEIHHVVNPDPYR.G
1445	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	367	875.91	1749.81	875.91	1749.81	2	2.11	18	21450	28	1	282 - 298	R.NAGGVCIADEVQTGFGR.T	Carbamidomethyl: 6
1445	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	525	1133.14	2264.26	1132.65	2263.28	2	432.04	23.6	4355	23	2	321 - 344	K.GIGNGLPLGAVVTTPEIASVLASK.I
1445	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	299	600.80	1199.58	600.80	1199.58	2	-2.12	16.3	5442	64	2	226 - 237	R.GVFGSDGSLYAK.D
1445	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	128	478.55	1432.64	478.55	1432.64	3	-0.22	12.5	6022	21	2	86 - 96	K.MQYLYDESGRR.Y	Oxidation: 1
1445	AT4G39660.1	AGT2 (alanine-glyoxylate aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	450	832.73	2495.18	832.73	2495.18	3	1.39	19.9	18460	23	1	299 - 320	R.TGSHYWGFQTQDVVPDIVTMAK.G	Oxidation: 20
253	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	233	729.69	2186.06	729.70	2186.08	3	-8.95	16.54675	5264	29	1	472 - 491	K.LKDFVSAMESSSTIQSEIAK.L	Oxidation: 8
253	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	105	506.24	1010.47	506.25	1010.49	2	-13.30	12.44658333	13271	41	2	366 - 373	K.FAQTLMER.G	Oxidation: 6
253	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	133	436.21	870.40	436.21	870.41	2	-10.64	13.42981667	7289	56	1	449 - 455	K.VAEYFDK.A
253	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	179	546.31	1090.60	546.31	1090.61	2	-9.74	14.8543	17893	87	2	226 - 236	K.LIVAGASAYAR.L
253	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	117	669.33	1336.65	669.34	1336.66	2	-9.60	12.863825	11145	46	1	354 - 365	K.AYQEQVLSNSAK.F
253	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	103	506.24	1010.47	506.25	1010.49	2	-11.92	12.37935833	4866	53	2	366 - 373	K.FAQTLMER.G	Oxidation: 6
253	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	182	546.31	1090.60	546.31	1090.61	2	-7.91	14.94830833	16206	52	2	226 - 236	K.LIVAGASAYAR.L
253	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	62	475.24	948.46	475.24	948.47	2	-13.49	10.99429167	8138	31	2	431 - 439	R.MGTPALTSR.G	Oxidation: 1
253	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	66	475.24	948.46	475.24	948.47	2	-14.33	11.10168333	15004	34	2	431 - 439	R.MGTPALTSR.G	Oxidation: 1
253	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	173	498.25	994.48	498.25	994.49	2	-10.59	14.66626667	5741	41	1	366 - 373	K.FAQTLMER.G
253	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	217	521.25	1040.48	521.25	1040.48	2	-2.52	16.063175	12970	31	1	440 - 448	R.GFVEEDFAK.V
253	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	273	751.74	2252.19	751.75	2252.22	3	-10.51	17.78239167	7836	18	1	374 - 394	R.GYELVSGGTDNHLVLVNLKPK.G
253	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	112	400.69	799.37	400.70	799.39	2	-14.48	12.70258333	4606	26	1	237 - 242	R.LYDYAR.I
253	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	272	564.06	2252.19	564.06	2252.22	4	-10.45	17.76900833	11619	37	1	374 - 394	R.GYELVSGGTDNHLVLVNLKPK.G
712	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	150	400.70	799.39	400.70	799.39	2	1.66	13.2	121000	20	2	237 - 242	R.LYDYAR.I
712	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	95	475.24	948.47	475.24	948.47	2	-1.60	11.3	16185	47	2	431 - 439	R.MGTPALTSR.G	Oxidation: 1
712	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	127	460.27	918.52	460.27	918.53	2	-5.14	12.4	79919	32	1	218 - 225	K.SATLFRPK.L
712	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	149	400.70	799.39	400.70	799.39	2	-0.61	13.1	9702	18	2	237 - 242	R.LYDYAR.I
712	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	92	475.24	948.47	475.24	948.47	2	-1.72	11.3	8693	74	2	431 - 439	R.MGTPALTSR.G	Oxidation: 1
712	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	433	801.41	2401.22	801.41	2401.20	3	6.36	22.2	41861	23	1	50 - 70	K.QLNAPLEEVDPEIADIIEHEK.A
712	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	154	669.34	1336.67	669.34	1336.66	2	2.64	13.3	83740	40	1	354 - 365	K.AYQEQVLSNSAK.F
712	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	134	506.25	1010.49	506.25	1010.49	2	-0.03	12.6	5160	39	1	366 - 373	K.FAQTLMER.G	Oxidation: 6
712	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	306	751.75	2252.22	751.75	2252.22	3	2.66	18	51708	16	1	374 - 394	R.GYELVSGGTDNHLVLVNLKPK.G
712	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	216	546.32	1090.62	546.31	1090.61	2	2.21	15.2	79631	50	1	226 - 236	K.LIVAGASAYAR.L
781	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	105	506.24	1010.47	506.25	1010.49	2	-12.33	12.6	8285	28	1	366 - 373	K.FAQTLMER.G	Oxidation: 6
781	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	189	546.31	1090.60	546.31	1090.61	2	-7.95	15.3	20936	56	1	226 - 236	K.LIVAGASAYAR.L
781	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	80	419.89	1256.64	419.89	1256.65	3	-12.56	11.6	2190	37	1	492 - 501	K.LRHEVEEFAK.Q
781	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	82	500.23	998.44	500.23	998.45	2	-9.25	11.7	4039	38	1	102 - 110	K.YSEGYPGAR.Y
781	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	68	475.24	948.46	475.24	948.47	2	-8.35	11.3	6177	32	2	431 - 439	R.MGTPALTSR.G	Oxidation: 1
781	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	119	669.33	1336.65	669.34	1336.66	2	-5.58	13	6803	55	1	354 - 365	K.AYQEQVLSNSAK.F
781	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	71	475.24	948.46	475.24	948.47	2	-9.62	11.4	34115	24	2	431 - 439	R.MGTPALTSR.G	Oxidation: 1
781	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	114	400.70	799.38	400.70	799.39	2	-9.79	12.9	2985	28	1	237 - 242	R.LYDYAR.I
781	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	97	460.27	918.52	460.27	918.53	2	-10.79	12.3	2357	23	1	218 - 225	K.SATLFRPK.L
878	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	74	500.23	998.44	500.23	998.45	2	-6.19	11.3	75289	41	3	102 - 110	K.YSEGYPGAR.Y
878	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	75	500.23	998.44	500.23	998.45	2	-7.49	11.4	31665	37	3	102 - 110	K.YSEGYPGAR.Y
878	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	55	475.24	948.46	475.24	948.47	2	-9.32	10.9	49651	30	3	431 - 439	R.MGTPALTSR.G	Oxidation: 1
878	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	222	546.31	1090.60	546.31	1090.61	2	-9.78	14.7	5515	78	2	226 - 236	K.LIVAGASAYAR.L
878	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	76	500.23	998.44	500.23	998.45	2	-7.59	11.4	201625	47	3	102 - 110	K.YSEGYPGAR.Y
878	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	70	419.89	1256.63	419.89	1256.65	3	-14.37	11.2	177159	44	3	492 - 501	K.LRHEVEEFAK.Q
878	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	72	419.89	1256.63	419.89	1256.65	3	-13.40	11.3	21563	41	3	492 - 501	K.LRHEVEEFAK.Q
878	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	100	460.27	918.52	460.27	918.53	2	-11.86	12	354662	24	3	218 - 225	K.SATLFRPK.L
878	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	57	475.24	948.46	475.24	948.47	2	-10.48	10.9	25651	46	3	431 - 439	R.MGTPALTSR.G	Oxidation: 1
878	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	225	546.31	1090.60	546.31	1090.61	2	-12.09	14.8	4422	47	2	226 - 236	K.LIVAGASAYAR.L
878	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	125	400.70	799.38	400.70	799.39	2	-8.07	12.6	48535	30	2	237 - 242	R.LYDYAR.I
878	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	522	801.40	2401.17	801.41	2401.20	3	-11.47	22	6443	59	1	50 - 70	K.QLNAPLEEVDPEIADIIEHEK.A
878	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	415	421.22	840.42	421.22	840.43	2	-10.07	19.2	16471	15	1	293 - 299	R.GAMIFFR.K
878	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	113	506.25	1010.48	506.25	1010.49	2	-9.57	12.3	10666	52	1	366 - 373	K.FAQTLMER.G	Oxidation: 6
878	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	61	475.24	948.46	475.24	948.47	2	-11.05	11	291990	27	3	431 - 439	R.MGTPALTSR.G	Oxidation: 1
878	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	69	419.89	1256.63	419.89	1256.65	3	-13.92	11.2	12167	15	3	492 - 501	K.LRHEVEEFAK.Q
878	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	102	460.27	918.52	460.27	918.53	2	-10.14	12.1	49130	50	3	218 - 225	K.SATLFRPK.L
878	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	156	436.21	870.40	436.21	870.41	2	-8.88	13.3	4922	30	1	449 - 455	K.VAEYFDK.A
878	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	101	460.27	918.52	460.27	918.53	2	-12.12	12	50131	41	3	218 - 225	K.SATLFRPK.L
878	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	122	400.70	799.38	400.70	799.39	2	-6.62	12.5	27674	30	2	237 - 242	R.LYDYAR.I
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	211	546.32	1090.62	546.31	1090.61	2	3.95	14.7	9017	83	3	226 - 236	K.LIVAGASAYAR.L
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	58	500.23	998.45	500.23	998.45	2	3.47	11.3	4695	45	3	102 - 110	K.YSEGYPGAR.Y
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	185	462.23	2306.12	462.23	2306.11	5	1.60	14.1	24856	30	4	167 - 187	R.IMALDLPHGGHLSHGYQTDTK.K	Oxidation: 2
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	303	429.22	856.43	429.22	856.43	2	0.86	16.8	55316	37	4	293 - 299	R.GAMIFFR.K	Oxidation: 3
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	521	838.92	1675.83	838.92	1675.83	2	0.14	22.5	11402	71	2	189 - 202	K.ISAVSIFFETMPYR.L	Oxidation: 11
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	409	724.37	2170.09	724.37	2170.08	3	3.36	19.2	6110	87	3	472 - 491	K.LKDFVSAMESSSTIQSEIAK.L
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	144	630.36	629.35	630.36	629.35	1	0.72	13.2	23872	16	2	45 - 49	R.VTWPK.Q
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	256	793.41	1584.80	793.40	1584.79	2	4.48	15.7	5156	103	3	415 - 430	K.NTVPGDVSAMVPGGIR.M	Oxidation: 10
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	265	521.25	1040.49	521.25	1040.48	2	3.43	15.9	4545	48	3	440 - 448	R.GFVEEDFAK.V
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	331	973.46	1944.91	973.46	1944.90	2	6.07	17.4	5099	123	2	474 - 491	K.DFVSAMESSSTIQSEIAK.L	Oxidation: 6
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	120	1337.67	1336.67	1337.67	1336.66	1	3.41	12.7	27474	18	2	354 - 365	K.AYQEQVLSNSAK.F
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	50	419.89	1256.65	419.89	1256.65	3	0.11	11.1	30384	48	3	492 - 501	K.LRHEVEEFAK.Q
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	207	995.50	994.49	995.50	994.49	1	1.98	14.6	158261	31	2	366 - 373	K.FAQTLMER.G
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	348	564.06	2252.22	564.06	2252.22	4	2.19	17.8	9055	52	3	374 - 394	R.GYELVSGGTDNHLVLVNLKPK.G
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	415	841.44	840.43	841.44	840.43	1	-0.03	19.3	15109	22	3	293 - 299	R.GAMIFFR.K
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	537	918.80	2753.37	918.79	2753.36	3	4.02	23.3	27096	73	2	76 - 101	K.GLELIPSENFTSVSVMQAVGSVMTNK.Y	Oxidation: 16
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	181	715.47	714.47	715.47	714.46	1	2.40	14	44184	30	3	456 - 462	K.AVTIALK.V
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	52	419.89	1256.65	419.89	1256.65	3	1.16	11.1	6980	42	3	492 - 501	K.LRHEVEEFAK.Q
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	182	462.23	2306.12	462.23	2306.11	5	2.12	14	27096	29	4	167 - 187	R.IMALDLPHGGHLSHGYQTDTK.K	Oxidation: 2
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	141	436.21	870.41	436.21	870.41	2	1.30	13.1	11146	32	3	449 - 455	K.VAEYFDK.A
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	55	419.89	1256.65	419.89	1256.65	3	0.39	11.2	3580	42	3	492 - 501	K.LRHEVEEFAK.Q
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	259	529.27	1584.80	529.27	1584.79	3	5.50	15.8	12154	70	3	415 - 430	K.NTVPGDVSAMVPGGIR.M	Oxidation: 10
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	346	751.75	2252.22	751.75	2252.22	3	2.62	17.8	37217	38	4	374 - 394	R.GYELVSGGTDNHLVLVNLKPK.G
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	129	590.84	1179.66	590.84	1179.66	2	1.43	12.9	13080	79	3	404 - 414	K.VLEAVHIASNK.N
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	112	800.39	799.39	800.39	799.39	1	0.64	12.5	9222	19	3	237 - 242	R.LYDYAR.I
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	109	800.39	799.39	800.39	799.39	1	0.54	12.4	6541	24	3	237 - 242	R.LYDYAR.I
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	449	685.63	2053.88	685.63	2053.88	3	1.79	20.3	27934	65	2	111 - 127	R.YYGGNEYIDMAETLCQK.R	Carbamidomethyl: 15
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	205	995.50	994.49	995.50	994.49	1	1.07	14.6	22472	21	2	366 - 373	K.FAQTLMER.G
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	341	690.97	2069.88	690.96	2069.87	3	5.83	17.6	330416	76	1	111 - 127	R.YYGGNEYIDMAETLCQK.R	Oxidation: 10
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	154	706.39	705.38	706.39	705.38	1	-0.19	13.4	277707	28	3	129 - 134	R.ALEAFR.L
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	138	436.21	870.41	436.21	870.41	2	1.53	13.1	4423	32	3	449 - 455	K.VAEYFDK.A
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	234	608.26	1821.77	608.26	1821.76	3	3.19	15.2	80385	41	1	203 - 217	R.LDESTGYIDYDQMEK.S	Oxidation: 13
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	150	487.85	2434.21	487.85	2434.21	5	0.34	13.3	13306	28	1	167 - 188	R.IMALDLPHGGHLSHGYQTDTKK.I	Oxidation: 2
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	53	629.33	1256.65	629.33	1256.65	2	1.17	11.1	35461	41	3	492 - 501	K.LRHEVEEFAK.Q
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	358	1066.56	1065.55	1066.56	1065.55	1	2.83	18	112151	39	3	502 - 510	K.QFPTIGFEK.E
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	347	1127.12	2252.22	1127.12	2252.22	2	2.62	17.8	28110	48	2	374 - 394	R.GYELVSGGTDNHLVLVNLKPK.G
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	140	630.36	629.35	630.36	629.35	1	1.87	13.1	20970	19	2	45 - 49	R.VTWPK.Q
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	263	1041.49	1040.49	1041.49	1040.48	1	3.83	15.9	7450	53	3	440 - 448	R.GFVEEDFAK.V
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	447	1027.95	2053.88	1027.95	2053.88	2	1.79	20.3	176505	90	3	111 - 127	R.YYGGNEYIDMAETLCQK.R	Carbamidomethyl: 15
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	419	737.67	2209.99	737.67	2209.98	3	3.96	19.5	30199	51	2	111 - 128	R.YYGGNEYIDMAETLCQKR.A	Carbamidomethyl: 15
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	338	1035.95	2069.88	1035.94	2069.87	2	5.38	17.6	132897	72	2	111 - 127	R.YYGGNEYIDMAETLCQK.R	Oxidation: 10
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	402	885.16	2652.45	885.16	2652.45	3	0.74	19.1	3500	17	2	320 - 345	K.INQAVFPGLQGGPHNHTITGLAVALK.Q
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	268	521.25	1040.48	521.25	1040.48	2	3.18	16	4069	45	3	440 - 448	R.GFVEEDFAK.V
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	490	924.13	2769.36	924.13	2769.36	3	1.19	21.6	5808	69	3	76 - 101	K.GLELIPSENFTSVSVMQAVGSVMTNK.Y	Oxidation: 16
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	291	729.70	2186.09	729.70	2186.08	3	4.68	16.5	4005	116	3	472 - 491	K.LKDFVSAMESSSTIQSEIAK.L	Oxidation: 8
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	488	924.13	2769.36	924.13	2769.36	3	2.54	21.5	4319	90	3	76 - 101	K.GLELIPSENFTSVSVMQAVGSVMTNK.Y	Oxidation: 16
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	231	459.03	2290.12	459.03	2290.12	5	0.29	15.2	67842	31	2	167 - 187	R.IMALDLPHGGHLSHGYQTDTK.K
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	64	999.45	998.45	999.45	998.45	1	1.72	11.4	30199	19	3	102 - 110	K.YSEGYPGAR.Y
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	379	533.77	1065.53	533.78	1065.55	2	-15.35	18.5	161793	37	5	502 - 510	K.QFPTIGFEK.E
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	113	669.83	1337.65	669.34	1336.66	2	738.02	12.5	28594	68	4	354 - 365	K.AYQEQVLSNSAK.F
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	319	1157.54	1156.53	1157.54	1156.53	1	3.40	17.2	52948	44	3	311 - 319	K.EVLYDFEDK.I
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	537	918.80	2753.37	918.79	2753.36	3	4.02	23.3	27096	32	4	76 - 101	K.GLELIPSENFTSVSVMQAVGSVMTNK.Y	Oxidation: 23
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	91	431.75	861.48	431.75	861.48	2	0.49	12	10048	23	1	128 - 134	K.RALEAFR.L
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	108	400.70	799.39	400.70	799.39	2	0.54	12.4	7171	30	3	237 - 242	R.LYDYAR.I
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	335	973.46	1944.91	973.46	1944.90	2	7.02	17.5	16125	29	2	474 - 491	K.DFVSAMESSSTIQSEIAK.L	Oxidation: 6
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	38	475.24	948.47	475.24	948.47	2	-2.23	10.7	14974	44	3	431 - 439	R.MGTPALTSR.G	Oxidation: 1
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	459	965.46	1928.91	965.46	1928.90	2	2.03	20.6	375080	98	2	474 - 491	K.DFVSAMESSSTIQSEIAK.L
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	189	462.23	2306.12	462.23	2306.11	5	3.64	14.2	42633	29	4	167 - 187	R.IMALDLPHGGHLSHGYQTDTK.K	Oxidation: 2
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	404	724.37	2170.09	724.37	2170.08	3	3.20	19.1	63623	110	3	472 - 491	K.LKDFVSAMESSSTIQSEIAK.L
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	462	965.46	1928.91	965.46	1928.90	2	1.35	20.6	60033	87	2	474 - 491	K.DFVSAMESSSTIQSEIAK.L
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	94	506.25	1010.49	506.25	1010.49	2	0.15	12.1	27934	54	3	366 - 373	K.FAQTLMER.G	Oxidation: 6
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	111	400.70	799.39	400.70	799.39	2	0.64	12.5	10037	31	3	237 - 242	R.LYDYAR.I
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	228	573.54	2290.12	573.54	2290.12	4	0.58	15.1	22274	37	2	167 - 187	R.IMALDLPHGGHLSHGYQTDTK.K
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	504	801.41	2401.21	801.41	2401.20	3	3.36	22.1	15942	85	3	50 - 70	K.QLNAPLEEVDPEIADIIEHEK.A
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	315	579.27	1156.53	579.27	1156.53	2	2.91	17.1	77742	40	3	311 - 319	K.EVLYDFEDK.I
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	114	669.34	1336.67	669.34	1336.66	2	2.19	12.5	15220	84	4	354 - 365	K.AYQEQVLSNSAK.F
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	184	715.47	714.47	715.47	714.46	1	2.62	14.1	24115	39	3	456 - 462	K.AVTIALK.V
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	300	903.90	1805.78	903.89	1805.77	2	4.95	16.7	57625	106	3	203 - 217	R.LDESTGYIDYDQMEK.S
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	342	751.75	2252.22	751.75	2252.22	3	3.17	17.7	48476	26	4	374 - 394	R.GYELVSGGTDNHLVLVNLKPK.G
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	398	664.12	2652.45	664.12	2652.45	4	1.84	19	17921	24	3	320 - 345	K.INQAVFPGLQGGPHNHTITGLAVALK.Q
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	105	400.70	799.39	400.70	799.39	2	0.49	12.3	79943	31	3	237 - 242	R.LYDYAR.I
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	262	521.25	1040.49	521.25	1040.48	2	3.83	15.9	6431	39	3	440 - 448	R.GFVEEDFAK.V
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	357	533.78	1065.55	533.78	1065.55	2	2.82	18	22352	45	5	502 - 510	K.QFPTIGFEK.E
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	106	800.39	799.39	800.39	799.39	1	0.50	12.3	18457	26	3	237 - 242	R.LYDYAR.I
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	349	751.75	2252.22	751.75	2252.22	3	2.19	17.8	107521	25	4	374 - 394	R.GYELVSGGTDNHLVLVNLKPK.G
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	523	838.92	1675.83	838.92	1675.83	2	0.97	22.6	7904	99	2	189 - 202	K.ISAVSIFFETMPYR.L	Oxidation: 11
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	345	564.06	2252.22	564.06	2252.22	4	2.63	17.8	47411	53	3	374 - 394	R.GYELVSGGTDNHLVLVNLKPK.G
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	43	949.48	948.47	949.48	948.47	1	1.67	10.9	17921	16	1	431 - 439	R.MGTPALTSR.G	Oxidation: 1
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	368	523.94	1568.80	523.94	1568.80	3	3.46	18.3	19020	55	3	415 - 430	K.NTVPGDVSAMVPGGIR.M
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	104	467.25	932.48	467.24	932.47	2	2.71	12.3	375080	64	3	431 - 439	R.MGTPALTSR.G
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	254	529.27	1584.80	529.27	1584.79	3	4.56	15.7	4484	79	3	415 - 430	K.NTVPGDVSAMVPGGIR.M	Oxidation: 10
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	215	546.32	1090.62	546.31	1090.61	2	3.47	14.8	3162	79	3	226 - 236	K.LIVAGASAYAR.L
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	42	475.24	948.47	475.24	948.47	2	1.68	10.9	18440	54	3	431 - 439	R.MGTPALTSR.G	Oxidation: 1
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	29	494.74	987.46	494.74	987.47	2	-3.63	10.6	12032	54	3	494 - 501	R.HEVEEFAK.Q
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	364	785.41	1568.81	785.41	1568.80	2	5.15	18.2	50487	74	3	415 - 430	K.NTVPGDVSAMVPGGIR.M
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	266	1041.49	1040.49	1041.49	1040.48	1	3.43	15.9	7805	43	3	440 - 448	R.GFVEEDFAK.V
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	299	687.87	2747.44	687.62	2746.44	4	361.66	16.7	162885	28	2	404 - 430	K.VLEAVHIASNKNTVPGDVSAMVPGGIR.M	Oxidation: 21
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	361	1066.56	1065.55	1066.56	1065.55	1	2.62	18.1	304237	39	3	502 - 510	K.QFPTIGFEK.E
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	100	506.25	1010.49	506.25	1010.49	2	1.29	12.2	10192	61	3	366 - 373	K.FAQTLMER.G	Oxidation: 6
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	290	430.23	1287.68	430.23	1287.68	3	0.58	16.5	5971	24	2	129 - 139	R.ALEAFRLDPEK.W
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	407	421.22	840.43	421.22	840.43	2	0.71	19.2	6980	39	3	293 - 299	R.GAMIFFR.K
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	62	999.46	998.45	999.45	998.45	1	2.10	11.3	15017	19	3	102 - 110	K.YSEGYPGAR.Y
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	97	506.25	1010.49	506.25	1010.49	2	1.73	12.1	33950	55	3	366 - 373	K.FAQTLMER.G	Oxidation: 6
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	369	785.41	1568.80	785.41	1568.80	2	2.95	18.3	10505	64	3	415 - 430	K.NTVPGDVSAMVPGGIR.M
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	360	533.78	1065.55	533.78	1065.55	2	2.61	18.1	18897	61	5	502 - 510	K.QFPTIGFEK.E
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	51	629.33	1256.65	629.33	1256.65	2	0.10	11.1	41863	59	3	492 - 501	K.LRHEVEEFAK.Q
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	119	446.56	1336.67	446.56	1336.66	3	3.71	12.6	65645	50	2	354 - 365	K.AYQEQVLSNSAK.F
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	179	577.54	2306.11	577.54	2306.11	4	1.56	14	12078	22	3	167 - 187	R.IMALDLPHGGHLSHGYQTDTK.K	Oxidation: 2
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	32	988.47	987.46	988.47	987.47	1	-3.67	10.6	17060	25	1	494 - 501	R.HEVEEFAK.Q
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	288	729.70	2186.09	729.70	2186.08	3	4.64	16.5	6743	123	3	472 - 491	K.LKDFVSAMESSSTIQSEIAK.L	Oxidation: 8
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	206	498.25	994.49	498.25	994.49	2	1.99	14.6	6483	63	3	366 - 373	K.FAQTLMER.G
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	186	577.54	2306.12	577.54	2306.11	4	1.61	14.1	72488	26	3	167 - 187	R.IMALDLPHGGHLSHGYQTDTK.K	Oxidation: 2
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	297	903.90	1805.78	903.89	1805.77	2	4.94	16.7	81177	118	3	203 - 217	R.LDESTGYIDYDQMEK.S
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	293	430.24	1287.69	430.23	1287.68	3	2.32	16.5	5155	29	2	129 - 139	R.ALEAFRLDPEK.W
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	183	577.54	2306.12	577.54	2306.11	4	2.13	14.1	28145	38	3	167 - 187	R.IMALDLPHGGHLSHGYQTDTK.K	Oxidation: 2
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	507	801.41	2401.21	801.41	2401.20	3	3.00	22.2	51713	101	3	50 - 70	K.QLNAPLEEVDPEIADIIEHEK.A
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	354	533.78	1065.55	533.78	1065.55	2	1.04	18	53226	40	5	502 - 510	K.QFPTIGFEK.E
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	190	462.23	2306.11	462.23	2306.11	5	1.21	14.2	23437	23	4	167 - 187	R.IMALDLPHGGHLSHGYQTDTK.K	Oxidation: 2
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	253	793.41	1584.80	793.40	1584.79	2	4.56	15.7	3616	107	3	415 - 430	K.NTVPGDVSAMVPGGIR.M	Oxidation: 10
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	408	841.44	840.43	841.44	840.43	1	0.72	19.2	35461	23	3	293 - 299	R.GAMIFFR.K
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	321	1157.54	1156.53	1157.54	1156.53	1	3.35	17.2	18270	60	3	311 - 319	K.EVLYDFEDK.I
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	56	500.23	998.45	500.23	998.45	2	2.91	11.2	25081	48	3	102 - 110	K.YSEGYPGAR.Y
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	61	500.23	998.45	500.23	998.45	2	2.09	11.3	4386	45	3	102 - 110	K.YSEGYPGAR.Y
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	531	918.80	2753.37	918.79	2753.36	3	1.84	23	12307	76	4	76 - 101	K.GLELIPSENFTSVSVMQAVGSVMTNK.Y	Oxidation: 23
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	366	785.41	1568.80	785.41	1568.80	2	3.46	18.2	15339	70	3	415 - 430	K.NTVPGDVSAMVPGGIR.M
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	203	498.25	994.49	498.25	994.49	2	1.07	14.5	2797	59	3	366 - 373	K.FAQTLMER.G
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	316	1157.54	1156.53	1157.54	1156.53	1	2.91	17.1	54576	51	3	311 - 319	K.EVLYDFEDK.I
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	411	841.44	840.43	841.44	840.43	1	1.10	19.3	25081	24	3	293 - 299	R.GAMIFFR.K
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	309	429.22	856.43	429.22	856.43	2	2.59	16.9	7033	26	4	293 - 299	R.GAMIFFR.K	Oxidation: 3
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	418	737.67	2209.99	737.67	2209.98	3	4.30	19.5	6887	77	2	111 - 128	R.YYGGNEYIDMAETLCQKR.A	Carbamidomethyl: 15
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	399	885.16	2652.45	885.16	2652.45	3	1.83	19	10645	21	2	320 - 345	K.INQAVFPGLQGGPHNHTITGLAVALK.Q
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	501	801.41	2401.21	801.41	2401.20	3	1.55	22	70115	86	3	50 - 70	K.QLNAPLEEVDPEIADIIEHEK.A
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	227	459.03	2290.12	459.03	2290.12	5	0.57	15.1	7629	39	2	167 - 187	R.IMALDLPHGGHLSHGYQTDTK.K
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	131	1180.67	1179.66	1180.67	1179.66	1	1.44	12.9	21444	20	1	404 - 414	K.VLEAVHIASNK.N
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	269	1041.49	1040.48	1041.49	1040.48	1	3.18	16	14957	50	3	440 - 448	R.GFVEEDFAK.V
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	213	1091.62	1090.62	1091.62	1090.61	1	3.29	14.8	130295	23	1	226 - 236	K.LIVAGASAYAR.L
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	401	664.12	2652.45	664.12	2652.45	4	0.73	19	50436	26	3	320 - 345	K.INQAVFPGLQGGPHNHTITGLAVALK.Q
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	232	573.54	2290.12	573.54	2290.12	4	0.28	15.2	66001	30	2	167 - 187	R.IMALDLPHGGHLSHGYQTDTK.K
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	344	1127.12	2252.22	1127.12	2252.22	2	3.17	17.7	266961	17	2	374 - 394	R.GYELVSGGTDNHLVLVNLKPK.G
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	139	871.42	870.41	871.42	870.41	1	1.53	13.1	32345	38	3	449 - 455	K.VAEYFDK.A
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	396	664.12	2652.45	664.12	2652.45	4	-1.88	18.9	20823	18	3	320 - 345	K.INQAVFPGLQGGPHNHTITGLAVALK.Q
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	233	911.89	1821.77	911.89	1821.76	2	3.19	15.2	31300	114	3	203 - 217	R.LDESTGYIDYDQMEK.S	Oxidation: 13
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	73	460.27	918.53	460.27	918.53	2	-0.08	11.6	124510	49	3	218 - 225	K.SATLFRPK.L
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	117	669.34	1336.67	669.34	1336.66	2	3.71	12.6	15910	68	4	354 - 365	K.AYQEQVLSNSAK.F
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	413	421.22	840.43	421.22	840.43	2	-0.03	19.3	4695	38	3	293 - 299	R.GAMIFFR.K
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	312	743.00	2225.99	743.00	2225.97	3	6.20	17	81697	34	1	111 - 128	R.YYGGNEYIDMAETLCQKR.A	Oxidation: 10
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	142	871.42	870.41	871.42	870.41	1	1.31	13.1	156856	37	3	449 - 455	K.VAEYFDK.A
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	403	724.37	2170.09	724.37	2170.08	3	1.25	19.1	85186	95	3	472 - 491	K.LKDFVSAMESSSTIQSEIAK.L
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	136	871.42	870.41	871.42	870.41	1	2.29	13	16396	38	3	449 - 455	K.VAEYFDK.A
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	160	706.39	705.38	706.39	705.38	1	1.66	13.5	8718	25	3	129 - 134	R.ALEAFR.L
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	446	1027.95	2053.88	1027.95	2053.88	2	1.50	20.3	10048	65	3	111 - 127	R.YYGGNEYIDMAETLCQK.R	Carbamidomethyl: 15
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	522	559.62	1675.83	559.62	1675.83	3	0.14	22.5	7632	52	2	189 - 202	K.ISAVSIFFETMPYR.L	Oxidation: 11
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	295	903.89	1805.78	903.89	1805.77	2	4.87	16.6	5908	112	3	203 - 217	R.LDESTGYIDYDQMEK.S
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	452	685.63	2053.88	685.63	2053.88	3	1.00	20.4	33950	53	2	111 - 127	R.YYGGNEYIDMAETLCQK.R	Carbamidomethyl: 15
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	343	564.06	2252.22	564.06	2252.22	4	3.16	17.7	41542	48	3	374 - 394	R.GYELVSGGTDNHLVLVNLKPK.G
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	72	460.27	918.53	460.27	918.53	2	0.29	11.5	27901	36	3	218 - 225	K.SATLFRPK.L
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	132	590.84	1179.66	590.84	1179.66	2	0.06	12.9	7895	78	3	404 - 414	K.VLEAVHIASNK.N
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	76	460.27	918.53	460.27	918.53	2	1.14	11.7	120470	49	3	218 - 225	K.SATLFRPK.L
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	34	494.74	987.46	494.74	987.47	2	-2.44	10.7	14608	45	3	494 - 501	R.HEVEEFAK.Q
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	370	523.94	1568.80	523.94	1568.80	3	2.94	18.3	32896	57	3	415 - 430	K.NTVPGDVSAMVPGGIR.M
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	376	534.27	1066.53	533.78	1065.55	2	921.83	18.5	119951	43	5	502 - 510	K.QFPTIGFEK.E
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	252	793.41	1584.80	793.40	1584.79	2	4.60	15.6	3587	104	3	415 - 430	K.NTVPGDVSAMVPGGIR.M	Oxidation: 10
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	146	669.83	1337.65	669.34	1336.66	2	738.28	13.2	70115	51	4	354 - 365	K.AYQEQVLSNSAK.F
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	118	1337.67	1336.67	1337.67	1336.66	1	3.72	12.6	17608	41	2	354 - 365	K.AYQEQVLSNSAK.F
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	202	498.25	994.49	498.25	994.49	2	0.73	14.5	5390	54	3	366 - 373	K.FAQTLMER.G
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	230	911.89	1821.77	911.89	1821.76	2	3.66	15.1	9288	92	3	203 - 217	R.LDESTGYIDYDQMEK.S	Oxidation: 13
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	59	999.46	998.45	999.45	998.45	1	3.47	11.3	28738	16	3	102 - 110	K.YSEGYPGAR.Y
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	57	629.33	1256.65	629.33	1256.65	2	0.41	11.2	9537	30	3	492 - 501	K.LRHEVEEFAK.Q
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	486	924.13	2769.36	924.13	2769.36	3	3.01	21.5	21444	89	3	76 - 101	K.GLELIPSENFTSVSVMQAVGSVMTNK.Y	Oxidation: 16
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	306	429.22	856.43	429.22	856.43	2	1.52	16.9	60605	29	4	293 - 299	R.GAMIFFR.K	Oxidation: 3
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	257	529.27	1584.80	529.27	1584.79	3	4.48	15.7	6701	59	3	415 - 430	K.NTVPGDVSAMVPGGIR.M	Oxidation: 10
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	405	1086.05	2170.09	1086.05	2170.08	2	3.20	19.1	30384	43	1	472 - 491	K.LKDFVSAMESSSTIQSEIAK.L
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	302	687.87	2747.44	687.62	2746.44	4	362.40	16.7	161209	26	2	404 - 430	K.VLEAVHIASNKNTVPGDVSAMVPGGIR.M	Oxidation: 21
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	318	579.27	1156.53	579.27	1156.53	2	3.39	17.1	88484	51	3	311 - 319	K.EVLYDFEDK.I
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	313	579.27	1156.54	579.27	1156.53	2	5.56	17	24943	33	3	311 - 319	K.EVLYDFEDK.I
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	157	706.39	705.38	706.39	705.38	1	0.01	13.5	252961	25	3	129 - 134	R.ALEAFR.L
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	536	918.79	2753.36	918.79	2753.36	3	-0.60	23.3	44184	64	2	76 - 101	K.GLELIPSENFTSVSVMQAVGSVMTNK.Y	Oxidation: 16
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	323	429.22	856.43	429.22	856.43	2	1.38	17.2	13416	20	4	293 - 299	R.GAMIFFR.K	Oxidation: 3
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	107	467.24	932.47	467.24	932.47	2	-1.63	12.3	60033	57	3	431 - 439	R.MGTPALTSR.G
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	548	830.93	1659.84	830.92	1659.83	2	2.06	24.2	35555	105	2	189 - 202	K.ISAVSIFFETMPYR.L
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	121	446.56	1336.67	446.56	1336.66	3	3.42	12.7	29954	50	2	354 - 365	K.AYQEQVLSNSAK.F
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	110	467.25	932.48	467.24	932.47	2	0.85	12.4	19222	57	3	431 - 439	R.MGTPALTSR.G
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	339	1035.95	2069.88	1035.94	2069.87	2	5.84	17.6	33854	80	2	111 - 127	R.YYGGNEYIDMAETLCQK.R	Oxidation: 10
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	551	830.93	1659.84	830.92	1659.83	2	2.23	24.3	46672	98	2	189 - 202	K.ISAVSIFFETMPYR.L
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	237	911.89	1821.77	911.89	1821.76	2	4.79	15.3	58536	76	3	203 - 217	R.LDESTGYIDYDQMEK.S	Oxidation: 13
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	187	715.47	714.47	715.47	714.46	1	2.88	14.2	43576	34	3	456 - 462	K.AVTIALK.V
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	355	1066.56	1065.55	1066.56	1065.55	1	1.04	18	285110	42	3	502 - 510	K.QFPTIGFEK.E
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	410	421.22	840.43	421.22	840.43	2	1.09	19.3	3580	39	3	293 - 299	R.GAMIFFR.K
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	127	590.84	1179.66	590.84	1179.66	2	-0.02	12.8	4707	89	3	404 - 414	K.VLEAVHIASNK.N
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	329	730.03	2187.07	729.70	2186.08	3	454.49	17.4	18169	37	3	472 - 491	K.LKDFVSAMESSSTIQSEIAK.L	Oxidation: 8
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	39	475.24	948.47	475.24	948.47	2	-0.38	10.8	18073	40	3	431 - 439	R.MGTPALTSR.G	Oxidation: 1
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	30	494.74	987.46	494.74	987.47	2	-3.67	10.6	195286	39	3	494 - 501	R.HEVEEFAK.Q
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	212	546.32	1090.62	546.31	1090.61	2	3.29	14.7	13163	87	3	226 - 236	K.LIVAGASAYAR.L
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	373	523.94	1568.80	523.94	1568.80	3	2.90	18.4	126782	49	3	415 - 430	K.NTVPGDVSAMVPGGIR.M
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	451	1027.95	2053.88	1027.95	2053.88	2	1.00	20.4	41261	70	3	111 - 127	R.YYGGNEYIDMAETLCQK.R	Carbamidomethyl: 15
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	533	918.80	2753.37	918.79	2753.36	3	2.01	23	52416	32	4	76 - 101	K.GLELIPSENFTSVSVMQAVGSVMTNK.Y	Oxidation: 23
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	550	554.29	1659.84	554.28	1659.83	3	2.05	24.3	181947	59	1	189 - 202	K.ISAVSIFFETMPYR.L
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	135	436.21	870.41	436.21	870.41	2	2.28	13	5808	30	3	449 - 455	K.VAEYFDK.A
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	289	1094.05	2186.09	1094.05	2186.08	2	4.65	16.5	64276	27	1	472 - 491	K.LKDFVSAMESSSTIQSEIAK.L	Oxidation: 8
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	353	751.75	2252.21	751.75	2252.22	3	-1.38	17.9	96968	31	4	374 - 394	R.GYELVSGGTDNHLVLVNLKPK.G
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	536	918.79	2753.36	918.79	2753.36	3	-0.60	23.3	44184	35	4	76 - 101	K.GLELIPSENFTSVSVMQAVGSVMTNK.Y	Oxidation: 23
933	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	524	559.62	1675.83	559.62	1675.83	3	0.96	22.6	3349	50	2	189 - 202	K.ISAVSIFFETMPYR.L	Oxidation: 11
986	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	97	400.71	799.40	400.70	799.39	2	14.94	12.9	168533	30	3	237 - 242	R.LYDYAR.I
986	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	259	430.24	1287.70	430.23	1287.68	3	15.36	16.6	27971	16	1	129 - 139	R.ALEAFRLDPEK.W
986	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	527	830.94	1659.86	830.92	1659.83	2	16.95	24.3	3979	88	2	189 - 202	K.ISAVSIFFETMPYR.L
986	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	189	546.32	1090.63	546.31	1090.61	2	18.55	15.1	10372	83	3	226 - 236	K.LIVAGASAYAR.L
986	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	41	419.90	1256.67	419.89	1256.65	3	11.42	11.6	52188	42	3	492 - 501	K.LRHEVEEFAK.Q
986	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	278	429.23	856.44	429.22	856.43	2	15.82	17.1	18904	30	3	293 - 299	R.GAMIFFR.K	Oxidation: 3
986	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	316	564.07	2252.25	564.06	2252.22	4	15.98	17.9	10180	51	2	374 - 394	R.GYELVSGGTDNHLVLVNLKPK.G
986	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	526	830.94	1659.86	830.92	1659.83	2	14.44	24.3	18771	71	2	189 - 202	K.ISAVSIFFETMPYR.L
986	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	331	533.79	1065.57	533.78	1065.55	2	16.18	18.3	63370	43	2	502 - 510	K.QFPTIGFEK.E
986	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	91	400.71	799.40	400.70	799.39	2	17.54	12.8	15914	31	3	237 - 242	R.LYDYAR.I
986	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	79	506.26	1010.50	506.25	1010.49	2	16.70	12.5	6047	59	2	366 - 373	K.FAQTLMER.G	Oxidation: 6
986	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	174	498.26	994.51	498.25	994.49	2	16.99	14.7	9047	49	3	366 - 373	K.FAQTLMER.G
986	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	334	533.79	1065.57	533.78	1065.55	2	17.79	18.4	61736	50	2	502 - 510	K.QFPTIGFEK.E
986	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	123	871.43	870.43	871.42	870.41	1	17.02	13.5	16366	43	2	449 - 455	K.VAEYFDK.A
986	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	333	1066.57	1065.57	1066.56	1065.55	1	16.20	18.3	4811	29	1	502 - 510	K.QFPTIGFEK.E
986	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	161	715.48	714.48	715.47	714.46	1	16.43	14.4	9861	22	3	456 - 462	K.AVTIALK.V
986	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	95	669.35	1336.69	669.34	1336.66	2	17.58	12.8	34628	74	4	354 - 365	K.AYQEQVLSNSAK.F
986	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	184	546.32	1090.63	546.31	1090.61	2	16.25	14.9	15206	73	3	226 - 236	K.LIVAGASAYAR.L
986	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	237	521.26	1040.50	521.25	1040.48	2	19.67	16.1	78244	45	1	440 - 448	R.GFVEEDFAK.V
986	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	378	421.23	840.45	421.22	840.43	2	17.21	19.3	16544	38	2	293 - 299	R.GAMIFFR.K
986	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	113	590.85	1179.68	590.84	1179.66	2	13.50	13.2	14067	64	3	404 - 414	K.VLEAVHIASNK.N
986	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	66	460.28	918.54	460.27	918.53	2	13.78	12.2	11277	41	2	218 - 225	K.SATLFRPK.L
986	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	40	419.90	1256.66	419.89	1256.65	3	9.82	11.6	17844	43	3	492 - 501	K.LRHEVEEFAK.Q
986	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	319	751.76	2252.26	751.75	2252.22	3	17.10	18	9198	30	2	374 - 394	R.GYELVSGGTDNHLVLVNLKPK.G
986	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	31	475.25	948.48	475.24	948.47	2	15.00	11.2	45501	38	3	431 - 439	R.MGTPALTSR.G	Oxidation: 1
986	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	497	559.63	1675.86	559.62	1675.83	3	19.11	22.7	39942	48	1	189 - 202	K.ISAVSIFFETMPYR.L	Oxidation: 11
986	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	496	838.94	1675.86	838.92	1675.83	2	19.12	22.7	4489	75	1	189 - 202	K.ISAVSIFFETMPYR.L	Oxidation: 11
986	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	118	669.84	1337.67	669.34	1336.66	2	755.25	13.4	43989	26	4	354 - 365	K.AYQEQVLSNSAK.F
986	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	381	421.23	840.45	421.22	840.43	2	18.13	19.4	5079	43	2	293 - 299	R.GAMIFFR.K
986	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	37	475.25	948.49	475.24	948.47	2	16.62	11.3	5335	48	3	431 - 439	R.MGTPALTSR.G	Oxidation: 1
986	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	320	564.07	2252.26	564.06	2252.22	4	17.10	18	243474	30	2	374 - 394	R.GYELVSGGTDNHLVLVNLKPK.G
986	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	98	446.57	1336.69	446.56	1336.66	3	17.90	12.9	34923	38	2	354 - 365	K.AYQEQVLSNSAK.F
986	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	489	801.42	2401.25	801.41	2401.20	3	19.24	22.3	15789	71	2	50 - 70	K.QLNAPLEEVDPEIADIIEHEK.A
986	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	82	506.26	1010.50	506.25	1010.49	2	18.03	12.6	6254	51	2	366 - 373	K.FAQTLMER.G	Oxidation: 6
986	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	187	546.32	1090.63	546.31	1090.61	2	18.43	15	16820	76	3	226 - 236	K.LIVAGASAYAR.L
986	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	96	669.35	1336.69	669.34	1336.66	2	17.92	12.9	29732	74	4	354 - 365	K.AYQEQVLSNSAK.F
986	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	44	419.90	1256.67	419.89	1256.65	3	14.35	11.7	4499	43	3	492 - 501	K.LRHEVEEFAK.Q
986	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	100	446.57	1336.68	446.56	1336.66	3	16.36	13	42913	27	2	354 - 365	K.AYQEQVLSNSAK.F
986	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	99	669.35	1336.68	669.34	1336.66	2	16.37	12.9	26370	70	4	354 - 365	K.AYQEQVLSNSAK.F
986	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	177	498.26	994.51	498.25	994.49	2	15.04	14.8	17183	54	3	366 - 373	K.FAQTLMER.G
986	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	275	429.23	856.44	429.22	856.43	2	16.08	17	5762	36	3	293 - 299	R.GAMIFFR.K	Oxidation: 3
986	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	93	400.71	799.40	400.70	799.39	2	15.07	12.8	11225	23	3	237 - 242	R.LYDYAR.I
986	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	45	500.24	998.47	500.23	998.45	2	19.36	11.7	4112	43	2	102 - 110	K.YSEGYPGAR.Y
986	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	117	590.85	1179.68	590.84	1179.66	2	14.35	13.4	46902	57	3	404 - 414	K.VLEAVHIASNK.N
986	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	49	500.24	998.46	500.23	998.45	2	18.52	11.8	83488	50	2	102 - 110	K.YSEGYPGAR.Y
986	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	166	715.48	714.48	715.47	714.46	1	15.44	14.5	14163	26	3	456 - 462	K.AVTIALK.V
986	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	121	436.22	870.43	436.21	870.41	2	17.00	13.5	9137	30	3	449 - 455	K.VAEYFDK.A
986	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	67	460.28	918.54	460.27	918.53	2	14.58	12.2	8754	46	2	218 - 225	K.SATLFRPK.L
986	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	288	579.28	1156.55	579.27	1156.53	2	18.94	17.3	6471	34	2	311 - 319	K.EVLYDFEDK.I
986	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	125	436.22	870.43	436.21	870.41	2	15.01	13.6	6436	32	3	449 - 455	K.VAEYFDK.A
986	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	488	801.42	2401.25	801.41	2401.20	3	19.83	22.3	16488	58	2	50 - 70	K.QLNAPLEEVDPEIADIIEHEK.A
986	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	159	715.48	714.47	715.47	714.46	1	10.40	14.4	10448	43	3	456 - 462	K.AVTIALK.V
986	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	317	751.76	2252.25	751.75	2252.22	3	16.00	17.9	236098	32	2	374 - 394	R.GYELVSGGTDNHLVLVNLKPK.G
986	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	42	629.34	1256.67	629.33	1256.65	2	11.43	11.6	5161	23	1	492 - 501	K.LRHEVEEFAK.Q
986	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	281	429.23	856.44	429.22	856.43	2	15.64	17.1	99145	32	3	293 - 299	R.GAMIFFR.K	Oxidation: 3
986	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	284	579.28	1156.55	579.27	1156.53	2	18.43	17.2	169920	52	2	311 - 319	K.EVLYDFEDK.I
986	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	119	436.22	870.43	436.21	870.41	2	16.15	13.5	7163	27	3	449 - 455	K.VAEYFDK.A
986	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	34	475.25	948.49	475.24	948.47	2	16.14	11.3	20936	39	3	431 - 439	R.MGTPALTSR.G	Oxidation: 1
986	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	126	871.43	870.43	871.42	870.41	1	15.01	13.6	21988	28	2	449 - 455	K.VAEYFDK.A
986	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	114	590.85	1179.68	590.84	1179.66	2	14.72	13.3	63939	64	3	404 - 414	K.VLEAVHIASNK.N
986	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	179	498.26	994.51	498.25	994.49	2	14.46	14.8	19164	64	3	366 - 373	K.FAQTLMER.G
1048	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	44	400.71	799.40	400.70	799.39	2	16.01	12.8	8494	26	3	237 - 242	R.LYDYAR.I
1048	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	149	687.63	2746.49	687.62	2746.44	4	15.94	16.5	2232	41	2	404 - 430	K.VLEAVHIASNKNTVPGDVSAMVPGGIR.M	Oxidation: 21
1048	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	12	475.25	948.48	475.24	948.47	2	13.47	11.1	38329	47	5	431 - 439	R.MGTPALTSR.G	Oxidation: 1
1048	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	117	546.32	1090.63	546.31	1090.61	2	15.30	15	25697	93	3	226 - 236	K.LIVAGASAYAR.L
1048	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	170	429.23	856.44	429.22	856.43	2	11.65	17.2	5089	25	1	293 - 299	R.GAMIFFR.K	Oxidation: 3
1048	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	39	506.26	1010.50	506.25	1010.49	2	14.59	12.6	16122	52	3	366 - 373	K.FAQTLMER.G	Oxidation: 6
1048	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	30	460.28	918.54	460.27	918.53	2	12.41	12.3	8730	21	3	218 - 225	K.SATLFRPK.L
1048	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	11	475.25	948.48	475.24	948.47	2	13.15	11.1	21627	50	5	431 - 439	R.MGTPALTSR.G	Oxidation: 1
1048	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	43	467.25	932.49	467.24	932.47	2	14.63	12.8	12339	64	3	431 - 439	R.MGTPALTSR.G
1048	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	10	475.25	948.48	475.24	948.47	2	13.26	11.1	9732	50	5	431 - 439	R.MGTPALTSR.G	Oxidation: 1
1048	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	37	506.26	1010.50	506.25	1010.49	2	13.40	12.5	10341	55	3	366 - 373	K.FAQTLMER.G	Oxidation: 6
1048	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	29	460.28	918.54	460.27	918.53	2	12.74	12.3	8041	40	3	218 - 225	K.SATLFRPK.L
1048	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	121	546.32	1090.63	546.31	1090.61	2	17.95	15.1	11701	49	3	226 - 236	K.LIVAGASAYAR.L
1048	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	45	400.71	799.40	400.70	799.39	2	16.34	12.9	20646	31	3	237 - 242	R.LYDYAR.I
1048	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	28	460.28	918.54	460.27	918.53	2	13.00	12.2	4205	22	3	218 - 225	K.SATLFRPK.L
1048	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	49	400.71	799.40	400.70	799.39	2	15.12	12.9	13617	24	3	237 - 242	R.LYDYAR.I
1048	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	218	658.10	2628.38	658.09	2628.34	4	17.04	21.3	3312	60	1	50 - 72	K.QLNAPLEEVDPEIADIIEHEKAR.Q
1048	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	109	498.26	994.50	498.25	994.49	2	12.37	14.8	4016	44	1	366 - 373	K.FAQTLMER.G
1048	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	9	475.25	948.48	475.24	948.47	2	14.54	11	4462	26	5	431 - 439	R.MGTPALTSR.G	Oxidation: 1
1048	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	150	687.63	2746.49	687.62	2746.44	4	17.17	16.5	3253	45	2	404 - 430	K.VLEAVHIASNKNTVPGDVSAMVPGGIR.M	Oxidation: 21
1048	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	40	506.26	1010.50	506.25	1010.49	2	15.00	12.6	12014	61	3	366 - 373	K.FAQTLMER.G	Oxidation: 6
1048	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	42	467.25	932.49	467.24	932.47	2	16.03	12.8	8468	69	3	431 - 439	R.MGTPALTSR.G
1048	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	13	475.25	948.48	475.24	948.47	2	15.19	11.2	53751	42	5	431 - 439	R.MGTPALTSR.G	Oxidation: 1
1048	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	188	751.76	2252.25	751.75	2252.22	3	16.44	17.9	5023	25	1	374 - 394	R.GYELVSGGTDNHLVLVNLKPK.G
1048	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	114	546.32	1090.63	546.31	1090.61	2	15.77	14.9	9086	87	3	226 - 236	K.LIVAGASAYAR.L
1048	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	41	467.25	932.48	467.24	932.47	2	9.76	12.7	5872	55	3	431 - 439	R.MGTPALTSR.G
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	198	749.38	2245.13	749.37	2245.09	3	18.32	15.1	3636	65	2	346 - 365	K.QATTSEYKAYQEQVLSNSAK.F
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	18	494.74	987.47	494.74	987.47	2	8.82	10.7	4065	54	2	494 - 501	R.HEVEEFAK.Q
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	226	521.26	1040.50	521.25	1040.48	2	16.28	16.1	3744	45	2	440 - 448	R.GFVEEDFAK.V
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	296	533.78	1065.55	533.78	1065.55	2	4.43	18.1	16043	23	3	502 - 510	K.QFPTIGFEK.E
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	94	400.71	799.40	400.70	799.39	2	13.74	12.6	6303	30	3	237 - 242	R.LYDYAR.I
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	321	523.30	1566.88	523.30	1566.87	3	10.72	18.9	14596	45	3	449 - 462	K.VAEYFDKAVTIALK.V
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	298	533.79	1065.56	533.78	1065.55	2	9.13	18.2	4792	53	3	502 - 510	K.QFPTIGFEK.E
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	334	724.38	2170.12	724.37	2170.08	3	15.20	19.2	44304	55	1	472 - 491	K.LKDFVSAMESSSTIQSEIAK.L
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	255	429.23	856.44	429.22	856.43	2	12.82	16.9	142809	19	3	293 - 299	R.GAMIFFR.K	Oxidation: 3
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	42	419.90	1256.67	419.89	1256.65	3	11.44	11.4	31588	42	3	492 - 501	K.LRHEVEEFAK.Q
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	241	687.63	2746.49	687.62	2746.44	4	18.05	16.5	8700	48	3	404 - 430	K.VLEAVHIASNKNTVPGDVSAMVPGGIR.M	Oxidation: 21
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	386	801.42	2401.24	801.41	2401.20	3	15.77	22.2	12745	43	4	50 - 70	K.QLNAPLEEVDPEIADIIEHEK.A
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	372	658.10	2628.38	658.09	2628.34	4	14.34	21.2	4858	56	4	50 - 72	K.QLNAPLEEVDPEIADIIEHEKAR.Q
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	248	729.71	2186.12	729.70	2186.08	3	18.06	16.6	66056	60	3	472 - 491	K.LKDFVSAMESSSTIQSEIAK.L	Oxidation: 8
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	370	658.10	2628.37	658.09	2628.34	4	11.94	21.1	14519	85	4	50 - 72	K.QLNAPLEEVDPEIADIIEHEKAR.Q
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	98	800.40	799.40	800.39	799.39	1	13.82	12.7	14738	29	1	237 - 242	R.LYDYAR.I
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	101	669.35	1336.68	669.34	1336.66	2	16.17	12.8	5215	78	4	354 - 365	K.AYQEQVLSNSAK.F
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	103	669.35	1336.68	669.34	1336.66	2	16.77	12.8	3743	78	4	354 - 365	K.AYQEQVLSNSAK.F
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	51	500.24	998.46	500.23	998.45	2	15.14	11.7	10052	54	3	102 - 110	K.YSEGYPGAR.Y
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	345	737.68	2210.02	737.67	2209.98	3	18.02	19.6	6893	24	1	111 - 128	R.YYGGNEYIDMAETLCQKR.A	Carbamidomethyl: 15
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	124	669.84	1337.67	669.34	1336.66	2	754.40	13.3	62509	22	4	354 - 365	K.AYQEQVLSNSAK.F
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	234	485.28	968.54	485.27	968.53	2	13.04	16.3	11305	16	2	293 - 300	R.GAMIFFRK.G
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	323	784.45	1566.88	784.44	1566.87	2	10.72	19	57814	49	3	449 - 462	K.VAEYFDKAVTIALK.V
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	95	467.25	932.49	467.24	932.47	2	12.09	12.6	16823	69	3	431 - 439	R.MGTPALTSR.G
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	158	462.24	2306.14	462.23	2306.11	5	13.74	14.1	61817	35	1	167 - 187	R.IMALDLPHGGHLSHGYQTDTK.K	Oxidation: 2
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	167	715.48	714.47	715.47	714.46	1	10.07	14.3	94470	19	1	456 - 462	K.AVTIALK.V
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	288	564.07	2252.25	564.06	2252.22	4	13.36	17.7	3655	48	3	374 - 394	R.GYELVSGGTDNHLVLVNLKPK.G
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	263	743.01	2226.01	743.00	2225.97	3	16.56	17.1	1854	36	2	111 - 128	R.YYGGNEYIDMAETLCQKR.A	Oxidation: 10
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	384	801.42	2401.23	801.41	2401.20	3	12.12	22.2	16627	83	4	50 - 70	K.QLNAPLEEVDPEIADIIEHEK.A
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	383	922.73	3686.89	922.72	3686.83	4	15.50	21.9	11084	34	2	252 - 286	K.AVMLADMAHISGLVAANVIPSPFDYADVVTTTTHK.S	Oxidation: 3
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	128	436.22	870.42	436.21	870.41	2	13.59	13.4	53705	15	2	449 - 455	K.VAEYFDK.A
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	84	506.26	1010.50	506.25	1010.49	2	13.13	12.4	6501	47	4	366 - 373	K.FAQTLMER.G	Oxidation: 6
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	23	475.25	948.48	475.24	948.47	2	14.94	10.9	2826	44	3	431 - 439	R.MGTPALTSR.G	Oxidation: 1
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	239	916.50	2746.49	916.49	2746.44	3	17.21	16.4	39748	30	2	404 - 430	K.VLEAVHIASNKNTVPGDVSAMVPGGIR.M	Oxidation: 21
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	213	793.42	1584.82	793.40	1584.79	2	17.11	15.7	5586	51	4	415 - 430	K.NTVPGDVSAMVPGGIR.M	Oxidation: 10
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	258	429.23	856.44	429.22	856.43	2	12.93	17	282509	25	3	293 - 299	R.GAMIFFR.K	Oxidation: 3
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	221	793.42	1584.82	793.40	1584.79	2	16.67	15.9	7794	74	4	415 - 430	K.NTVPGDVSAMVPGGIR.M	Oxidation: 10
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	182	546.32	1090.63	546.31	1090.61	2	15.32	14.8	7009	83	3	226 - 236	K.LIVAGASAYAR.L
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	324	784.45	1566.89	784.44	1566.87	2	14.79	19	11795	50	3	449 - 462	K.VAEYFDKAVTIALK.V
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	376	658.10	2628.38	658.09	2628.34	4	14.76	21.3	17419	50	4	50 - 72	K.QLNAPLEEVDPEIADIIEHEKAR.Q
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	327	523.30	1566.89	523.30	1566.87	3	13.57	19.1	7229	66	3	449 - 462	K.VAEYFDKAVTIALK.V
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	48	500.24	998.46	500.23	998.45	2	15.32	11.6	8796	56	3	102 - 110	K.YSEGYPGAR.Y
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	176	498.26	994.50	498.25	994.49	2	13.67	14.6	72012	63	3	366 - 373	K.FAQTLMER.G
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	93	467.25	932.49	467.24	932.47	2	11.04	12.6	4049	54	3	431 - 439	R.MGTPALTSR.G
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	177	498.26	994.50	498.25	994.49	2	12.69	14.6	28558	69	3	366 - 373	K.FAQTLMER.G
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	385	801.42	2401.23	801.41	2401.20	3	12.52	22.2	16836	49	4	50 - 70	K.QLNAPLEEVDPEIADIIEHEK.A
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	178	498.26	994.50	498.25	994.49	2	12.93	14.6	13846	59	3	366 - 373	K.FAQTLMER.G
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	291	564.07	2252.25	564.06	2252.22	4	15.98	17.8	6456	46	3	374 - 394	R.GYELVSGGTDNHLVLVNLKPK.G
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	261	429.23	856.44	429.22	856.43	2	12.61	17	11734	32	3	293 - 299	R.GAMIFFR.K	Oxidation: 3
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	99	467.25	932.49	467.24	932.47	2	13.44	12.7	4025	63	3	431 - 439	R.MGTPALTSR.G
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	72	460.28	918.54	460.27	918.53	2	12.43	12.1	5471	50	3	218 - 225	K.SATLFRPK.L
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	297	533.79	1065.56	533.78	1065.55	2	12.45	18.2	8592	45	3	502 - 510	K.QFPTIGFEK.E
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	131	436.22	870.43	436.21	870.41	2	18.17	13.5	42006	28	2	449 - 455	K.VAEYFDK.A
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	236	485.28	968.54	485.27	968.53	2	13.95	16.3	24060	24	2	293 - 300	R.GAMIFFRK.G
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	118	590.84	1179.68	590.84	1179.66	2	12.00	13.2	96269	71	2	404 - 414	K.VLEAVHIASNK.N
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	19	494.75	987.48	494.74	987.47	2	10.58	10.8	15819	50	2	494 - 501	R.HEVEEFAK.Q
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	373	877.13	2628.38	877.12	2628.34	3	14.35	21.2	4065	48	1	50 - 72	K.QLNAPLEEVDPEIADIIEHEKAR.Q
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	237	916.50	2746.49	916.49	2746.44	3	16.24	16.3	11965	19	2	404 - 430	K.VLEAVHIASNKNTVPGDVSAMVPGGIR.M	Oxidation: 21
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	108	669.35	1336.68	669.34	1336.66	2	16.04	12.9	7281	49	4	354 - 365	K.AYQEQVLSNSAK.F
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	294	564.07	2252.25	564.06	2252.22	4	14.92	17.9	14429	48	3	374 - 394	R.GYELVSGGTDNHLVLVNLKPK.G
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	212	793.42	1584.82	793.40	1584.79	2	15.61	15.7	4747	58	4	415 - 430	K.NTVPGDVSAMVPGGIR.M	Oxidation: 10
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	290	751.76	2252.25	751.75	2252.22	3	15.98	17.8	12986	33	3	374 - 394	R.GYELVSGGTDNHLVLVNLKPK.G
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	67	460.28	918.54	460.27	918.53	2	8.83	12	15468	50	3	218 - 225	K.SATLFRPK.L
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	43	629.34	1256.67	629.33	1256.65	2	11.45	11.5	24037	34	2	492 - 501	K.LRHEVEEFAK.Q
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	287	751.76	2252.25	751.75	2252.22	3	13.36	17.7	6226	30	3	374 - 394	R.GYELVSGGTDNHLVLVNLKPK.G
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	374	658.10	2628.38	658.09	2628.34	4	14.44	21.2	15819	59	4	50 - 72	K.QLNAPLEEVDPEIADIIEHEKAR.Q
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	215	529.28	1584.82	529.27	1584.79	3	17.10	15.7	7125	41	2	415 - 430	K.NTVPGDVSAMVPGGIR.M	Oxidation: 10
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	87	506.26	1010.50	506.25	1010.49	2	13.52	12.5	6731	51	4	366 - 373	K.FAQTLMER.G	Oxidation: 6
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	185	546.32	1090.63	546.31	1090.61	2	15.55	14.8	13353	87	3	226 - 236	K.LIVAGASAYAR.L
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	266	743.01	2226.01	743.00	2225.97	3	18.81	17.1	4991	27	2	111 - 128	R.YYGGNEYIDMAETLCQKR.A	Oxidation: 10
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	203	911.90	1821.79	911.89	1821.76	2	18.32	15.2	17466	62	1	203 - 217	R.LDESTGYIDYDQMEK.S	Oxidation: 13
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	181	546.32	1090.63	546.31	1090.61	2	14.99	14.7	21200	82	3	226 - 236	K.LIVAGASAYAR.L
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	100	400.71	799.40	400.70	799.39	2	12.32	12.8	25284	27	3	237 - 242	R.LYDYAR.I
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	244	729.71	2186.12	729.70	2186.08	3	18.39	16.5	8167	96	3	472 - 491	K.LKDFVSAMESSSTIQSEIAK.L	Oxidation: 8
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	235	687.63	2746.49	687.62	2746.44	4	16.24	16.3	12891	40	3	404 - 430	K.VLEAVHIASNKNTVPGDVSAMVPGGIR.M	Oxidation: 21
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	121	506.75	1011.49	506.25	1010.49	2	990.08	13.2	77628	22	4	366 - 373	K.FAQTLMER.G	Oxidation: 6
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	46	500.24	998.46	500.23	998.45	2	14.92	11.5	6262	47	3	102 - 110	K.YSEGYPGAR.Y
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	40	419.90	1256.67	419.89	1256.65	3	11.21	11.4	6951	51	3	492 - 501	K.LRHEVEEFAK.Q
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	269	579.28	1156.55	579.27	1156.53	2	17.48	17.2	26040	24	1	311 - 319	K.EVLYDFEDK.I
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	97	400.71	799.40	400.70	799.39	2	13.79	12.7	6096	31	3	237 - 242	R.LYDYAR.I
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	218	529.28	1584.82	529.27	1584.79	3	15.31	15.8	6454	52	2	415 - 430	K.NTVPGDVSAMVPGGIR.M	Oxidation: 10
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	339	421.23	840.44	421.22	840.43	2	10.87	19.3	5068	35	3	293 - 299	R.GAMIFFR.K
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	200	749.38	2245.13	749.37	2245.09	3	18.79	15.2	2766	34	2	346 - 365	K.QATTSEYKAYQEQVLSNSAK.F
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	341	421.23	840.44	421.22	840.43	2	10.23	19.4	6718	43	3	293 - 299	R.GAMIFFR.K
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	81	506.26	1010.50	506.25	1010.49	2	12.53	12.3	4105	55	4	366 - 373	K.FAQTLMER.G	Oxidation: 6
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	116	590.84	1179.67	590.84	1179.66	2	10.71	13.1	13912	80	2	404 - 414	K.VLEAVHIASNK.N
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	69	460.28	918.54	460.27	918.53	2	11.78	12.1	3232	36	3	218 - 225	K.SATLFRPK.L
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	387	801.42	2401.24	801.41	2401.20	3	15.18	22.3	4778	31	4	50 - 70	K.QLNAPLEEVDPEIADIIEHEK.A
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	45	419.90	1256.67	419.89	1256.65	3	12.85	11.5	18870	45	3	492 - 501	K.LRHEVEEFAK.Q
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	105	446.57	1336.68	446.56	1336.66	3	16.76	12.8	6679	24	1	354 - 365	K.AYQEQVLSNSAK.F
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	223	521.26	1040.50	521.25	1040.48	2	18.62	16	13466	45	2	440 - 448	R.GFVEEDFAK.V
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	216	793.42	1584.82	793.40	1584.79	2	15.32	15.8	5688	83	4	415 - 430	K.NTVPGDVSAMVPGGIR.M	Oxidation: 10
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	243	729.71	2186.12	729.70	2186.08	3	17.46	16.5	11046	99	3	472 - 491	K.LKDFVSAMESSSTIQSEIAK.L	Oxidation: 8
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	326	784.45	1566.89	784.44	1566.87	2	13.58	19.1	24985	54	3	449 - 462	K.VAEYFDKAVTIALK.V
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	336	421.23	840.44	421.22	840.43	2	13.41	19.3	3654	43	3	293 - 299	R.GAMIFFR.K
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	238	687.63	2746.49	687.62	2746.44	4	17.21	16.4	11739	40	3	404 - 430	K.VLEAVHIASNKNTVPGDVSAMVPGGIR.M	Oxidation: 21
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	47	629.34	1256.67	629.33	1256.65	2	12.86	11.5	52382	17	2	492 - 501	K.LRHEVEEFAK.Q
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	381	922.73	3686.88	922.72	3686.83	4	13.45	21.8	4580	74	2	252 - 286	K.AVMLADMAHISGLVAANVIPSPFDYADVVTTTTHK.S	Oxidation: 3
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	325	523.30	1566.89	523.30	1566.87	3	14.78	19	6492	60	3	449 - 462	K.VAEYFDKAVTIALK.V
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	293	751.76	2252.25	751.75	2252.22	3	14.92	17.8	7990	22	3	374 - 394	R.GYELVSGGTDNHLVLVNLKPK.G
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	126	487.85	2434.24	487.85	2434.21	5	12.23	13.4	9028	19	1	167 - 188	R.IMALDLPHGGHLSHGYQTDTKK.I	Oxidation: 2
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	21	475.25	948.48	475.24	948.47	2	13.15	10.9	17419	23	3	431 - 439	R.MGTPALTSR.G	Oxidation: 1
1105	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	22	475.25	948.48	475.24	948.47	2	14.35	10.9	6249	47	3	431 - 439	R.MGTPALTSR.G	Oxidation: 1
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	335	442.73	883.45	442.23	882.44	2	1136.89	17.6	4584	20	1	293 - 299	R.GAMIFFR.K	Acetyl: 1
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	253	793.42	1584.82	793.40	1584.79	2	14.77	15.8	22224	71	3	415 - 430	K.NTVPGDVSAMVPGGIR.M	Oxidation: 10
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	499	838.93	1675.84	838.92	1675.83	2	8.21	22.5	5481	72	3	189 - 202	K.ISAVSIFFETMPYR.L	Oxidation: 11
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	487	801.42	2401.23	801.41	2401.20	3	11.60	22.2	6882	53	3	50 - 70	K.QLNAPLEEVDPEIADIIEHEK.A
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	230	911.90	1821.79	911.89	1821.76	2	16.66	15.1	14596	120	2	203 - 217	R.LDESTGYIDYDQMEK.S	Oxidation: 13
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	139	590.84	1179.67	590.84	1179.66	2	11.28	13.1	29618	97	3	404 - 414	K.VLEAVHIASNK.N
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	149	871.43	870.42	871.42	870.41	1	13.21	13.3	44825	38	2	449 - 455	K.VAEYFDK.A
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	217	546.32	1090.63	546.31	1090.61	2	14.38	14.8	80152	83	3	226 - 236	K.LIVAGASAYAR.L
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	470	924.14	2769.39	924.13	2769.36	3	13.21	21.4	164896	40	3	76 - 101	K.GLELIPSENFTSVSVMQAVGSVMTNK.Y	Oxidation: 16
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	63	629.34	1256.66	629.33	1256.65	2	9.32	11.3	28069	26	2	492 - 501	K.LRHEVEEFAK.Q
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	525	830.93	1659.85	830.92	1659.83	2	7.19	24.2	14338	84	2	189 - 202	K.ISAVSIFFETMPYR.L
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	524	830.93	1659.85	830.92	1659.83	2	10.52	24.2	24460	60	2	189 - 202	K.ISAVSIFFETMPYR.L
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	489	596.99	1787.94	596.98	1787.93	3	9.15	22.2	13181	36	1	188 - 202	K.KISAVSIFFETMPYR.L
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	343	564.07	2252.25	564.06	2252.22	4	13.66	17.8	30353	47	3	374 - 394	R.GYELVSGGTDNHLVLVNLKPK.G
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	232	911.90	1821.79	911.89	1821.76	2	16.15	15.2	11472	93	2	203 - 217	R.LDESTGYIDYDQMEK.S	Oxidation: 13
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	194	715.48	714.47	715.47	714.46	1	12.11	14.3	8510	32	3	456 - 462	K.AVTIALK.V
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	251	529.28	1584.82	529.27	1584.79	3	16.59	15.7	30640	66	3	415 - 430	K.NTVPGDVSAMVPGGIR.M	Oxidation: 10
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	125	446.57	1336.68	446.56	1336.66	3	13.49	12.7	45268	36	1	354 - 365	K.AYQEQVLSNSAK.F
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	303	429.23	856.44	429.22	856.43	2	13.42	16.9	69515	29	3	293 - 299	R.GAMIFFR.K	Oxidation: 3
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	128	669.35	1336.68	669.34	1336.66	2	13.90	12.8	9034	64	4	354 - 365	K.AYQEQVLSNSAK.F
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	481	922.73	3686.88	922.72	3686.83	4	13.16	21.9	5752	44	1	252 - 286	K.AVMLADMAHISGLVAANVIPSPFDYADVVTTTTHK.S	Oxidation: 3
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	208	498.26	994.50	498.25	994.49	2	11.61	14.6	45447	62	2	366 - 373	K.FAQTLMER.G
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	42	475.25	948.48	475.24	948.47	2	8.78	10.9	178152	38	3	431 - 439	R.MGTPALTSR.G	Oxidation: 1
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	473	924.14	2769.39	924.13	2769.36	3	11.42	21.5	108119	51	3	76 - 101	K.GLELIPSENFTSVSVMQAVGSVMTNK.Y	Oxidation: 16
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	340	751.76	2252.25	751.75	2252.22	3	12.96	17.7	50674	30	3	374 - 394	R.GYELVSGGTDNHLVLVNLKPK.G
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	146	669.84	1337.67	669.34	1336.66	2	750.83	13.2	31817	26	4	354 - 365	K.AYQEQVLSNSAK.F
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	164	630.37	629.36	630.36	629.35	1	9.85	13.6	6115	15	2	45 - 49	R.VTWPK.Q
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	153	871.43	870.42	871.42	870.41	1	13.33	13.4	13414	43	2	449 - 455	K.VAEYFDK.A
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	450	602.32	1803.95	602.31	1803.92	3	12.21	20.6	12437	46	2	188 - 202	K.KISAVSIFFETMPYR.L	Oxidation: 12
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	503	838.93	1675.85	838.92	1675.83	2	11.92	22.6	114656	84	3	189 - 202	K.ISAVSIFFETMPYR.L	Oxidation: 11
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	447	602.32	1803.95	602.31	1803.92	3	13.57	20.5	16952	70	2	188 - 202	K.KISAVSIFFETMPYR.L	Oxidation: 12
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	247	793.42	1584.82	793.40	1584.79	2	16.32	15.6	55776	61	3	415 - 430	K.NTVPGDVSAMVPGGIR.M	Oxidation: 10
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	254	529.28	1584.82	529.27	1584.79	3	14.76	15.8	5923	57	3	415 - 430	K.NTVPGDVSAMVPGGIR.M	Oxidation: 10
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	263	1041.51	1040.50	1041.49	1040.48	1	16.33	16	45865	39	1	440 - 448	R.GFVEEDFAK.V
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	306	429.23	856.44	429.22	856.43	2	10.95	16.9	68299	35	3	293 - 299	R.GAMIFFR.K	Oxidation: 3
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	408	421.23	840.44	421.22	840.43	2	11.18	19.2	6222	43	2	293 - 299	R.GAMIFFR.K
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	361	1066.57	1065.56	1066.56	1065.55	1	9.95	18.2	5417	38	1	502 - 510	K.QFPTIGFEK.E
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	363	533.79	1065.56	533.78	1065.55	2	11.29	18.2	11975	52	3	502 - 510	K.QFPTIGFEK.E
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	142	590.84	1179.67	590.84	1179.66	2	9.46	13.1	9454	67	3	404 - 414	K.VLEAVHIASNK.N
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	151	436.22	870.42	436.21	870.41	2	13.31	13.3	102694	30	3	449 - 455	K.VAEYFDK.A
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	395	664.13	2652.49	664.12	2652.45	4	13.59	18.9	6926	17	1	320 - 345	K.INQAVFPGLQGGPHNHTITGLAVALK.Q
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	309	429.23	856.44	429.22	856.43	2	11.56	17	27841	32	3	293 - 299	R.GAMIFFR.K	Oxidation: 3
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	94	460.28	918.54	460.27	918.53	2	8.74	12.1	17022	49	3	218 - 225	K.SATLFRPK.L
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	39	475.25	948.48	475.24	948.47	2	10.52	10.8	74110	50	3	431 - 439	R.MGTPALTSR.G	Oxidation: 1
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	313	1157.55	1156.55	1157.54	1156.53	1	16.02	17.1	17014	19	1	311 - 319	K.EVLYDFEDK.I
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	68	419.89	1256.66	419.89	1256.65	3	9.32	11.5	18595	39	3	492 - 501	K.LRHEVEEFAK.Q
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	190	715.48	714.47	715.47	714.46	1	12.65	14.2	42797	42	3	456 - 462	K.AVTIALK.V
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	100	506.26	1010.50	506.25	1010.49	2	11.05	12.2	135750	48	3	366 - 373	K.FAQTLMER.G	Oxidation: 6
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	342	751.76	2252.25	751.75	2252.22	3	13.66	17.8	34229	30	3	374 - 394	R.GYELVSGGTDNHLVLVNLKPK.G
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	148	436.22	870.42	436.21	870.41	2	13.20	13.3	114656	34	3	449 - 455	K.VAEYFDK.A
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	121	669.35	1336.68	669.34	1336.66	2	14.10	12.7	128504	63	4	354 - 365	K.AYQEQVLSNSAK.F
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	250	793.42	1584.82	793.40	1584.79	2	16.61	15.7	75811	73	3	415 - 430	K.NTVPGDVSAMVPGGIR.M	Oxidation: 10
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	403	724.38	2170.11	724.37	2170.08	3	14.22	19.1	5489	50	1	472 - 491	K.LKDFVSAMESSSTIQSEIAK.L
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	256	529.28	1584.82	529.27	1584.79	3	15.74	15.8	7215	64	3	415 - 430	K.NTVPGDVSAMVPGGIR.M	Oxidation: 10
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	500	838.93	1675.85	838.92	1675.83	2	11.15	22.5	109907	72	3	189 - 202	K.ISAVSIFFETMPYR.L	Oxidation: 11
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	145	436.22	870.42	436.21	870.41	2	13.10	13.2	109907	29	3	449 - 455	K.VAEYFDK.A
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	469	924.14	2769.39	924.13	2769.36	3	12.48	21.4	20471	36	3	76 - 101	K.GLELIPSENFTSVSVMQAVGSVMTNK.Y	Oxidation: 16
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	504	559.62	1675.85	559.62	1675.83	3	11.91	22.6	44825	52	3	189 - 202	K.ISAVSIFFETMPYR.L	Oxidation: 11
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	61	419.89	1256.66	419.89	1256.65	3	9.30	11.3	121083	43	3	492 - 501	K.LRHEVEEFAK.Q
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	166	630.37	629.36	630.36	629.35	1	10.75	13.7	19023	18	2	45 - 49	R.VTWPK.Q
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	45	475.25	948.48	475.24	948.47	2	10.96	11	13881	42	3	431 - 439	R.MGTPALTSR.G	Oxidation: 1
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	505	559.62	1675.85	559.62	1675.83	3	12.40	22.6	36610	40	3	189 - 202	K.ISAVSIFFETMPYR.L	Oxidation: 11
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	490	801.42	2401.23	801.41	2401.20	3	10.31	22.2	15604	65	3	50 - 70	K.QLNAPLEEVDPEIADIIEHEK.A
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	70	500.24	998.46	500.23	998.45	2	11.40	11.5	45336	63	3	102 - 110	K.YSEGYPGAR.Y
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	213	546.32	1090.63	546.31	1090.61	2	13.08	14.7	54975	76	3	226 - 236	K.LIVAGASAYAR.L
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	262	521.26	1040.50	521.25	1040.48	2	16.32	16	93427	42	2	440 - 448	R.GFVEEDFAK.V
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	136	590.84	1179.67	590.84	1179.66	2	10.64	13	59463	78	3	404 - 414	K.VLEAVHIASNK.N
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	169	706.40	705.39	706.39	705.38	1	11.38	13.7	24460	38	2	129 - 134	R.ALEAFR.L
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	294	687.88	2747.47	687.62	2746.44	4	374.89	16.7	9976	27	2	404 - 430	K.VLEAVHIASNKNTVPGDVSAMVPGGIR.M	Oxidation: 21
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	345	751.76	2252.25	751.75	2252.22	3	13.22	17.8	10457	27	3	374 - 394	R.GYELVSGGTDNHLVLVNLKPK.G
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	172	706.40	705.39	706.39	705.38	1	14.47	13.8	37949	17	2	129 - 134	R.ALEAFR.L
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	317	579.28	1156.55	579.27	1156.53	2	15.66	17.2	7062	42	2	311 - 319	K.EVLYDFEDK.I
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	214	546.32	1090.63	546.31	1090.61	2	14.73	14.8	286435	73	3	226 - 236	K.LIVAGASAYAR.L
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	106	506.26	1010.50	506.25	1010.49	2	11.25	12.3	12246	47	3	366 - 373	K.FAQTLMER.G	Oxidation: 6
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	341	564.07	2252.25	564.06	2252.22	4	12.97	17.7	13003	43	3	374 - 394	R.GYELVSGGTDNHLVLVNLKPK.G
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	410	421.23	840.44	421.22	840.43	2	9.59	19.3	51775	34	2	293 - 299	R.GAMIFFR.K
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	118	400.70	799.39	400.70	799.39	2	10.37	12.6	108119	26	3	237 - 242	R.LYDYAR.I
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	205	498.26	994.50	498.25	994.49	2	11.45	14.6	25817	56	2	366 - 373	K.FAQTLMER.G
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	115	400.71	799.40	400.70	799.39	2	11.47	12.5	164896	23	3	237 - 242	R.LYDYAR.I
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	346	564.07	2252.25	564.06	2252.22	4	13.21	17.8	7616	33	3	374 - 394	R.GYELVSGGTDNHLVLVNLKPK.G
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	486	801.42	2401.23	801.41	2401.20	3	11.16	22.1	9884	106	3	50 - 70	K.QLNAPLEEVDPEIADIIEHEK.A
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	124	669.35	1336.68	669.34	1336.66	2	13.50	12.7	12723	74	4	354 - 365	K.AYQEQVLSNSAK.F
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	501	559.62	1675.85	559.62	1675.83	3	11.15	22.5	31817	69	3	189 - 202	K.ISAVSIFFETMPYR.L	Oxidation: 11
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	187	715.48	714.47	715.47	714.46	1	11.98	14.2	62069	39	3	456 - 462	K.AVTIALK.V
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	312	579.28	1156.55	579.27	1156.53	2	16.01	17.1	18238	59	2	311 - 319	K.EVLYDFEDK.I
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	289	729.71	2186.11	729.70	2186.08	3	16.74	16.5	21952	63	2	472 - 491	K.LKDFVSAMESSSTIQSEIAK.L	Oxidation: 8
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	123	400.70	799.39	400.70	799.39	2	9.00	12.7	17860	22	3	237 - 242	R.LYDYAR.I
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	64	419.89	1256.66	419.89	1256.65	3	8.78	11.4	89491	45	3	492 - 501	K.LRHEVEEFAK.Q
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	360	533.79	1065.56	533.78	1065.55	2	9.96	18.2	7191	50	3	502 - 510	K.QFPTIGFEK.E
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	30	494.74	987.47	494.74	987.47	2	8.56	10.6	26362	54	2	494 - 501	R.HEVEEFAK.Q
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	285	729.71	2186.11	729.70	2186.08	3	16.53	16.5	124454	101	2	472 - 491	K.LKDFVSAMESSSTIQSEIAK.L	Oxidation: 8
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	65	500.24	998.46	500.23	998.45	2	13.12	11.4	52463	53	3	102 - 110	K.YSEGYPGAR.Y
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	103	506.26	1010.50	506.25	1010.49	2	12.32	12.3	79785	48	3	366 - 373	K.FAQTLMER.G	Oxidation: 6
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	357	533.79	1065.56	533.78	1065.55	2	10.88	18.1	24485	45	3	502 - 510	K.QFPTIGFEK.E
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	91	460.28	918.54	460.27	918.53	2	8.31	12	61007	41	3	218 - 225	K.SATLFRPK.L
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	67	500.24	998.46	500.23	998.45	2	14.02	11.5	90009	57	3	102 - 110	K.YSEGYPGAR.Y
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	35	494.74	987.47	494.74	987.47	2	8.17	10.7	7804	41	2	494 - 501	R.HEVEEFAK.Q
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	293	687.87	2747.47	687.62	2746.44	4	372.22	16.6	4131	19	2	404 - 430	K.VLEAVHIASNKNTVPGDVSAMVPGGIR.M	Oxidation: 21
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	88	460.28	918.54	460.27	918.53	2	7.98	11.9	69569	46	3	218 - 225	K.SATLFRPK.L
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	265	521.26	1040.50	521.25	1040.48	2	14.28	16	33383	42	2	440 - 448	R.GFVEEDFAK.V
1159	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	66	629.34	1256.66	629.33	1256.65	2	8.78	11.4	20988	27	2	492 - 501	K.LRHEVEEFAK.Q
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	419	737.67	2210.00	737.67	2209.98	3	10.23	19.3	15169	35	2	111 - 128	R.YYGGNEYIDMAETLCQKR.A	Carbamidomethyl: 15
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	208	498.26	994.50	498.25	994.49	2	6.37	14.4	61271	51	3	366 - 373	K.FAQTLMER.G
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	83	460.27	918.53	460.27	918.53	2	6.61	11.6	45346	38	3	218 - 225	K.SATLFRPK.L
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	210	995.50	994.50	995.50	994.49	1	6.38	14.4	4878	26	1	366 - 373	K.FAQTLMER.G
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	171	706.39	705.39	706.39	705.38	1	6.74	13.5	5803	31	2	129 - 134	R.ALEAFR.L
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	38	494.74	987.47	494.74	987.47	2	1.16	10.5	64294	54	3	494 - 501	R.HEVEEFAK.Q
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	347	564.07	2252.23	564.06	2252.22	4	7.81	17.6	4467	50	3	374 - 394	R.GYELVSGGTDNHLVLVNLKPK.G
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	130	446.57	1336.68	446.56	1336.66	3	9.66	12.6	20444	49	1	354 - 365	K.AYQEQVLSNSAK.F
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	234	573.54	2290.13	573.54	2290.12	4	5.41	14.9	175695	31	1	167 - 187	R.IMALDLPHGGHLSHGYQTDTK.K
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	113	467.25	932.48	467.24	932.47	2	4.19	12.2	24240	57	3	431 - 439	R.MGTPALTSR.G
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	450	1027.95	2053.89	1027.95	2053.88	2	8.35	20.3	35937	40	3	111 - 127	R.YYGGNEYIDMAETLCQK.R	Carbamidomethyl: 15
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	371	785.41	1568.81	785.41	1568.80	2	8.96	18.1	51625	62	3	415 - 430	K.NTVPGDVSAMVPGGIR.M
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	69	419.89	1256.66	419.89	1256.65	3	8.32	11.2	48136	40	3	492 - 501	K.LRHEVEEFAK.Q
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	254	793.41	1584.81	793.40	1584.79	2	8.10	15.5	17429	51	3	415 - 430	K.NTVPGDVSAMVPGGIR.M	Oxidation: 10
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	255	793.41	1584.81	793.40	1584.79	2	8.51	15.5	48828	75	3	415 - 430	K.NTVPGDVSAMVPGGIR.M	Oxidation: 10
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	409	421.22	840.44	421.22	840.43	2	4.46	19	4890	36	3	293 - 299	R.GAMIFFR.K
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	533	918.80	2753.38	918.79	2753.36	3	7.98	23.1	5904	53	3	76 - 101	K.GLELIPSENFTSVSVMQAVGSVMTNK.Y	Oxidation: 16
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	378	785.41	1568.81	785.41	1568.80	2	7.63	18.3	28169	64	3	415 - 430	K.NTVPGDVSAMVPGGIR.M
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	555	554.29	1659.84	554.28	1659.83	3	1.98	24.1	12925	46	2	189 - 202	K.ISAVSIFFETMPYR.L
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	261	521.25	1040.50	521.25	1040.48	2	13.31	15.6	58178	42	3	440 - 448	R.GFVEEDFAK.V
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	518	838.93	1675.84	838.92	1675.83	2	7.78	22.5	3603	77	3	189 - 202	K.ISAVSIFFETMPYR.L	Oxidation: 11
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	344	564.07	2252.23	564.06	2252.22	4	7.52	17.5	5263	49	3	374 - 394	R.GYELVSGGTDNHLVLVNLKPK.G
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	275	485.27	968.53	485.27	968.53	2	3.99	16	32999	37	3	293 - 300	R.GAMIFFRK.G
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	421	737.67	2210.00	737.67	2209.98	3	9.06	19.4	37499	39	2	111 - 128	R.YYGGNEYIDMAETLCQKR.A	Carbamidomethyl: 15
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	515	838.93	1675.84	838.92	1675.83	2	8.13	22.4	32418	100	3	189 - 202	K.ISAVSIFFETMPYR.L	Oxidation: 11
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	288	729.71	2186.10	729.70	2186.08	3	9.93	16.2	112496	92	3	472 - 491	K.LKDFVSAMESSSTIQSEIAK.L	Oxidation: 8
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	190	715.48	714.47	715.47	714.46	1	7.88	14	4296	44	3	456 - 462	K.AVTIALK.V
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	67	500.24	998.46	500.23	998.45	2	10.54	11.2	15480	55	3	102 - 110	K.YSEGYPGAR.Y
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	359	533.79	1065.56	533.78	1065.55	2	6.01	17.9	103868	48	5	502 - 510	K.QFPTIGFEK.E
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	343	751.75	2252.23	751.75	2252.22	3	4.58	17.5	21948	28	3	374 - 394	R.GYELVSGGTDNHLVLVNLKPK.G
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	146	871.43	870.42	871.42	870.41	1	8.98	13	12103	38	3	449 - 455	K.VAEYFDK.A
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	238	911.90	1821.78	911.89	1821.76	2	11.27	15.1	69828	89	2	203 - 217	R.LDESTGYIDYDQMEK.S	Oxidation: 13
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	519	559.62	1675.84	559.62	1675.83	3	7.77	22.5	5855	50	3	189 - 202	K.ISAVSIFFETMPYR.L	Oxidation: 11
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	283	687.62	2746.46	687.62	2746.44	4	7.23	16.1	102409	41	3	404 - 430	K.VLEAVHIASNKNTVPGDVSAMVPGGIR.M	Oxidation: 21
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	514	559.62	1675.84	559.62	1675.83	3	7.16	22.4	85661	67	3	189 - 202	K.ISAVSIFFETMPYR.L	Oxidation: 11
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	140	590.84	1179.67	590.84	1179.66	2	7.71	12.8	183069	77	3	404 - 414	K.VLEAVHIASNK.N
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	137	590.84	1179.67	590.84	1179.66	2	7.51	12.8	131325	80	3	404 - 414	K.VLEAVHIASNK.N
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	364	683.62	2730.47	683.62	2730.45	4	7.48	18	20743	30	1	404 - 430	K.VLEAVHIASNKNTVPGDVSAMVPGGIR.M
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	39	494.74	987.47	494.74	987.47	2	0.05	10.6	36776	43	3	494 - 501	R.HEVEEFAK.Q
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	484	924.13	2769.38	924.13	2769.36	3	9.59	21.5	22505	83	3	76 - 101	K.GLELIPSENFTSVSVMQAVGSVMTNK.Y	Oxidation: 16
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	112	467.25	932.48	467.24	932.47	2	5.26	12.2	18947	54	3	431 - 439	R.MGTPALTSR.G
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	412	724.37	2170.10	724.37	2170.08	3	9.00	19	9889	92	2	472 - 491	K.LKDFVSAMESSSTIQSEIAK.L
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	257	793.41	1584.81	793.40	1584.79	2	9.41	15.6	12947	94	3	415 - 430	K.NTVPGDVSAMVPGGIR.M	Oxidation: 10
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	267	1041.50	1040.49	1041.49	1040.48	1	8.36	15.8	37088	50	3	440 - 448	R.GFVEEDFAK.V
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	169	706.39	705.39	706.39	705.38	1	6.13	13.5	3131	25	2	129 - 134	R.ALEAFR.L
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	350	1127.12	2252.23	1127.12	2252.22	2	6.80	17.7	35051	20	1	374 - 394	R.GYELVSGGTDNHLVLVNLKPK.G
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	48	475.25	948.48	475.24	948.47	2	8.31	10.8	13804	38	3	431 - 439	R.MGTPALTSR.G	Oxidation: 1
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	256	529.28	1584.81	529.27	1584.79	3	8.51	15.5	17948	69	3	415 - 430	K.NTVPGDVSAMVPGGIR.M	Oxidation: 10
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	375	523.94	1568.81	523.94	1568.80	3	9.13	18.2	98397	45	2	415 - 430	K.NTVPGDVSAMVPGGIR.M
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	188	577.54	2306.14	577.54	2306.11	4	10.57	13.9	15217	21	2	167 - 187	R.IMALDLPHGGHLSHGYQTDTK.K	Oxidation: 2
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	305	429.22	856.43	429.22	856.43	2	5.80	16.6	27537	37	3	293 - 299	R.GAMIFFR.K	Oxidation: 3
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	446	1027.96	2053.90	1027.95	2053.88	2	13.16	20.2	4934	96	3	111 - 127	R.YYGGNEYIDMAETLCQK.R	Carbamidomethyl: 15
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	402	523.30	1566.88	523.30	1566.87	3	7.86	18.8	18457	62	2	449 - 462	K.VAEYFDKAVTIALK.V
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	410	421.23	840.44	421.22	840.43	2	5.43	19	32819	35	3	293 - 299	R.GAMIFFR.K
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	154	487.85	2434.22	487.85	2434.21	5	6.84	13.2	12027	26	1	167 - 188	R.IMALDLPHGGHLSHGYQTDTKK.I	Oxidation: 2
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	136	590.84	1179.67	590.84	1179.66	2	6.50	12.7	13023	89	3	404 - 414	K.VLEAVHIASNK.N
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	363	1066.56	1065.56	1066.56	1065.55	1	6.54	17.9	19264	49	3	502 - 510	K.QFPTIGFEK.E
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	553	830.93	1659.84	830.92	1659.83	2	1.98	24.1	3615	91	2	189 - 202	K.ISAVSIFFETMPYR.L
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	475	658.10	2628.35	658.09	2628.34	4	5.78	21.2	47072	40	3	50 - 72	K.QLNAPLEEVDPEIADIIEHEKAR.Q
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	104	506.25	1010.49	506.25	1010.49	2	7.66	12	169016	58	3	366 - 373	K.FAQTLMER.G	Oxidation: 6
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	116	400.70	799.39	400.70	799.39	2	7.08	12.3	54622	31	3	237 - 242	R.LYDYAR.I
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	118	467.25	932.48	467.24	932.47	2	5.92	12.3	12024	60	3	431 - 439	R.MGTPALTSR.G
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	556	830.93	1659.84	830.92	1659.83	2	5.59	24.2	4774	96	2	189 - 202	K.ISAVSIFFETMPYR.L
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	196	715.48	714.47	715.47	714.46	1	5.29	14.1	4639	38	3	456 - 462	K.AVTIALK.V
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	317	579.28	1156.54	579.27	1156.53	2	9.79	16.9	186491	65	2	311 - 319	K.EVLYDFEDK.I
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	151	436.22	870.42	436.21	870.41	2	7.86	13.1	4820	30	3	449 - 455	K.VAEYFDK.A
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	214	546.32	1090.62	546.31	1090.61	2	7.87	14.5	215821	83	3	226 - 236	K.LIVAGASAYAR.L
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	345	751.75	2252.23	751.75	2252.22	3	7.52	17.5	5469	33	3	374 - 394	R.GYELVSGGTDNHLVLVNLKPK.G
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	71	500.24	998.46	500.23	998.45	2	11.10	11.3	63068	54	3	102 - 110	K.YSEGYPGAR.Y
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	235	911.90	1821.78	911.89	1821.76	2	10.23	15	140076	113	2	203 - 217	R.LDESTGYIDYDQMEK.S	Oxidation: 13
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	281	485.27	968.53	485.27	968.53	2	1.85	16.1	6356	43	3	293 - 300	R.GAMIFFRK.G
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	117	800.40	799.39	800.39	799.39	1	7.08	12.3	29606	24	3	237 - 242	R.LYDYAR.I
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	265	1041.50	1040.49	1041.49	1040.48	1	10.14	15.7	38077	53	3	440 - 448	R.GFVEEDFAK.V
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	530	918.80	2753.39	918.79	2753.36	3	10.36	22.8	6905	55	3	76 - 101	K.GLELIPSENFTSVSVMQAVGSVMTNK.Y	Oxidation: 23
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	156	406.71	2434.22	406.71	2434.21	6	6.83	13.2	79599	26	1	167 - 188	R.IMALDLPHGGHLSHGYQTDTKK.I	Oxidation: 2
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	217	546.32	1090.62	546.31	1090.61	2	8.16	14.6	84550	74	3	226 - 236	K.LIVAGASAYAR.L
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	37	494.74	987.47	494.74	987.47	2	1.00	10.5	107766	54	3	494 - 501	R.HEVEEFAK.Q
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	493	922.72	3686.86	922.72	3686.83	4	6.82	21.9	28827	25	2	252 - 286	K.AVMLADMAHISGLVAANVIPSPFDYADVVTTTTHK.S	Oxidation: 3
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	65	419.89	1256.66	419.89	1256.65	3	7.06	11.2	6303	43	3	492 - 501	K.LRHEVEEFAK.Q
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	211	498.26	994.50	498.25	994.49	2	6.91	14.5	74673	54	3	366 - 373	K.FAQTLMER.G
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	472	658.10	2628.36	658.09	2628.34	4	6.28	21.1	29606	45	3	50 - 72	K.QLNAPLEEVDPEIADIIEHEKAR.Q
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	287	687.62	2746.47	687.62	2746.44	4	8.16	16.2	31525	52	3	404 - 430	K.VLEAVHIASNKNTVPGDVSAMVPGGIR.M	Oxidation: 21
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	145	436.22	870.42	436.21	870.41	2	8.98	13	14957	24	3	449 - 455	K.VAEYFDK.A
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	152	871.43	870.42	871.42	870.41	1	7.87	13.1	30626	36	3	449 - 455	K.VAEYFDK.A
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	284	687.63	2746.47	687.62	2746.44	4	10.64	16.2	63513	49	3	404 - 430	K.VLEAVHIASNKNTVPGDVSAMVPGGIR.M	Oxidation: 21
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	232	749.38	2245.11	749.37	2245.09	3	10.81	14.9	93742	59	1	346 - 365	K.QATTSEYKAYQEQVLSNSAK.F
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	290	729.71	2186.10	729.70	2186.08	3	10.36	16.3	27757	95	3	472 - 491	K.LKDFVSAMESSSTIQSEIAK.L	Oxidation: 8
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	399	523.30	1566.88	523.30	1566.87	3	7.02	18.8	17945	52	2	449 - 462	K.VAEYFDKAVTIALK.V
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	527	918.80	2753.38	918.79	2753.36	3	7.84	22.8	5862	50	3	76 - 101	K.GLELIPSENFTSVSVMQAVGSVMTNK.Y	Oxidation: 23
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	516	559.62	1675.84	559.62	1675.83	3	8.13	22.4	21578	76	3	189 - 202	K.ISAVSIFFETMPYR.L	Oxidation: 11
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	300	903.90	1805.79	903.89	1805.77	2	11.76	16.5	18002	108	2	203 - 217	R.LDESTGYIDYDQMEK.S
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	491	922.72	3686.87	922.72	3686.83	4	10.02	21.8	13023	36	2	252 - 286	K.AVMLADMAHISGLVAANVIPSPFDYADVVTTTTHK.S	Oxidation: 3
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	266	521.25	1040.49	521.25	1040.48	2	8.36	15.8	13569	42	3	440 - 448	R.GFVEEDFAK.V
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	193	715.48	714.47	715.47	714.46	1	7.27	14.1	15450	39	3	456 - 462	K.AVTIALK.V
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	123	800.40	799.39	800.39	799.39	1	6.53	12.4	39474	16	3	237 - 242	R.LYDYAR.I
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	44	475.24	948.47	475.24	948.47	2	5.22	10.6	17945	46	3	431 - 439	R.MGTPALTSR.G	Oxidation: 1
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	233	459.03	2290.13	459.03	2290.12	5	5.39	14.9	36019	27	1	167 - 187	R.IMALDLPHGGHLSHGYQTDTK.K
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	469	658.10	2628.36	658.09	2628.34	4	7.74	21.1	26715	76	3	50 - 72	K.QLNAPLEEVDPEIADIIEHEKAR.Q
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	114	400.70	799.39	400.70	799.39	2	9.67	12.2	26715	31	3	237 - 242	R.LYDYAR.I
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	360	1066.56	1065.56	1066.56	1065.55	1	6.02	17.9	30451	48	3	502 - 510	K.QFPTIGFEK.E
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	72	999.46	998.46	999.45	998.45	1	11.12	11.3	10361	16	2	102 - 110	K.YSEGYPGAR.Y
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	366	1066.56	1065.56	1066.56	1065.55	1	6.97	18	21975	24	3	502 - 510	K.QFPTIGFEK.E
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	529	918.80	2753.38	918.79	2753.36	3	8.02	22.8	4380	56	3	76 - 101	K.GLELIPSENFTSVSVMQAVGSVMTNK.Y	Oxidation: 23
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	411	841.44	840.44	841.44	840.43	1	5.45	19	8954	19	1	293 - 299	R.GAMIFFR.K
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	414	421.22	840.44	421.22	840.43	2	4.22	19.1	6376	43	3	293 - 299	R.GAMIFFR.K
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	120	800.40	799.39	800.39	799.39	1	7.25	12.4	47072	26	3	237 - 242	R.LYDYAR.I
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	107	506.25	1010.49	506.25	1010.49	2	7.64	12.1	211956	59	3	366 - 373	K.FAQTLMER.G	Oxidation: 6
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	314	743.01	2226.00	743.00	2225.97	3	12.20	16.8	234155	32	2	111 - 128	R.YYGGNEYIDMAETLCQKR.A	Oxidation: 10
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	501	801.42	2401.23	801.41	2401.20	3	9.93	22.1	12103	83	3	50 - 70	K.QLNAPLEEVDPEIADIIEHEK.A
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	342	564.06	2252.23	564.06	2252.22	4	4.58	17.5	13425	51	3	374 - 394	R.GYELVSGGTDNHLVLVNLKPK.G
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	66	629.34	1256.66	629.33	1256.65	2	7.06	11.2	37499	34	2	492 - 501	K.LRHEVEEFAK.Q
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	148	436.22	870.42	436.21	870.41	2	9.48	13	5925	32	3	449 - 455	K.VAEYFDK.A
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	294	729.71	2186.10	729.70	2186.08	3	10.37	16.4	48133	102	3	472 - 491	K.LKDFVSAMESSSTIQSEIAK.L	Oxidation: 8
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	96	437.25	872.49	437.25	872.49	2	6.07	11.8	15138	19	1	43 - 49	R.SRVTWPK.Q
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	479	924.14	2769.39	924.13	2769.36	3	12.99	21.3	5635	42	3	76 - 101	K.GLELIPSENFTSVSVMQAVGSVMTNK.Y	Oxidation: 16
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	149	871.43	870.42	871.42	870.41	1	9.50	13	15710	38	3	449 - 455	K.VAEYFDK.A
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	400	664.13	2652.48	664.12	2652.45	4	9.60	18.8	16809	19	2	320 - 345	K.INQAVFPGLQGGPHNHTITGLAVALK.Q
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	373	523.94	1568.81	523.94	1568.80	3	8.95	18.2	20305	60	2	415 - 430	K.NTVPGDVSAMVPGGIR.M
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	403	664.12	2652.47	664.12	2652.45	4	7.70	18.8	13804	20	2	320 - 345	K.INQAVFPGLQGGPHNHTITGLAVALK.Q
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	398	784.45	1566.88	784.44	1566.87	2	7.01	18.7	22045	72	2	449 - 462	K.VAEYFDKAVTIALK.V
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	447	1027.96	2053.90	1027.95	2053.88	2	9.75	20.2	28389	85	3	111 - 127	R.YYGGNEYIDMAETLCQK.R	Carbamidomethyl: 15
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	205	498.26	994.50	498.25	994.49	2	5.14	14.3	49182	59	3	366 - 373	K.FAQTLMER.G
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	381	534.28	1066.54	533.78	1065.55	2	923.68	18.4	68073	46	5	502 - 510	K.QFPTIGFEK.E
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	497	596.99	1787.94	596.98	1787.93	3	6.22	22	11005	73	2	188 - 202	K.KISAVSIFFETMPYR.L
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	496	801.41	2401.21	801.41	2401.20	3	5.41	22	40556	50	3	50 - 70	K.QLNAPLEEVDPEIADIIEHEK.A
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	303	903.90	1805.79	903.89	1805.77	2	12.28	16.6	99684	116	2	203 - 217	R.LDESTGYIDYDQMEK.S
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	313	743.01	2226.01	743.00	2225.97	3	15.57	16.8	3512	35	2	111 - 128	R.YYGGNEYIDMAETLCQKR.A	Oxidation: 10
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	121	669.84	1337.66	669.34	1336.66	2	746.10	12.4	5580	74	3	354 - 365	K.AYQEQVLSNSAK.F
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	437	604.32	3016.59	604.32	3016.57	5	6.32	19.7	20777	36	1	140 - 166	K.WGVNVQPLSGSPANFHVYTALLKPHER.I
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	122	669.34	1336.67	669.34	1336.66	2	8.73	12.4	165826	84	3	354 - 365	K.AYQEQVLSNSAK.F
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	269	1041.50	1040.49	1041.49	1040.48	1	9.06	15.8	15307	45	3	440 - 448	R.GFVEEDFAK.V
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	86	460.27	918.53	460.27	918.53	2	6.02	11.6	21071	36	3	218 - 225	K.SATLFRPK.L
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	500	596.99	1787.94	596.98	1787.93	3	4.40	22.1	14957	35	2	188 - 202	K.KISAVSIFFETMPYR.L
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	192	462.23	2306.13	462.23	2306.11	5	8.20	14	4508	33	2	167 - 187	R.IMALDLPHGGHLSHGYQTDTK.K	Oxidation: 2
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	168	630.37	629.36	630.36	629.35	1	7.47	13.4	32537	19	1	45 - 49	R.VTWPK.Q
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	379	534.28	1066.54	533.78	1065.55	2	924.99	18.3	29914	38	5	502 - 510	K.QFPTIGFEK.E
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	101	506.25	1010.49	506.25	1010.49	2	7.50	12	104783	47	3	366 - 373	K.FAQTLMER.G	Oxidation: 6
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	365	533.79	1065.56	533.78	1065.55	2	6.98	18	36009	47	5	502 - 510	K.QFPTIGFEK.E
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	340	1035.95	2069.90	1035.94	2069.87	2	11.76	17.4	27369	75	1	111 - 127	R.YYGGNEYIDMAETLCQK.R	Oxidation: 10
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	408	724.37	2170.10	724.37	2170.08	3	8.54	19	9196	99	2	472 - 491	K.LKDFVSAMESSSTIQSEIAK.L
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	362	533.79	1065.56	533.78	1065.55	2	6.55	17.9	71721	42	5	502 - 510	K.QFPTIGFEK.E
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	458	602.32	1803.93	602.31	1803.92	3	4.97	20.4	44768	25	3	188 - 202	K.KISAVSIFFETMPYR.L	Oxidation: 12
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	558	554.29	1659.84	554.28	1659.83	3	5.58	24.2	9145	32	2	189 - 202	K.ISAVSIFFETMPYR.L
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	189	462.23	2306.14	462.23	2306.11	5	10.56	13.9	25528	41	2	167 - 187	R.IMALDLPHGGHLSHGYQTDTK.K	Oxidation: 2
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	320	579.28	1156.54	579.27	1156.53	2	9.16	17	29408	41	2	311 - 319	K.EVLYDFEDK.I
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	348	751.75	2252.23	751.75	2252.22	3	7.80	17.6	16735	40	3	374 - 394	R.GYELVSGGTDNHLVLVNLKPK.G
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	453	602.32	1803.93	602.31	1803.92	3	6.39	20.3	42676	52	3	188 - 202	K.KISAVSIFFETMPYR.L	Oxidation: 12
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	46	475.25	948.48	475.24	948.47	2	8.10	10.7	53759	42	3	431 - 439	R.MGTPALTSR.G	Oxidation: 1
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	513	838.93	1675.84	838.92	1675.83	2	7.17	22.4	90967	97	3	189 - 202	K.ISAVSIFFETMPYR.L	Oxidation: 11
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	308	429.22	856.43	429.22	856.43	2	6.08	16.7	17252	27	3	293 - 299	R.GAMIFFR.K	Oxidation: 3
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	237	608.27	1821.78	608.26	1821.76	3	10.22	15	231424	45	1	203 - 217	R.LDESTGYIDYDQMEK.S	Oxidation: 13
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	62	419.89	1256.66	419.89	1256.65	3	5.97	11.1	19014	41	3	492 - 501	K.LRHEVEEFAK.Q
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	258	529.28	1584.81	529.27	1584.79	3	9.42	15.6	36046	78	3	415 - 430	K.NTVPGDVSAMVPGGIR.M	Oxidation: 10
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	481	924.14	2769.38	924.13	2769.36	3	10.08	21.4	8961	103	3	76 - 101	K.GLELIPSENFTSVSVMQAVGSVMTNK.Y	Oxidation: 16
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	311	429.22	856.43	429.22	856.43	2	5.94	16.8	32468	26	3	293 - 299	R.GAMIFFR.K	Oxidation: 3
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	291	430.24	1287.69	430.23	1287.68	3	6.48	16.3	323564	29	1	129 - 139	R.ALEAFRLDPEK.W
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	81	460.27	918.53	460.27	918.53	2	6.83	11.5	37175	34	3	218 - 225	K.SATLFRPK.L
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	449	685.64	2053.90	685.63	2053.88	3	9.74	20.2	5365	37	1	111 - 127	R.YYGGNEYIDMAETLCQK.R	Carbamidomethyl: 15
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	278	485.27	968.53	485.27	968.53	2	5.23	16	7076	39	3	293 - 300	R.GAMIFFRK.G
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	191	577.54	2306.13	577.54	2306.11	4	8.21	14	8305	23	2	167 - 187	R.IMALDLPHGGHLSHGYQTDTK.K	Oxidation: 2
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	68	500.24	998.46	500.23	998.45	2	12.64	11.2	141655	52	3	102 - 110	K.YSEGYPGAR.Y
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	401	784.45	1566.88	784.44	1566.87	2	7.85	18.8	53759	70	2	449 - 462	K.VAEYFDKAVTIALK.V
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	374	785.41	1568.81	785.41	1568.80	2	9.14	18.2	269374	71	3	415 - 430	K.NTVPGDVSAMVPGGIR.M
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	63	629.34	1256.66	629.33	1256.65	2	5.98	11.1	19519	41	2	492 - 501	K.LRHEVEEFAK.Q
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	263	521.25	1040.49	521.25	1040.48	2	10.12	15.7	15022	42	3	440 - 448	R.GFVEEDFAK.V
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	534	918.80	2753.38	918.79	2753.36	3	8.21	23.2	5296	40	3	76 - 101	K.GLELIPSENFTSVSVMQAVGSVMTNK.Y	Oxidation: 16
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	535	918.80	2753.39	918.79	2753.36	3	9.03	23.2	7608	57	3	76 - 101	K.GLELIPSENFTSVSVMQAVGSVMTNK.Y	Oxidation: 16
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	125	669.35	1336.68	669.34	1336.66	2	11.16	12.5	12171	75	3	354 - 365	K.AYQEQVLSNSAK.F
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	70	999.47	998.46	999.45	998.45	1	12.65	11.2	3671	21	2	102 - 110	K.YSEGYPGAR.Y
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	454	902.97	1803.93	902.97	1803.92	2	6.39	20.3	33682	38	1	188 - 202	K.KISAVSIFFETMPYR.L	Oxidation: 12
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	498	801.41	2401.22	801.41	2401.20	3	8.98	22	73789	85	3	50 - 70	K.QLNAPLEEVDPEIADIIEHEK.A
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	260	529.28	1584.81	529.27	1584.79	3	9.49	15.6	8196	71	3	415 - 430	K.NTVPGDVSAMVPGGIR.M	Oxidation: 10
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	126	1337.68	1336.68	1337.67	1336.66	1	11.17	12.5	8961	22	1	354 - 365	K.AYQEQVLSNSAK.F
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	201	404.04	2418.22	404.04	2418.21	6	4.38	14.2	4774	27	1	167 - 188	R.IMALDLPHGGHLSHGYQTDTKK.I
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	119	400.70	799.39	400.70	799.39	2	7.23	12.4	198287	22	3	237 - 242	R.LYDYAR.I
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	220	546.32	1090.62	546.31	1090.61	2	7.59	14.7	12923	88	3	226 - 236	K.LIVAGASAYAR.L
1218	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	451	602.32	1803.93	602.31	1803.92	3	4.36	20.3	15138	70	3	188 - 202	K.KISAVSIFFETMPYR.L	Oxidation: 12
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	130	800.40	799.39	800.39	799.39	1	3.81	12.6	290404	26	4	237 - 242	R.LYDYAR.I
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	249	911.89	1821.77	911.89	1821.76	2	6.50	15.3	459930	116	2	203 - 217	R.LDESTGYIDYDQMEK.S	Oxidation: 13
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	53	494.74	987.47	494.74	987.47	2	1.02	10.9	46674	47	3	494 - 501	R.HEVEEFAK.Q
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	302	729.70	2186.09	729.70	2186.08	3	5.53	16.5	15507	113	3	472 - 491	K.LKDFVSAMESSSTIQSEIAK.L	Oxidation: 8
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	353	751.75	2252.21	751.75	2252.22	3	-0.92	17.7	27736	38	3	374 - 394	R.GYELVSGGTDNHLVLVNLKPK.G
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	523	738.38	3686.84	738.37	3686.83	5	3.37	21.8	25650	47	2	252 - 286	K.AVMLADMAHISGLVAANVIPSPFDYADVVTTTTHK.S	Oxidation: 3
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	448	604.32	3016.57	604.32	3016.57	5	1.61	19.9	8782	37	2	140 - 166	K.WGVNVQPLSGSPANFHVYTALLKPHER.I
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	432	737.67	2209.98	737.67	2209.98	3	1.47	19.5	56160	31	2	111 - 128	R.YYGGNEYIDMAETLCQKR.A	Carbamidomethyl: 15
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	72	419.89	1256.66	419.89	1256.65	3	2.97	11.4	45121	42	3	492 - 501	K.LRHEVEEFAK.Q
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	329	743.00	2225.98	743.00	2225.97	3	5.74	17.1	6832	39	3	111 - 128	R.YYGGNEYIDMAETLCQKR.A	Oxidation: 10
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	231	546.32	1090.62	546.31	1090.61	2	3.03	14.9	4270	72	3	226 - 236	K.LIVAGASAYAR.L
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	358	1127.12	2252.22	1127.12	2252.22	2	2.34	17.8	10413	36	1	374 - 394	R.GYELVSGGTDNHLVLVNLKPK.G
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	371	683.62	2730.46	683.62	2730.45	4	2.58	18.1	69770	38	2	404 - 430	K.VLEAVHIASNKNTVPGDVSAMVPGGIR.M
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	165	436.22	870.42	436.21	870.41	2	3.66	13.4	20981	30	3	449 - 455	K.VAEYFDK.A
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	529	596.98	1787.92	596.98	1787.93	3	-2.24	22	30232	68	2	188 - 202	K.KISAVSIFFETMPYR.L
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	272	793.41	1584.80	793.40	1584.79	2	5.58	15.9	34640	104	3	415 - 430	K.NTVPGDVSAMVPGGIR.M	Oxidation: 10
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	570	918.80	2753.37	918.79	2753.36	3	2.14	23.2	34754	43	3	76 - 101	K.GLELIPSENFTSVSVMQAVGSVMTNK.Y	Oxidation: 23
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	530	894.97	1787.92	894.97	1787.93	2	-2.23	22	97556	22	1	188 - 202	K.KISAVSIFFETMPYR.L
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	158	506.74	1011.47	506.25	1010.49	2	974.65	13.3	22225	21	5	366 - 373	K.FAQTLMER.G	Oxidation: 6
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	140	446.56	1336.67	446.56	1336.66	3	5.86	12.9	29049	52	2	354 - 365	K.AYQEQVLSNSAK.F
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	204	715.47	714.47	715.47	714.46	1	1.51	14.3	8561	52	3	456 - 462	K.AVTIALK.V
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	562	918.80	2753.37	918.79	2753.36	3	3.87	22.8	16684	63	3	76 - 101	K.GLELIPSENFTSVSVMQAVGSVMTNK.Y	Oxidation: 23
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	54	475.24	948.47	475.24	948.47	2	2.69	11	5699	43	3	431 - 439	R.MGTPALTSR.G	Oxidation: 1
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	450	604.32	3016.57	604.32	3016.57	5	2.07	19.9	26910	32	2	140 - 166	K.WGVNVQPLSGSPANFHVYTALLKPHER.I
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	553	838.92	1675.83	838.92	1675.83	2	-0.87	22.5	81321	84	3	189 - 202	K.ISAVSIFFETMPYR.L	Oxidation: 11
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	306	729.70	2186.09	729.70	2186.08	3	4.92	16.6	9484	120	3	472 - 491	K.LKDFVSAMESSSTIQSEIAK.L	Oxidation: 8
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	385	785.41	1568.80	785.41	1568.80	2	2.74	18.4	55339	86	3	415 - 430	K.NTVPGDVSAMVPGGIR.M
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	138	669.34	1336.67	669.34	1336.66	2	5.85	12.8	37254	72	5	354 - 365	K.AYQEQVLSNSAK.F
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	153	590.84	1179.66	590.84	1179.66	2	2.81	13.2	20063	93	3	404 - 414	K.VLEAVHIASNK.N
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	270	529.27	1584.80	529.27	1584.79	3	4.67	15.8	192399	73	3	415 - 430	K.NTVPGDVSAMVPGGIR.M	Oxidation: 10
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	537	801.41	2401.20	801.41	2401.20	3	1.23	22.2	8366	97	3	50 - 70	K.QLNAPLEEVDPEIADIIEHEK.A
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	203	577.54	2306.11	577.54	2306.11	4	0.32	14.3	8366	24	3	167 - 187	R.IMALDLPHGGHLSHGYQTDTK.K	Oxidation: 2
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	343	519.27	1554.78	519.27	1554.78	3	2.98	17.4	4369	37	1	502 - 514	K.QFPTIGFEKETMK.Y
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	420	841.44	840.43	841.44	840.43	1	-1.81	19.2	55896	31	2	293 - 299	R.GAMIFFR.K
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	284	521.25	1040.48	521.25	1040.48	2	3.27	16.1	10578	42	3	440 - 448	R.GFVEEDFAK.V
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	491	938.46	3749.81	938.46	3749.79	4	4.71	21	71390	27	2	76 - 110	K.GLELIPSENFTSVSVMQAVGSVMTNKYSEGYPGAR.Y	Oxidation: 16
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	199	577.54	2306.11	577.54	2306.11	4	0.71	14.2	838535	35	3	167 - 187	R.IMALDLPHGGHLSHGYQTDTK.K	Oxidation: 2
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	383	785.41	1568.80	785.41	1568.80	2	2.24	18.4	989195	65	3	415 - 430	K.NTVPGDVSAMVPGGIR.M
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	212	404.04	2418.21	404.04	2418.21	6	0.29	14.5	44701	34	1	167 - 188	R.IMALDLPHGGHLSHGYQTDTKK.I
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	167	871.42	870.42	871.42	870.41	1	3.67	13.5	84181	38	2	449 - 455	K.VAEYFDK.A
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	411	523.30	1566.87	523.30	1566.87	3	1.13	19	163728	59	2	449 - 462	K.VAEYFDKAVTIALK.V
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	120	506.25	1010.49	506.25	1010.49	2	3.27	12.4	23085	48	5	366 - 373	K.FAQTLMER.G	Oxidation: 6
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	323	429.22	856.43	429.22	856.43	2	2.31	17	17404	25	3	293 - 299	R.GAMIFFR.K	Oxidation: 3
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	187	706.39	705.38	706.39	705.38	1	0.86	13.9	384775	16	2	129 - 134	R.ALEAFR.L
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	593	554.29	1659.83	554.28	1659.83	3	0.39	24.1	12354	49	2	189 - 202	K.ISAVSIFFETMPYR.L
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	243	749.37	2245.10	749.37	2245.09	3	5.52	15.2	236908	71	2	346 - 365	K.QATTSEYKAYQEQVLSNSAK.F
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	81	500.23	998.45	500.23	998.45	2	5.75	11.6	33099	55	3	102 - 110	K.YSEGYPGAR.Y
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	273	529.27	1584.80	529.27	1584.79	3	5.58	15.9	89612	81	3	415 - 430	K.NTVPGDVSAMVPGGIR.M	Oxidation: 10
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	131	467.25	932.48	467.24	932.47	2	2.59	12.7	72919	49	3	431 - 439	R.MGTPALTSR.G
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	282	1041.49	1040.49	1041.49	1040.48	1	3.87	16.1	25827	48	2	440 - 448	R.GFVEEDFAK.V
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	354	564.06	2252.21	564.06	2252.22	4	-0.93	17.7	4680	47	3	374 - 394	R.GYELVSGGTDNHLVLVNLKPK.G
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	305	524.60	1570.77	524.60	1570.77	3	2.50	16.6	17088	48	2	502 - 514	K.QFPTIGFEKETMK.Y	Oxidation: 12
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	572	918.80	2753.37	918.79	2753.36	3	3.65	23.2	79261	66	3	76 - 101	K.GLELIPSENFTSVSVMQAVGSVMTNK.Y	Oxidation: 16
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	225	546.32	1090.62	546.31	1090.61	2	3.56	14.8	5708	80	3	226 - 236	K.LIVAGASAYAR.L
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	408	523.30	1566.87	523.30	1566.87	3	2.87	19	46674	58	2	449 - 462	K.VAEYFDKAVTIALK.V
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	569	631.97	1892.88	631.97	1892.88	3	-1.72	23.2	71521	18	1	440 - 455	R.GFVEEDFAKVAEYFDK.A
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	290	485.27	968.53	485.27	968.53	2	-0.07	16.3	8686	37	3	293 - 300	R.GAMIFFRK.G
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	386	523.94	1568.80	523.94	1568.80	3	2.75	18.4	85109	53	1	415 - 430	K.NTVPGDVSAMVPGGIR.M
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	129	400.70	799.39	400.70	799.39	2	3.81	12.6	9329	26	3	237 - 242	R.LYDYAR.I
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	303	1094.05	2186.09	1094.05	2186.08	2	5.54	16.6	32473	21	1	472 - 491	K.LKDFVSAMESSSTIQSEIAK.L	Oxidation: 8
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	595	554.28	1659.83	554.28	1659.83	3	-2.25	24.2	174996	47	2	189 - 202	K.ISAVSIFFETMPYR.L
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	82	999.46	998.45	999.45	998.45	1	5.74	11.6	104547	30	2	102 - 110	K.YSEGYPGAR.Y
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	549	559.62	1675.83	559.62	1675.83	3	-0.72	22.4	86806	65	3	189 - 202	K.ISAVSIFFETMPYR.L	Oxidation: 11
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	80	999.46	998.45	999.45	998.45	1	7.82	11.5	73684	16	2	102 - 110	K.YSEGYPGAR.Y
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	373	533.78	1065.55	533.78	1065.55	2	1.10	18.1	9308	43	3	502 - 510	K.QFPTIGFEK.E
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	198	462.23	2306.11	462.23	2306.11	5	0.72	14.2	81321	30	3	167 - 187	R.IMALDLPHGGHLSHGYQTDTK.K	Oxidation: 2
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	513	1385.69	2769.36	1385.69	2769.36	2	2.50	21.6	22225	20	2	76 - 101	K.GLELIPSENFTSVSVMQAVGSVMTNK.Y	Oxidation: 16
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	76	629.34	1256.66	629.33	1256.65	2	4.70	11.4	108960	44	2	492 - 501	K.LRHEVEEFAK.Q
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	301	729.70	2186.09	729.70	2186.08	3	4.74	16.5	12822	119	3	472 - 491	K.LKDFVSAMESSSTIQSEIAK.L	Oxidation: 8
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	495	658.09	2628.34	658.09	2628.34	4	1.35	21.2	29049	54	2	50 - 72	K.QLNAPLEEVDPEIADIIEHEKAR.Q
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	592	830.92	1659.83	830.92	1659.83	2	0.40	24.1	30374	103	3	189 - 202	K.ISAVSIFFETMPYR.L
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	218	995.50	994.49	995.50	994.49	1	3.80	14.6	29528	31	2	366 - 373	K.FAQTLMER.G
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	377	1066.56	1065.55	1066.56	1065.55	1	1.59	18.2	62160	40	2	502 - 510	K.QFPTIGFEK.E
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	496	877.12	2628.34	877.12	2628.34	3	1.34	21.2	16448	32	1	50 - 72	K.QLNAPLEEVDPEIADIIEHEKAR.Q
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	201	715.47	714.46	715.47	714.46	1	0.63	14.3	18008	31	3	456 - 462	K.AVTIALK.V
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	276	529.27	1584.80	529.27	1584.79	3	5.62	15.9	125674	78	3	415 - 430	K.NTVPGDVSAMVPGGIR.M	Oxidation: 10
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	469	602.31	1803.92	602.31	1803.92	3	-1.19	20.4	16473	51	3	188 - 202	K.KISAVSIFFETMPYR.L	Oxidation: 12
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	128	800.40	799.39	800.39	799.39	1	4.09	12.6	43380	23	4	237 - 242	R.LYDYAR.I
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	254	608.26	1821.77	608.26	1821.76	3	5.42	15.4	31673	39	1	203 - 217	R.LDESTGYIDYDQMEK.S	Oxidation: 13
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	360	751.75	2252.22	751.75	2252.22	3	2.79	17.8	12436	37	3	374 - 394	R.GYELVSGGTDNHLVLVNLKPK.G
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	359	564.06	2252.22	564.06	2252.22	4	2.79	17.8	5180	53	3	374 - 394	R.GYELVSGGTDNHLVLVNLKPK.G
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	423	841.44	840.43	841.44	840.43	1	-0.89	19.3	53392	24	2	293 - 299	R.GAMIFFR.K
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	572	918.80	2753.37	918.79	2753.36	3	3.65	23.2	79261	28	3	76 - 101	K.GLELIPSENFTSVSVMQAVGSVMTNK.Y	Oxidation: 23
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	5	480.76	959.50	480.76	959.50	2	0.81	8.8	12436	24	5	395 - 403	K.GIDGSRVEK.V
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	309	524.60	1570.77	524.60	1570.77	3	3.03	16.7	282985	31	2	502 - 514	K.QFPTIGFEKETMK.Y	Oxidation: 12
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	591	830.92	1659.83	830.92	1659.83	2	-1.83	24.1	4276	86	3	189 - 202	K.ISAVSIFFETMPYR.L
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	197	462.23	2306.11	462.23	2306.11	5	0.54	14.1	114701	30	3	167 - 187	R.IMALDLPHGGHLSHGYQTDTK.K	Oxidation: 2
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	217	498.25	994.49	498.25	994.49	2	3.80	14.6	79261	50	3	366 - 373	K.FAQTLMER.G
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	96	460.27	918.53	460.27	918.53	2	4.07	11.9	6938	49	3	218 - 225	K.SATLFRPK.L
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	7	480.76	959.51	480.76	959.50	2	3.78	8.9	8080	36	5	395 - 403	K.GIDGSRVEK.V
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	477	965.46	1928.91	965.46	1928.90	2	1.17	20.6	54601	62	1	474 - 491	K.DFVSAMESSSTIQSEIAK.L
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	508	1385.69	2769.37	1385.69	2769.36	2	3.31	21.4	20063	28	2	76 - 101	K.GLELIPSENFTSVSVMQAVGSVMTNK.Y	Oxidation: 16
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	143	446.56	1336.67	446.56	1336.66	3	4.18	12.9	76559	48	2	354 - 365	K.AYQEQVLSNSAK.F
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	407	784.44	1566.87	784.44	1566.87	2	2.87	18.9	31290	92	2	449 - 462	K.VAEYFDKAVTIALK.V
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	102	460.27	918.53	460.27	918.53	2	3.85	12	43234	41	3	218 - 225	K.SATLFRPK.L
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	125	467.25	932.48	467.24	932.47	2	0.89	12.5	39198	54	3	431 - 439	R.MGTPALTSR.G
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	325	743.00	2225.99	743.00	2225.97	3	6.75	17	30503	39	3	111 - 128	R.YYGGNEYIDMAETLCQKR.A	Oxidation: 10
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	200	769.71	2306.11	769.71	2306.11	3	0.72	14.2	73808	26	1	167 - 187	R.IMALDLPHGGHLSHGYQTDTK.K	Oxidation: 2
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	159	436.22	870.42	436.21	870.41	2	4.92	13.3	23264	30	3	449 - 455	K.VAEYFDK.A
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	409	664.12	2652.46	664.12	2652.45	4	3.92	19	5699	27	1	320 - 345	K.INQAVFPGLQGGPHNHTITGLAVALK.Q
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	163	871.42	870.41	871.42	870.41	1	2.24	13.4	106558	36	2	449 - 455	K.VAEYFDK.A
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	296	687.62	2746.45	687.62	2746.44	4	4.14	16.4	4488	64	3	404 - 430	K.VLEAVHIASNKNTVPGDVSAMVPGGIR.M	Oxidation: 21
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	127	467.25	932.48	467.24	932.47	2	2.63	12.6	25159	56	3	431 - 439	R.MGTPALTSR.G
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	370	533.78	1065.55	533.78	1065.55	2	0.80	18.1	8519	54	3	502 - 510	K.QFPTIGFEK.E
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	162	436.21	870.41	436.21	870.41	2	2.24	13.4	4279	32	3	449 - 455	K.VAEYFDK.A
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	134	669.83	1337.66	669.34	1336.66	2	741.88	12.7	74750	58	5	354 - 365	K.AYQEQVLSNSAK.F
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	179	630.36	629.36	630.36	629.35	1	2.52	13.7	33290	18	2	45 - 49	R.VTWPK.Q
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	416	724.37	2170.09	724.37	2170.08	3	2.37	19.2	329707	99	2	472 - 491	K.LKDFVSAMESSSTIQSEIAK.L
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	73	629.33	1256.66	629.33	1256.65	2	2.98	11.4	65569	45	2	492 - 501	K.LRHEVEEFAK.Q
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	314	903.90	1805.78	903.89	1805.77	2	6.12	16.8	15439	86	2	203 - 217	R.LDESTGYIDYDQMEK.S
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	570	918.80	2753.37	918.79	2753.36	3	2.14	23.2	34754	79	3	76 - 101	K.GLELIPSENFTSVSVMQAVGSVMTNK.Y	Oxidation: 16
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	37	480.76	959.51	480.76	959.50	2	2.22	10.5	10216	26	5	395 - 403	K.GIDGSRVEK.V
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	410	784.44	1566.87	784.44	1566.87	2	1.14	19	387191	95	2	449 - 462	K.VAEYFDKAVTIALK.V
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	136	800.40	799.39	800.39	799.39	1	3.00	12.8	71390	33	4	237 - 242	R.LYDYAR.I
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	510	924.13	2769.37	924.13	2769.36	3	3.69	21.5	34657	104	2	76 - 101	K.GLELIPSENFTSVSVMQAVGSVMTNK.Y	Oxidation: 16
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	46	494.74	987.46	494.74	987.47	2	-2.58	10.8	291364	47	3	494 - 501	R.HEVEEFAK.Q
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	317	429.22	856.43	429.22	856.43	2	0.03	16.9	905	29	3	293 - 299	R.GAMIFFR.K	Oxidation: 3
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	279	521.25	1040.49	521.25	1040.48	2	4.63	16	98769	40	3	440 - 448	R.GFVEEDFAK.V
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	326	743.00	2225.98	743.00	2225.97	3	5.18	17.1	49009	28	3	111 - 128	R.YYGGNEYIDMAETLCQKR.A	Oxidation: 10
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	327	857.43	856.43	857.43	856.43	1	-0.60	17.1	3720	20	1	293 - 299	R.GAMIFFR.K	Oxidation: 3
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	247	459.03	2290.12	459.03	2290.12	5	0.79	15.3	24566	36	2	167 - 187	R.IMALDLPHGGHLSHGYQTDTK.K
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	470	685.63	2053.88	685.63	2053.88	3	2.29	20.4	24015	49	1	111 - 127	R.YYGGNEYIDMAETLCQK.R	Carbamidomethyl: 15
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	474	602.31	1803.92	602.31	1803.92	3	-1.68	20.6	20817	57	3	188 - 202	K.KISAVSIFFETMPYR.L	Oxidation: 12
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	532	596.98	1787.93	596.98	1787.93	3	-0.53	22	51563	52	2	188 - 202	K.KISAVSIFFETMPYR.L
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	281	521.25	1040.49	521.25	1040.48	2	3.87	16.1	18290	39	3	440 - 448	R.GFVEEDFAK.V
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	57	475.24	948.47	475.24	948.47	2	4.69	11	59650	41	3	431 - 439	R.MGTPALTSR.G	Oxidation: 1
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	472	902.97	1803.92	902.97	1803.92	2	0.88	20.5	14498	15	1	188 - 202	K.KISAVSIFFETMPYR.L	Oxidation: 12
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	531	801.41	2401.21	801.41	2401.20	3	1.84	22	36648	85	3	50 - 70	K.QLNAPLEEVDPEIADIIEHEK.A
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	250	459.03	2290.12	459.03	2290.12	5	1.75	15.3	144641	39	2	167 - 187	R.IMALDLPHGGHLSHGYQTDTK.K
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	219	498.25	994.49	498.25	994.49	2	2.43	14.7	24347	54	3	366 - 373	K.FAQTLMER.G
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	164	669.83	1337.65	669.34	1336.66	2	739.25	13.4	21745	47	5	354 - 365	K.AYQEQVLSNSAK.F
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	160	506.74	1011.47	506.25	1010.49	2	974.63	13.3	46456	33	5	366 - 373	K.FAQTLMER.G	Oxidation: 6
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	117	506.25	1010.49	506.25	1010.49	2	3.74	12.4	14498	58	5	366 - 373	K.FAQTLMER.G	Oxidation: 6
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	75	419.89	1256.66	419.89	1256.65	3	4.70	11.4	18001	41	3	492 - 501	K.LRHEVEEFAK.Q
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	109	437.25	872.49	437.25	872.49	2	1.86	12.2	364895	17	1	43 - 49	R.SRVTWPK.Q
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	521	922.72	3686.84	922.72	3686.83	4	3.37	21.8	81006	51	2	252 - 286	K.AVMLADMAHISGLVAANVIPSPFDYADVVTTTTHK.S	Oxidation: 3
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	185	706.39	705.38	706.39	705.38	1	2.19	13.9	54212	34	2	129 - 134	R.ALEAFR.L
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	312	903.90	1805.78	903.89	1805.77	2	6.64	16.8	344824	97	2	203 - 217	R.LDESTGYIDYDQMEK.S
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	507	924.13	2769.37	924.13	2769.36	3	3.31	21.4	19296	97	2	76 - 101	K.GLELIPSENFTSVSVMQAVGSVMTNK.Y	Oxidation: 16
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	169	406.71	2434.21	406.71	2434.21	6	2.41	13.5	50001	39	1	167 - 188	R.IMALDLPHGGHLSHGYQTDTKK.I	Oxidation: 2
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	563	1377.69	2753.37	1377.69	2753.36	2	3.87	22.9	80321	38	1	76 - 101	K.GLELIPSENFTSVSVMQAVGSVMTNK.Y	Oxidation: 23
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	207	715.47	714.47	715.47	714.46	1	1.46	14.4	16684	42	3	456 - 462	K.AVTIALK.V
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	228	546.32	1090.62	546.31	1090.61	2	4.72	14.9	8754	80	3	226 - 236	K.LIVAGASAYAR.L
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	133	800.40	799.39	800.39	799.39	1	3.50	12.7	225471	26	4	237 - 242	R.LYDYAR.I
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	554	559.62	1675.83	559.62	1675.83	3	-0.86	22.5	838535	69	3	189 - 202	K.ISAVSIFFETMPYR.L	Oxidation: 11
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	208	484.65	2418.21	484.65	2418.21	5	0.72	14.4	80321	22	1	167 - 188	R.IMALDLPHGGHLSHGYQTDTKK.I
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	132	400.70	799.39	400.70	799.39	2	3.49	12.7	63935	30	3	237 - 242	R.LYDYAR.I
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	63	949.48	948.47	949.48	948.47	1	3.82	11.2	49406	21	1	431 - 439	R.MGTPALTSR.G	Oxidation: 1
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	79	419.89	1256.66	419.89	1256.65	3	3.11	11.5	98049	42	3	492 - 501	K.LRHEVEEFAK.Q
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	356	564.06	2252.22	564.06	2252.22	4	2.33	17.8	12950	54	3	374 - 394	R.GYELVSGGTDNHLVLVNLKPK.G
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	293	485.27	968.53	485.27	968.53	2	-0.03	16.3	16869	38	3	293 - 300	R.GAMIFFRK.G
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	522	948.75	3790.98	948.75	3790.97	4	1.81	21.8	84181	29	1	311 - 345	K.EVLYDFEDKINQAVFPGLQGGPHNHTITGLAVALK.Q
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	221	995.50	994.49	995.50	994.49	1	2.43	14.7	15348	15	2	366 - 373	K.FAQTLMER.G
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	594	830.92	1659.83	830.92	1659.83	2	-2.25	24.2	5389	86	3	189 - 202	K.ISAVSIFFETMPYR.L
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	550	838.92	1675.83	838.92	1675.83	2	0.53	22.5	47424	100	3	189 - 202	K.ISAVSIFFETMPYR.L	Oxidation: 11
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	9	480.76	959.51	480.76	959.50	2	2.56	8.9	1807	26	5	395 - 403	K.GIDGSRVEK.V
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	466	1027.95	2053.88	1027.95	2053.88	2	2.20	20.4	56934	111	2	111 - 127	R.YYGGNEYIDMAETLCQK.R	Carbamidomethyl: 15
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	375	683.62	2730.45	683.62	2730.45	4	1.91	18.2	56251	26	2	404 - 430	K.VLEAVHIASNKNTVPGDVSAMVPGGIR.M
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	114	506.25	1010.49	506.25	1010.49	2	2.08	12.3	16473	58	5	366 - 373	K.FAQTLMER.G	Oxidation: 6
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	426	421.22	840.43	421.22	840.43	2	-0.00	19.4	116233	38	3	293 - 299	R.GAMIFFR.K
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	269	793.41	1584.80	793.40	1584.79	2	4.67	15.8	45282	82	3	415 - 430	K.NTVPGDVSAMVPGGIR.M	Oxidation: 10
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	60	475.24	948.47	475.24	948.47	2	4.78	11.1	80186	41	3	431 - 439	R.MGTPALTSR.G	Oxidation: 1
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	551	559.62	1675.83	559.62	1675.83	3	0.53	22.5	993810	69	3	189 - 202	K.ISAVSIFFETMPYR.L	Oxidation: 11
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	141	669.34	1336.67	669.34	1336.66	2	4.18	12.9	16448	88	5	354 - 365	K.AYQEQVLSNSAK.F
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	468	1027.95	2053.88	1027.95	2053.88	2	2.29	20.4	47737	69	2	111 - 127	R.YYGGNEYIDMAETLCQK.R	Carbamidomethyl: 15
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	48	494.74	987.47	494.74	987.47	2	0.07	10.8	62670	50	3	494 - 501	R.HEVEEFAK.Q
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	222	498.25	994.49	498.25	994.49	2	3.20	14.7	15436	57	3	366 - 373	K.FAQTLMER.G
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	562	918.80	2753.37	918.79	2753.36	3	3.87	22.8	16684	19	3	76 - 101	K.GLELIPSENFTSVSVMQAVGSVMTNK.Y	Oxidation: 16
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	77	500.23	998.45	500.23	998.45	2	7.22	11.4	56160	52	3	102 - 110	K.YSEGYPGAR.Y
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	172	630.36	629.36	630.36	629.35	1	3.56	13.6	123006	19	2	45 - 49	R.VTWPK.Q
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	355	1035.95	2069.88	1035.94	2069.87	2	3.01	17.7	9313	64	1	111 - 127	R.YYGGNEYIDMAETLCQK.R	Oxidation: 10
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	38	480.76	959.51	480.76	959.50	2	1.75	10.6	8892	20	5	395 - 403	K.GIDGSRVEK.V
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	251	573.54	2290.12	573.54	2290.12	4	1.75	15.3	24001	20	1	167 - 187	R.IMALDLPHGGHLSHGYQTDTK.K
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	297	916.49	2746.45	916.49	2746.44	3	4.14	16.4	22582	39	2	404 - 430	K.VLEAVHIASNKNTVPGDVSAMVPGGIR.M	Oxidation: 21
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	525	738.37	3686.84	738.37	3686.83	5	0.80	21.9	45586	61	2	252 - 286	K.AVMLADMAHISGLVAANVIPSPFDYADVVTTTTHK.S	Oxidation: 3
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	374	1066.56	1065.55	1066.56	1065.55	1	1.10	18.1	74132	52	2	502 - 510	K.QFPTIGFEK.E
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	298	485.27	968.53	485.27	968.53	2	1.11	16.4	9412	31	3	293 - 300	R.GAMIFFRK.G
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	471	602.32	1803.92	602.31	1803.92	3	0.87	20.5	16817	73	3	188 - 202	K.KISAVSIFFETMPYR.L	Oxidation: 12
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	295	687.62	2746.45	687.62	2746.44	4	2.93	16.4	39161	51	3	404 - 430	K.VLEAVHIASNKNTVPGDVSAMVPGGIR.M	Oxidation: 21
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	332	579.27	1156.53	579.27	1156.53	2	2.56	17.2	21102	47	2	311 - 319	K.EVLYDFEDK.I
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	534	801.41	2401.21	801.41	2401.20	3	2.25	22.1	33290	103	3	50 - 70	K.QLNAPLEEVDPEIADIIEHEK.A
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	435	737.67	2209.98	737.67	2209.98	3	1.44	19.6	73684	28	2	111 - 128	R.YYGGNEYIDMAETLCQKR.A	Carbamidomethyl: 15
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	246	749.37	2245.10	749.37	2245.09	3	4.88	15.3	36765	80	2	346 - 365	K.QATTSEYKAYQEQVLSNSAK.F
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	168	487.85	2434.21	487.85	2434.21	5	2.41	13.5	25650	15	2	167 - 188	R.IMALDLPHGGHLSHGYQTDTKK.I	Oxidation: 2
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	419	421.22	840.43	421.22	840.43	2	-1.81	19.2	252996	36	3	293 - 299	R.GAMIFFR.K
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	150	590.84	1179.66	590.84	1179.66	2	2.26	13.1	28785	92	3	404 - 414	K.VLEAVHIASNK.N
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	126	400.70	799.39	400.70	799.39	2	4.08	12.6	25523	26	3	237 - 242	R.LYDYAR.I
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	320	429.22	856.43	429.22	856.43	2	1.98	16.9	6941	28	3	293 - 299	R.GAMIFFR.K	Oxidation: 3
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	99	460.27	918.53	460.27	918.53	2	4.20	12	81048	43	3	218 - 225	K.SATLFRPK.L
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	421	724.37	2170.09	724.37	2170.08	3	1.09	19.2	31208	99	2	472 - 491	K.LKDFVSAMESSSTIQSEIAK.L
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	524	922.72	3686.84	922.72	3686.83	4	0.80	21.9	50001	54	2	252 - 286	K.AVMLADMAHISGLVAANVIPSPFDYADVVTTTTHK.S	Oxidation: 3
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	135	669.84	1337.66	669.34	1336.66	2	748.79	12.8	71330	66	5	354 - 365	K.AYQEQVLSNSAK.F
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	166	487.85	2434.21	487.85	2434.21	5	1.76	13.5	81006	28	2	167 - 188	R.IMALDLPHGGHLSHGYQTDTKK.I	Oxidation: 2
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	335	579.27	1156.53	579.27	1156.53	2	3.54	17.3	9747	65	2	311 - 319	K.EVLYDFEDK.I
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	492	658.09	2628.35	658.09	2628.34	4	2.58	21.1	41006	58	2	50 - 72	K.QLNAPLEEVDPEIADIIEHEKAR.Q
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	304	430.24	1287.68	430.23	1287.68	3	1.42	16.6	27132	28	1	129 - 139	R.ALEAFRLDPEK.W
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	299	687.62	2746.45	687.62	2746.44	4	4.09	16.5	8319	54	3	404 - 430	K.VLEAVHIASNKNTVPGDVSAMVPGGIR.M	Oxidation: 21
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	285	1041.49	1040.48	1041.49	1040.48	1	3.27	16.1	26304	47	2	440 - 448	R.GFVEEDFAK.V
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	196	577.54	2306.11	577.54	2306.11	4	0.54	14.1	993810	32	3	167 - 187	R.IMALDLPHGGHLSHGYQTDTK.K	Oxidation: 2
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	357	751.75	2252.22	751.75	2252.22	3	2.34	17.8	4180	48	3	374 - 394	R.GYELVSGGTDNHLVLVNLKPK.G
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	548	838.92	1675.83	838.92	1675.83	2	-0.72	22.4	576705	111	3	189 - 202	K.ISAVSIFFETMPYR.L	Oxidation: 11
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	422	421.22	840.43	421.22	840.43	2	-0.88	19.3	251302	31	3	293 - 299	R.GAMIFFR.K
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	156	590.84	1179.66	590.84	1179.66	2	1.60	13.2	12505	72	3	404 - 414	K.VLEAVHIASNK.N
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	376	533.78	1065.55	533.78	1065.55	2	1.58	18.2	60557	42	3	502 - 510	K.QFPTIGFEK.E
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	78	500.23	998.45	500.23	998.45	2	7.80	11.5	20685	55	3	102 - 110	K.YSEGYPGAR.Y
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	494	938.46	3749.81	938.46	3749.79	4	6.07	21.1	39703	36	2	76 - 110	K.GLELIPSENFTSVSVMQAVGSVMTNKYSEGYPGAR.Y	Oxidation: 16
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	300	916.49	2746.45	916.49	2746.44	3	4.10	16.5	31809	17	2	404 - 430	K.VLEAVHIASNKNTVPGDVSAMVPGGIR.M	Oxidation: 21
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	252	911.89	1821.77	911.89	1821.76	2	5.42	15.4	429381	111	2	203 - 217	R.LDESTGYIDYDQMEK.S	Oxidation: 13
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	275	793.41	1584.80	793.40	1584.79	2	5.63	15.9	43729	104	3	415 - 430	K.NTVPGDVSAMVPGGIR.M	Oxidation: 10
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	536	601.31	2401.21	601.31	2401.20	4	2.25	22.1	31612	52	1	50 - 70	K.QLNAPLEEVDPEIADIIEHEK.A
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	202	462.23	2306.11	462.23	2306.11	5	0.30	14.3	13139	30	3	167 - 187	R.IMALDLPHGGHLSHGYQTDTK.K	Oxidation: 2
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	388	785.41	1568.80	785.41	1568.80	2	2.85	18.5	5398	43	3	415 - 430	K.NTVPGDVSAMVPGGIR.M
1273	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	307	786.39	1570.77	786.39	1570.77	2	2.50	16.6	21108	25	1	502 - 514	K.QFPTIGFEKETMK.Y	Oxidation: 12
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	303	793.40	1584.78	793.40	1584.79	2	-8.17	15.3	86424	104	3	415 - 430	K.NTVPGDVSAMVPGGIR.M	Oxidation: 10
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	141	431.74	861.47	431.75	861.48	2	-10.74	11.7	163635	17	1	128 - 134	K.RALEAFR.L
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	671	830.92	1659.82	830.92	1659.83	2	-9.14	23.9	31341	108	3	189 - 202	K.ISAVSIFFETMPYR.L
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	373	579.27	1156.52	579.27	1156.53	2	-10.37	16.9	4843	59	2	311 - 319	K.EVLYDFEDK.I
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	188	871.41	870.41	871.42	870.41	1	-8.13	12.7	310370	36	3	449 - 455	K.VAEYFDK.A
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	571	924.12	2769.33	924.13	2769.36	3	-8.77	21.3	83222	104	3	76 - 101	K.GLELIPSENFTSVSVMQAVGSVMTNK.Y	Oxidation: 16
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	164	467.24	932.47	467.24	932.47	2	-9.49	12.2	51516	57	3	431 - 439	R.MGTPALTSR.G
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	494	604.32	3016.55	604.32	3016.57	5	-6.52	19.6	865815	42	2	140 - 166	K.WGVNVQPLSGSPANFHVYTALLKPHER.I
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	610	838.91	1675.81	838.92	1675.83	2	-9.09	22.2	49715	91	3	189 - 202	K.ISAVSIFFETMPYR.L	Oxidation: 11
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	457	421.22	840.42	421.22	840.43	2	-8.31	18.8	69630	33	2	293 - 299	R.GAMIFFR.K
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	337	430.23	1287.67	430.23	1287.68	3	-9.67	16.1	452432	25	1	129 - 139	R.ALEAFRLDPEK.W
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	281	573.53	2290.10	573.54	2290.12	4	-7.72	14.8	5464	32	1	167 - 187	R.IMALDLPHGGHLSHGYQTDTK.K
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	517	602.31	1803.91	602.31	1803.92	3	-8.54	20.1	47667	57	2	188 - 202	K.KISAVSIFFETMPYR.L	Oxidation: 12
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	678	554.28	1659.82	554.28	1659.83	3	-9.41	24	161880	60	3	189 - 202	K.ISAVSIFFETMPYR.L
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	608	838.91	1675.81	838.92	1675.83	2	-8.79	22.1	343784	106	3	189 - 202	K.ISAVSIFFETMPYR.L	Oxidation: 11
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	312	529.27	1584.78	529.27	1584.79	3	-8.06	15.5	5418	80	3	415 - 430	K.NTVPGDVSAMVPGGIR.M	Oxidation: 10
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	178	590.83	1179.65	590.84	1179.66	2	-6.59	12.5	92089	92	3	404 - 414	K.VLEAVHIASNK.N
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	672	554.28	1659.82	554.28	1659.83	3	-9.14	23.9	27705	61	3	189 - 202	K.ISAVSIFFETMPYR.L
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	285	608.26	1821.75	608.26	1821.76	3	-6.78	14.9	7665	54	2	203 - 217	R.LDESTGYIDYDQMEK.S	Oxidation: 13
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	256	498.25	994.48	498.25	994.49	2	-10.27	14.3	20576	54	3	366 - 373	K.FAQTLMER.G
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	592	801.40	2401.18	801.41	2401.20	3	-6.91	21.8	78799	99	3	50 - 70	K.QLNAPLEEVDPEIADIIEHEK.A
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	106	419.89	1256.64	419.89	1256.65	3	-6.54	10.9	252816	40	3	492 - 501	K.LRHEVEEFAK.Q
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	280	459.03	2290.10	459.03	2290.12	5	-7.73	14.8	40674	29	1	167 - 187	R.IMALDLPHGGHLSHGYQTDTK.K
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	291	911.88	1821.75	911.89	1821.76	2	-6.27	15	24556	82	3	203 - 217	R.LDESTGYIDYDQMEK.S	Oxidation: 13
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	660	735.17	3670.81	735.17	3670.84	5	-6.44	23.4	45983	57	3	252 - 286	K.AVMLADMAHISGLVAANVIPSPFDYADVVTTTTHK.S	Oxidation: 7
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	407	533.78	1065.54	533.78	1065.55	2	-11.08	17.6	8818	42	3	502 - 510	K.QFPTIGFEK.E
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	410	1066.55	1065.54	1066.56	1065.55	1	-8.40	17.7	15151	51	3	502 - 510	K.QFPTIGFEK.E
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	391	564.06	2252.20	564.06	2252.22	4	-7.46	17.3	4209	50	3	374 - 394	R.GYELVSGGTDNHLVLVNLKPK.G
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	231	577.53	2306.09	577.54	2306.11	4	-7.53	13.7	23735	23	3	167 - 187	R.IMALDLPHGGHLSHGYQTDTK.K	Oxidation: 2
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	207	706.38	705.38	706.39	705.38	1	-7.36	13.1	5782	20	3	129 - 134	R.ALEAFR.L
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	308	529.27	1584.78	529.27	1584.79	3	-9.48	15.4	6659	71	3	415 - 430	K.NTVPGDVSAMVPGGIR.M	Oxidation: 10
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	684	731.97	3654.82	731.98	3654.84	5	-6.41	24.2	100653	53	3	252 - 286	K.AVMLADMAHISGLVAANVIPSPFDYADVVTTTTHK.S
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	515	1027.94	2053.86	1027.95	2053.88	2	-7.40	20.1	222945	92	1	111 - 127	R.YYGGNEYIDMAETLCQK.R	Carbamidomethyl: 15
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	663	735.17	3670.81	735.17	3670.84	5	-6.70	23.4	6659	50	3	252 - 286	K.AVMLADMAHISGLVAANVIPSPFDYADVVTTTTHK.S	Oxidation: 3
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	358	429.22	856.42	429.22	856.43	2	-10.46	16.5	13382	31	3	293 - 299	R.GAMIFFR.K	Oxidation: 3
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	521	602.31	1803.91	602.31	1803.92	3	-7.76	20.2	59411	50	2	188 - 202	K.KISAVSIFFETMPYR.L	Oxidation: 12
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	357	903.88	1805.75	903.89	1805.77	2	-9.04	16.5	3766	115	3	203 - 217	R.LDESTGYIDYDQMEK.S
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	316	521.24	1040.47	521.25	1040.48	2	-9.66	15.6	31341	39	3	440 - 448	R.GFVEEDFAK.V
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	580	759.20	3790.95	759.20	3790.97	5	-5.90	21.5	21323	23	2	311 - 345	K.EVLYDFEDKINQAVFPGLQGGPHNHTITGLAVALK.Q
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	101	629.33	1256.64	629.33	1256.65	2	-5.93	10.8	277737	36	3	492 - 501	K.LRHEVEEFAK.Q
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	286	911.88	1821.75	911.89	1821.76	2	-5.97	14.9	288496	120	3	203 - 217	R.LDESTGYIDYDQMEK.S	Oxidation: 13
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	108	629.33	1256.64	629.33	1256.65	2	-6.54	10.9	26781	34	3	492 - 501	K.LRHEVEEFAK.Q
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	516	685.63	2053.86	685.63	2053.88	3	-7.40	20.1	112298	52	1	111 - 127	R.YYGGNEYIDMAETLCQK.R	Carbamidomethyl: 15
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	167	1337.66	1336.65	1337.67	1336.66	1	-6.91	12.2	39512	32	2	354 - 365	K.AYQEQVLSNSAK.F
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	307	793.40	1584.78	793.40	1584.79	2	-9.49	15.4	30764	107	3	415 - 430	K.NTVPGDVSAMVPGGIR.M	Oxidation: 10
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	211	706.38	705.38	706.39	705.38	1	-6.64	13.2	43384	25	3	129 - 134	R.ALEAFR.L
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	112	500.23	998.44	500.23	998.45	2	-6.73	11	88397	63	3	102 - 110	K.YSEGYPGAR.Y
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	160	467.24	932.47	467.24	932.47	2	-8.65	12.1	222945	54	3	431 - 439	R.MGTPALTSR.G
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	161	800.39	799.38	800.39	799.39	1	-6.63	12.1	112298	24	2	237 - 242	R.LYDYAR.I
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	236	577.53	2306.09	577.54	2306.11	4	-7.55	13.8	172339	29	3	167 - 187	R.IMALDLPHGGHLSHGYQTDTK.K	Oxidation: 2
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	398	751.74	2252.20	751.75	2252.22	3	-7.25	17.4	16450	32	3	374 - 394	R.GYELVSGGTDNHLVLVNLKPK.G
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	107	500.23	998.44	500.23	998.45	2	-7.53	10.9	40289	48	3	102 - 110	K.YSEGYPGAR.Y
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	304	793.40	1584.78	793.40	1584.79	2	-8.08	15.3	81944	109	3	415 - 430	K.NTVPGDVSAMVPGGIR.M	Oxidation: 10
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	594	1201.60	2401.18	1201.61	2401.20	2	-6.91	21.8	49475	17	2	50 - 70	K.QLNAPLEEVDPEIADIIEHEK.A
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	602	918.71	3670.82	918.72	3670.84	4	-4.96	22	714434	45	2	252 - 286	K.AVMLADMAHISGLVAANVIPSPFDYADVVTTTTHK.S	Oxidation: 7
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	628	918.79	2753.34	918.79	2753.36	3	-6.47	22.6	66024	26	2	76 - 101	K.GLELIPSENFTSVSVMQAVGSVMTNK.Y	Oxidation: 16
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	588	922.71	3686.81	922.72	3686.83	4	-6.73	21.7	150100	41	2	252 - 286	K.AVMLADMAHISGLVAANVIPSPFDYADVVTTTTHK.S	Oxidation: 3
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	127	460.27	918.53	460.27	918.53	2	-3.40	11.4	669727	46	3	218 - 225	K.SATLFRPK.L
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	612	559.61	1675.81	559.62	1675.83	3	-9.08	22.2	11223	69	3	189 - 202	K.ISAVSIFFETMPYR.L	Oxidation: 11
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	287	608.26	1821.75	608.26	1821.76	3	-5.97	14.9	111633	46	2	203 - 217	R.LDESTGYIDYDQMEK.S	Oxidation: 13
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	100	419.89	1256.64	419.89	1256.65	3	-5.92	10.8	579309	40	3	492 - 501	K.LRHEVEEFAK.Q
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	113	999.45	998.44	999.45	998.45	1	-6.74	11	36971	16	2	102 - 110	K.YSEGYPGAR.Y
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	208	706.38	705.38	706.39	705.38	1	-7.02	13.2	167287	23	3	129 - 134	R.ALEAFR.L
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	157	400.70	799.38	400.70	799.39	2	-6.22	12	143245	26	2	237 - 242	R.LYDYAR.I
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	583	922.71	3686.81	922.72	3686.83	4	-7.43	21.6	33478	78	2	252 - 286	K.AVMLADMAHISGLVAANVIPSPFDYADVVTTTTHK.S	Oxidation: 3
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	448	664.12	2652.43	664.12	2652.45	4	-7.13	18.6	53436	31	2	320 - 345	K.INQAVFPGLQGGPHNHTITGLAVALK.Q
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	158	800.39	799.38	800.39	799.39	1	-6.22	12	91159	26	2	237 - 242	R.LYDYAR.I
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	163	669.33	1336.65	669.34	1336.66	2	-7.94	12.2	231595	73	3	354 - 365	K.AYQEQVLSNSAK.F
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	246	404.04	2418.20	404.04	2418.21	6	-5.65	14	140907	27	2	167 - 188	R.IMALDLPHGGHLSHGYQTDTKK.I
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	110	999.45	998.44	999.45	998.45	1	-7.14	11	35823	24	2	102 - 110	K.YSEGYPGAR.Y
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	235	715.46	714.46	715.47	714.46	1	-9.88	13.8	573474	42	2	456 - 462	K.AVTIALK.V
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	155	467.24	932.47	467.24	932.47	2	-10.47	12	62951	60	3	431 - 439	R.MGTPALTSR.G
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	409	533.78	1065.54	533.78	1065.55	2	-8.40	17.7	6172	40	3	502 - 510	K.QFPTIGFEK.E
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	424	785.40	1568.79	785.41	1568.80	2	-8.27	18	60264	96	2	415 - 430	K.NTVPGDVSAMVPGGIR.M
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	707	1369.68	2737.35	1369.69	2737.37	2	-7.05	24.8	7466	16	2	76 - 101	K.GLELIPSENFTSVSVMQAVGSVMTNK.Y
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	168	446.56	1336.65	446.56	1336.66	3	-6.88	12.3	38209	49	2	354 - 365	K.AYQEQVLSNSAK.F
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	629	1377.68	2753.34	1377.69	2753.36	2	-6.47	22.6	103068	22	3	76 - 101	K.GLELIPSENFTSVSVMQAVGSVMTNK.Y	Oxidation: 23
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	421	785.40	1568.79	785.41	1568.80	2	-7.45	18	52024	83	2	415 - 430	K.NTVPGDVSAMVPGGIR.M
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	628	918.79	2753.34	918.79	2753.36	3	-6.47	22.6	66024	85	3	76 - 101	K.GLELIPSENFTSVSVMQAVGSVMTNK.Y	Oxidation: 23
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	124	460.27	918.52	460.27	918.53	2	-4.08	11.3	115275	46	3	218 - 225	K.SATLFRPK.L
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	121	460.27	918.53	460.27	918.53	2	-3.82	11.2	84398	43	3	218 - 225	K.SATLFRPK.L
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	162	669.33	1336.64	669.34	1336.66	2	-16.74	12.1	47667	71	3	354 - 365	K.AYQEQVLSNSAK.F
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	91	475.24	948.46	475.24	948.47	2	-6.33	10.6	598679	41	3	431 - 439	R.MGTPALTSR.G	Oxidation: 1
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	645	689.34	2753.34	689.35	2753.36	4	-8.03	23	169997	20	1	76 - 101	K.GLELIPSENFTSVSVMQAVGSVMTNK.Y	Oxidation: 16
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	313	521.24	1040.47	521.25	1040.48	2	-8.80	15.5	5501	39	3	440 - 448	R.GFVEEDFAK.V
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	355	429.22	856.42	429.22	856.43	2	-11.11	16.5	3941	36	3	293 - 299	R.GAMIFFR.K	Oxidation: 3
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	305	529.27	1584.78	529.27	1584.79	3	-8.08	15.3	45983	83	3	415 - 430	K.NTVPGDVSAMVPGGIR.M	Oxidation: 10
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	613	838.91	1675.81	838.92	1675.83	2	-8.43	22.3	9022	94	3	189 - 202	K.ISAVSIFFETMPYR.L	Oxidation: 11
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	148	506.25	1010.48	506.25	1010.49	2	-6.21	11.8	870989	48	3	366 - 373	K.FAQTLMER.G	Oxidation: 6
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	232	715.46	714.46	715.47	714.46	1	-9.62	13.7	461069	48	2	456 - 462	K.AVTIALK.V
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	181	590.83	1179.65	590.84	1179.66	2	-6.67	12.6	526974	93	3	404 - 414	K.VLEAVHIASNK.N
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	461	724.36	2170.07	724.37	2170.08	3	-6.67	18.8	252816	95	2	472 - 491	K.LKDFVSAMESSSTIQSEIAK.L
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	674	830.92	1659.82	830.92	1659.83	2	-9.07	24	64716	104	3	189 - 202	K.ISAVSIFFETMPYR.L
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	191	871.41	870.40	871.42	870.41	1	-8.63	12.8	46088	36	3	449 - 455	K.VAEYFDK.A
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	342	729.69	2186.06	729.70	2186.08	3	-8.01	16.2	6018	122	3	472 - 491	K.LKDFVSAMESSSTIQSEIAK.L	Oxidation: 8
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	397	564.06	2252.20	564.06	2252.22	4	-7.25	17.4	8703	47	3	374 - 394	R.GYELVSGGTDNHLVLVNLKPK.G
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	233	462.23	2306.09	462.23	2306.11	5	-7.33	13.7	150100	25	2	167 - 187	R.IMALDLPHGGHLSHGYQTDTK.K	Oxidation: 2
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	353	903.88	1805.75	903.89	1805.77	2	-9.12	16.4	11114	106	3	203 - 217	R.LDESTGYIDYDQMEK.S
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	260	546.31	1090.60	546.31	1090.61	2	-8.66	14.3	44900	74	3	226 - 236	K.LIVAGASAYAR.L
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	493	755.14	3016.55	755.15	3016.57	4	-6.51	19.6	17762	33	2	140 - 166	K.WGVNVQPLSGSPANFHVYTALLKPHER.I
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	370	579.27	1156.52	579.27	1156.53	2	-9.59	16.8	27597	47	2	311 - 319	K.EVLYDFEDK.I
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	679	731.97	3654.82	731.98	3654.84	5	-6.06	24.1	123131	64	3	252 - 286	K.AVMLADMAHISGLVAANVIPSPFDYADVVTTTTHK.S
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	596	1201.60	2401.18	1201.61	2401.20	2	-7.45	21.9	937007	15	2	50 - 70	K.QLNAPLEEVDPEIADIIEHEK.A
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	683	914.71	3654.82	914.72	3654.84	4	-6.42	24.2	499819	79	3	252 - 286	K.AVMLADMAHISGLVAANVIPSPFDYADVVTTTTHK.S
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	143	506.25	1010.48	506.25	1010.49	2	-9.00	11.7	227766	48	3	366 - 373	K.FAQTLMER.G	Oxidation: 6
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	522	902.96	1803.91	902.97	1803.92	2	-7.77	20.2	39512	18	2	188 - 202	K.KISAVSIFFETMPYR.L	Oxidation: 12
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	598	801.40	2401.19	801.41	2401.20	3	-5.77	21.9	231651	83	3	50 - 70	K.QLNAPLEEVDPEIADIIEHEK.A
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	344	729.69	2186.06	729.70	2186.08	3	-7.80	16.2	29645	113	3	472 - 491	K.LKDFVSAMESSSTIQSEIAK.L	Oxidation: 8
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	681	731.97	3654.82	731.98	3654.84	5	-5.92	24.1	159561	64	3	252 - 286	K.AVMLADMAHISGLVAANVIPSPFDYADVVTTTTHK.S
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	454	421.22	840.42	421.22	840.43	2	-9.10	18.7	72089	33	2	293 - 299	R.GAMIFFR.K
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	491	604.32	3016.55	604.32	3016.57	5	-6.38	19.5	89925	45	2	140 - 166	K.WGVNVQPLSGSPANFHVYTALLKPHER.I
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	708	913.46	2737.35	913.46	2737.37	3	-6.49	24.8	11114	76	3	76 - 101	K.GLELIPSENFTSVSVMQAVGSVMTNK.Y
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	347	729.69	2186.06	729.70	2186.08	3	-7.79	16.3	12709	89	3	472 - 491	K.LKDFVSAMESSSTIQSEIAK.L	Oxidation: 8
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	193	871.41	870.40	871.42	870.41	1	-10.31	12.8	119804	38	3	449 - 455	K.VAEYFDK.A
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	253	498.25	994.48	498.25	994.49	2	-10.33	14.2	343784	54	3	366 - 373	K.FAQTLMER.G
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	574	924.12	2769.33	924.13	2769.36	3	-9.12	21.4	78821	83	3	76 - 101	K.GLELIPSENFTSVSVMQAVGSVMTNK.Y	Oxidation: 16
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	609	559.61	1675.81	559.62	1675.83	3	-8.78	22.2	107678	69	3	189 - 202	K.ISAVSIFFETMPYR.L	Oxidation: 11
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	519	902.96	1803.91	902.97	1803.92	2	-8.55	20.1	51516	69	2	188 - 202	K.KISAVSIFFETMPYR.L	Oxidation: 12
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	447	664.12	2652.43	664.12	2652.45	4	-6.89	18.5	146354	40	2	320 - 345	K.INQAVFPGLQGGPHNHTITGLAVALK.Q
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	76	494.74	987.46	494.74	987.47	2	-10.08	10.2	96024	50	3	494 - 501	R.HEVEEFAK.Q
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	568	924.12	2769.33	924.13	2769.36	3	-8.13	21.3	25743	102	3	76 - 101	K.GLELIPSENFTSVSVMQAVGSVMTNK.Y	Oxidation: 16
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	185	436.21	870.40	436.21	870.41	2	-9.41	12.7	525628	32	3	449 - 455	K.VAEYFDK.A
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	413	1066.55	1065.54	1066.56	1065.55	1	-9.15	17.8	56236	52	3	502 - 510	K.QFPTIGFEK.E
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	243	404.04	2418.20	404.04	2418.21	6	-6.54	13.9	231651	30	2	167 - 188	R.IMALDLPHGGHLSHGYQTDTKK.I
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	84	494.74	987.46	494.74	987.47	2	-9.74	10.4	37376	44	3	494 - 501	R.HEVEEFAK.Q
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	663	735.17	3670.81	735.17	3670.84	5	-6.70	23.4	6659	36	3	252 - 286	K.AVMLADMAHISGLVAANVIPSPFDYADVVTTTTHK.S	Oxidation: 7
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	145	506.25	1010.48	506.25	1010.49	2	-7.67	11.8	558496	48	3	366 - 373	K.FAQTLMER.G	Oxidation: 6
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	631	918.79	2753.34	918.79	2753.36	3	-8.03	22.7	23690	75	3	76 - 101	K.GLELIPSENFTSVSVMQAVGSVMTNK.Y	Oxidation: 23
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	677	914.71	3654.82	914.72	3654.84	4	-6.05	24	787976	50	3	252 - 286	K.AVMLADMAHISGLVAANVIPSPFDYADVVTTTTHK.S
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	595	801.40	2401.18	801.41	2401.20	3	-7.44	21.9	41833	104	3	50 - 70	K.QLNAPLEEVDPEIADIIEHEK.A
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	88	475.24	948.46	475.24	948.47	2	-7.51	10.5	460862	41	3	431 - 439	R.MGTPALTSR.G	Oxidation: 1
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	283	911.88	1821.75	911.89	1821.76	2	-6.78	14.9	31152	136	3	203 - 217	R.LDESTGYIDYDQMEK.S	Oxidation: 13
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	371	1157.52	1156.52	1157.54	1156.53	1	-9.60	16.8	3741	50	1	311 - 319	K.EVLYDFEDK.I
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	670	830.92	1659.82	830.92	1659.83	2	-8.33	23.9	6562	120	3	189 - 202	K.ISAVSIFFETMPYR.L
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	265	546.31	1090.61	546.31	1090.61	2	-7.62	14.5	167362	76	3	226 - 236	K.LIVAGASAYAR.L
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	632	1377.68	2753.34	1377.69	2753.36	2	-8.04	22.7	56514	19	3	76 - 101	K.GLELIPSENFTSVSVMQAVGSVMTNK.Y	Oxidation: 23
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	581	948.74	3790.95	948.75	3790.97	4	-5.89	21.5	88715	46	2	311 - 345	K.EVLYDFEDKINQAVFPGLQGGPHNHTITGLAVALK.Q
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	198	406.71	2434.19	406.71	2434.21	6	-5.14	12.9	11003	18	1	167 - 188	R.IMALDLPHGGHLSHGYQTDTKK.I	Oxidation: 2
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	176	590.83	1179.65	590.84	1179.66	2	-7.28	12.4	125011	89	3	404 - 414	K.VLEAVHIASNK.N
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	310	521.24	1040.47	521.25	1040.48	2	-9.72	15.5	12921	42	3	440 - 448	R.GFVEEDFAK.V
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	86	475.24	948.46	475.24	948.47	2	-9.53	10.4	258434	37	3	431 - 439	R.MGTPALTSR.G	Oxidation: 1
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	352	429.22	856.42	429.22	856.43	2	-11.65	16.4	7466	35	3	293 - 299	R.GAMIFFR.K	Oxidation: 3
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	399	1127.11	2252.20	1127.12	2252.22	2	-7.26	17.4	14857	23	1	374 - 394	R.GYELVSGGTDNHLVLVNLKPK.G
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	604	918.71	3670.82	918.72	3670.84	4	-5.51	22.1	382192	42	2	252 - 286	K.AVMLADMAHISGLVAANVIPSPFDYADVVTTTTHK.S	Oxidation: 3
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	262	546.31	1090.60	546.31	1090.61	2	-8.06	14.4	75441	76	3	226 - 236	K.LIVAGASAYAR.L
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	449	885.15	2652.43	885.16	2652.45	3	-7.13	18.6	562581	18	1	320 - 345	K.INQAVFPGLQGGPHNHTITGLAVALK.Q
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	705	913.46	2737.35	913.46	2737.37	3	-4.61	24.7	13106	77	3	76 - 101	K.GLELIPSENFTSVSVMQAVGSVMTNK.Y
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	250	498.25	994.48	498.25	994.49	2	-10.29	14.1	467359	54	3	366 - 373	K.FAQTLMER.G
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	234	577.53	2306.09	577.54	2306.11	4	-7.32	13.7	109701	27	3	167 - 187	R.IMALDLPHGGHLSHGYQTDTK.K	Oxidation: 2
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	165	1337.66	1336.65	1337.67	1336.66	1	-7.94	12.2	30792	36	2	354 - 365	K.AYQEQVLSNSAK.F
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	459	724.36	2170.07	724.37	2170.08	3	-5.76	18.8	280905	93	2	472 - 491	K.LKDFVSAMESSSTIQSEIAK.L
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	412	533.78	1065.54	533.78	1065.55	2	-9.15	17.8	10791	40	3	502 - 510	K.QFPTIGFEK.E
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	351	687.86	2747.41	687.62	2746.44	4	351.76	16.4	4118	41	1	404 - 430	K.VLEAVHIASNKNTVPGDVSAMVPGGIR.M	Oxidation: 21
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	392	751.74	2252.20	751.75	2252.22	3	-7.47	17.3	64511	34	3	374 - 394	R.GYELVSGGTDNHLVLVNLKPK.G
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	631	918.79	2753.34	918.79	2753.36	3	-8.03	22.7	23690	37	2	76 - 101	K.GLELIPSENFTSVSVMQAVGSVMTNK.Y	Oxidation: 16
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	187	436.21	870.41	436.21	870.41	2	-8.12	12.7	605370	32	3	449 - 455	K.VAEYFDK.A
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	190	436.21	870.40	436.21	870.41	2	-8.63	12.8	145012	29	3	449 - 455	K.VAEYFDK.A
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	680	914.71	3654.82	914.72	3654.84	4	-5.92	24.1	786417	61	3	252 - 286	K.AVMLADMAHISGLVAANVIPSPFDYADVVTTTTHK.S
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	665	735.17	3670.81	735.17	3670.84	5	-6.50	23.5	12921	41	3	252 - 286	K.AVMLADMAHISGLVAANVIPSPFDYADVVTTTTHK.S	Oxidation: 7
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	237	462.23	2306.09	462.23	2306.11	5	-7.53	13.8	78799	25	2	167 - 187	R.IMALDLPHGGHLSHGYQTDTK.K	Oxidation: 2
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	103	419.89	1256.64	419.89	1256.65	3	-5.63	10.8	266589	42	3	492 - 501	K.LRHEVEEFAK.Q
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	109	500.23	998.44	500.23	998.45	2	-7.13	11	204933	63	3	102 - 110	K.YSEGYPGAR.Y
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	394	564.06	2252.20	564.06	2252.22	4	-7.67	17.4	7966	46	3	374 - 394	R.GYELVSGGTDNHLVLVNLKPK.G
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	706	913.46	2737.35	913.46	2737.37	3	-7.05	24.8	4118	85	3	76 - 101	K.GLELIPSENFTSVSVMQAVGSVMTNK.Y
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	395	751.74	2252.20	751.75	2252.22	3	-7.68	17.4	112263	45	3	374 - 394	R.GYELVSGGTDNHLVLVNLKPK.G
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	425	523.94	1568.79	523.94	1568.80	3	-8.26	18	646585	54	1	415 - 430	K.NTVPGDVSAMVPGGIR.M
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	675	554.28	1659.82	554.28	1659.83	3	-9.07	24	40218	70	3	189 - 202	K.ISAVSIFFETMPYR.L
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	590	894.96	1787.91	894.97	1787.93	2	-9.63	21.7	573474	53	1	188 - 202	K.KISAVSIFFETMPYR.L
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	417	1066.55	1065.54	1066.56	1065.55	1	-9.01	17.8	13782	35	3	502 - 510	K.QFPTIGFEK.E
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	456	841.43	840.42	841.44	840.43	1	-9.11	18.7	277737	25	1	293 - 299	R.GAMIFFR.K
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	349	903.88	1805.75	903.89	1805.77	2	-7.87	16.3	35566	108	3	203 - 217	R.LDESTGYIDYDQMEK.S
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	585	948.74	3790.94	948.75	3790.97	4	-7.26	21.6	14267	36	2	311 - 345	K.EVLYDFEDKINQAVFPGLQGGPHNHTITGLAVALK.Q
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	154	400.70	799.38	400.70	799.39	2	-7.97	12	111105	24	2	237 - 242	R.LYDYAR.I
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	604	918.71	3670.82	918.72	3670.84	4	-5.51	22.1	382192	45	2	252 - 286	K.AVMLADMAHISGLVAANVIPSPFDYADVVTTTTHK.S	Oxidation: 7
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	614	559.61	1675.81	559.62	1675.83	3	-8.42	22.3	49099	55	3	189 - 202	K.ISAVSIFFETMPYR.L	Oxidation: 11
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	589	596.98	1787.91	596.98	1787.93	3	-9.62	21.7	109701	73	1	188 - 202	K.KISAVSIFFETMPYR.L
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	79	494.74	987.46	494.74	987.47	2	-9.65	10.3	33024	54	3	494 - 501	R.HEVEEFAK.Q
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	602	918.71	3670.82	918.72	3670.84	4	-4.96	22	714434	42	2	252 - 286	K.AVMLADMAHISGLVAANVIPSPFDYADVVTTTTHK.S	Oxidation: 3
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	195	487.84	2434.19	487.85	2434.21	5	-8.12	12.9	5747	22	1	167 - 188	R.IMALDLPHGGHLSHGYQTDTKK.I	Oxidation: 2
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	245	484.65	2418.20	484.65	2418.21	5	-5.65	14	533803	22	1	167 - 188	R.IMALDLPHGGHLSHGYQTDTKK.I
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	401	1035.93	2069.85	1035.94	2069.87	2	-7.75	17.5	9276	48	1	111 - 127	R.YYGGNEYIDMAETLCQK.R	Oxidation: 10
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	104	629.33	1256.64	629.33	1256.65	2	-5.63	10.8	280905	39	3	492 - 501	K.LRHEVEEFAK.Q
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	660	735.17	3670.81	735.17	3670.84	5	-6.44	23.4	45983	85	3	252 - 286	K.AVMLADMAHISGLVAANVIPSPFDYADVVTTTTHK.S	Oxidation: 3
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	584	759.20	3790.94	759.20	3790.97	5	-7.26	21.6	49135	22	2	311 - 345	K.EVLYDFEDKINQAVFPGLQGGPHNHTITGLAVALK.Q
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	665	735.17	3670.81	735.17	3670.84	5	-6.50	23.5	12921	60	3	252 - 286	K.AVMLADMAHISGLVAANVIPSPFDYADVVTTTTHK.S	Oxidation: 3
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	627	1377.68	2753.34	1377.69	2753.36	2	-8.44	22.6	9186	80	3	76 - 101	K.GLELIPSENFTSVSVMQAVGSVMTNK.Y	Oxidation: 23
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	625	918.79	2753.34	918.79	2753.36	3	-8.44	22.5	26801	42	3	76 - 101	K.GLELIPSENFTSVSVMQAVGSVMTNK.Y	Oxidation: 23
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	166	669.33	1336.65	669.34	1336.66	2	-6.89	12.2	59411	76	3	354 - 365	K.AYQEQVLSNSAK.F
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	490	755.14	3016.55	755.15	3016.57	4	-6.38	19.5	21283	33	2	140 - 166	K.WGVNVQPLSGSPANFHVYTALLKPHER.I
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	627	1377.68	2753.34	1377.69	2753.36	2	-8.44	22.6	9186	28	1	76 - 101	K.GLELIPSENFTSVSVMQAVGSVMTNK.Y	Oxidation: 16
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	709	1369.68	2737.35	1369.69	2737.37	2	-6.50	24.8	7591	29	2	76 - 101	K.GLELIPSENFTSVSVMQAVGSVMTNK.Y
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	318	1041.48	1040.47	1041.49	1040.48	1	-9.67	15.6	21625	43	1	440 - 448	R.GFVEEDFAK.V
1332	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	170	446.56	1336.65	446.56	1336.66	3	-8.30	12.3	204503	49	2	354 - 365	K.AYQEQVLSNSAK.F
1386	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	536	924.12	2769.35	924.13	2769.36	3	-3.02	21.5	10106	47	2	76 - 101	K.GLELIPSENFTSVSVMQAVGSVMTNK.Y	Oxidation: 16
1386	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	246	498.25	994.48	498.25	994.49	2	-7.28	14.8	3580	63	3	366 - 373	K.FAQTLMER.G
1386	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	252	546.31	1090.61	546.31	1090.61	2	-4.73	15	3449	83	3	226 - 236	K.LIVAGASAYAR.L
1386	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	177	590.84	1179.66	590.84	1179.66	2	-3.86	13.3	9819	89	2	404 - 414	K.VLEAVHIASNK.N
1386	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	443	421.22	840.43	421.22	840.43	2	-4.11	19.3	177018	43	2	293 - 299	R.GAMIFFR.K
1386	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	305	521.25	1040.48	521.25	1040.48	2	-4.61	16.2	10748	42	1	440 - 448	R.GFVEEDFAK.V
1386	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	186	436.21	870.41	436.21	870.41	2	-4.94	13.5	6700	30	2	449 - 455	K.VAEYFDK.A
1386	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	250	546.31	1090.61	546.31	1090.61	2	-2.51	14.9	14343	76	3	226 - 236	K.LIVAGASAYAR.L
1386	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	593	918.79	2753.36	918.79	2753.36	3	-1.39	23.2	150259	54	2	76 - 101	K.GLELIPSENFTSVSVMQAVGSVMTNK.Y	Oxidation: 16
1386	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	379	751.74	2252.21	751.75	2252.22	3	-3.36	17.8	32016	29	2	374 - 394	R.GYELVSGGTDNHLVLVNLKPK.G
1386	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	229	715.47	714.46	715.47	714.46	1	-5.79	14.4	5053	31	1	456 - 462	K.AVTIALK.V
1386	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	427	664.12	2652.44	664.12	2652.45	4	-3.90	19	47889	18	1	320 - 345	K.INQAVFPGLQGGPHNHTITGLAVALK.Q
1386	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	83	475.24	948.47	475.24	948.47	2	-4.90	11.1	6952	42	3	431 - 439	R.MGTPALTSR.G	Oxidation: 1
1386	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	571	838.92	1675.82	838.92	1675.83	2	-2.81	22.5	25634	87	3	189 - 202	K.ISAVSIFFETMPYR.L	Oxidation: 11
1386	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	594	918.79	2753.36	918.79	2753.36	3	-2.12	23.3	21451	34	2	76 - 101	K.GLELIPSENFTSVSVMQAVGSVMTNK.Y	Oxidation: 16
1386	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	616	914.72	3654.84	914.72	3654.84	4	-1.85	24.3	11390	28	1	252 - 286	K.AVMLADMAHISGLVAANVIPSPFDYADVVTTTTHK.S
1386	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	152	400.70	799.38	400.70	799.39	2	-6.40	12.7	11852	31	3	237 - 242	R.LYDYAR.I
1386	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	156	467.24	932.47	467.24	932.47	2	-8.71	12.8	9469	69	2	431 - 439	R.MGTPALTSR.G
1386	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	273	911.89	1821.76	911.89	1821.76	2	-3.13	15.4	3949	65	2	203 - 217	R.LDESTGYIDYDQMEK.S	Oxidation: 13
1386	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	240	498.25	994.48	498.25	994.49	2	-6.46	14.7	5730	53	3	366 - 373	K.FAQTLMER.G
1386	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	382	564.06	2252.21	564.06	2252.22	4	-3.33	17.9	11397	39	2	374 - 394	R.GYELVSGGTDNHLVLVNLKPK.G
1386	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	292	793.40	1584.79	793.40	1584.79	2	-4.11	15.9	41391	53	3	415 - 430	K.NTVPGDVSAMVPGGIR.M	Oxidation: 10
1386	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	103	419.89	1256.64	419.89	1256.65	3	-5.66	11.6	49950	38	2	492 - 501	K.LRHEVEEFAK.Q
1386	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	160	669.34	1336.66	669.34	1336.66	2	-3.58	12.9	9798	59	2	354 - 365	K.AYQEQVLSNSAK.F
1386	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	135	460.27	918.52	460.27	918.53	2	-4.60	12.3	136334	31	3	218 - 225	K.SATLFRPK.L
1386	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	127	460.27	918.52	460.27	918.53	2	-4.19	12.1	7891	50	3	218 - 225	K.SATLFRPK.L
1386	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	593	918.79	2753.36	918.79	2753.36	3	-1.39	23.2	150259	16	2	76 - 101	K.GLELIPSENFTSVSVMQAVGSVMTNK.Y	Oxidation: 23
1386	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	611	830.92	1659.83	830.92	1659.83	2	-3.25	24.2	34147	93	3	189 - 202	K.ISAVSIFFETMPYR.L
1386	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	142	506.25	1010.48	506.25	1010.49	2	-6.03	12.5	74240	52	3	366 - 373	K.FAQTLMER.G	Oxidation: 6
1386	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	391	533.78	1065.54	533.78	1065.55	2	-7.97	18.2	12014	48	3	502 - 510	K.QFPTIGFEK.E
1386	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	289	793.40	1584.79	793.40	1584.79	2	-3.37	15.8	21451	71	3	415 - 430	K.NTVPGDVSAMVPGGIR.M	Oxidation: 10
1386	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	157	400.70	799.38	400.70	799.39	2	-5.30	12.8	6190	31	3	237 - 242	R.LYDYAR.I
1386	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	130	460.27	918.53	460.27	918.53	2	-3.14	12.2	23754	40	3	218 - 225	K.SATLFRPK.L
1386	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	154	400.70	799.38	400.70	799.39	2	-5.12	12.8	8200	31	3	237 - 242	R.LYDYAR.I
1386	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	545	759.20	3790.96	759.20	3790.97	5	-1.09	21.9	5730	20	1	311 - 345	K.EVLYDFEDKINQAVFPGLQGGPHNHTITGLAVALK.Q
1386	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	341	429.22	856.42	429.22	856.43	2	-5.12	17	27892	28	3	293 - 299	R.GAMIFFR.K	Oxidation: 3
1386	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	609	830.92	1659.83	830.92	1659.83	2	-4.29	24.2	12940	93	3	189 - 202	K.ISAVSIFFETMPYR.L
1386	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	347	429.22	856.42	429.22	856.43	2	-5.66	17.1	23025	23	3	293 - 299	R.GAMIFFR.K	Oxidation: 3
1386	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	70	494.74	987.46	494.74	987.47	2	-7.01	10.8	106543	27	2	494 - 501	R.HEVEEFAK.Q
1386	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	81	475.24	948.46	475.24	948.47	2	-5.36	11.1	28776	46	3	431 - 439	R.MGTPALTSR.G	Oxidation: 1
1386	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	590	918.79	2753.36	918.79	2753.36	3	-1.36	22.9	73576	35	2	76 - 101	K.GLELIPSENFTSVSVMQAVGSVMTNK.Y	Oxidation: 23
1386	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	269	911.89	1821.76	911.89	1821.76	2	-2.74	15.3	9285	89	2	203 - 217	R.LDESTGYIDYDQMEK.S	Oxidation: 13
1386	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	140	506.25	1010.48	506.25	1010.49	2	-6.47	12.4	259551	55	3	366 - 373	K.FAQTLMER.G	Oxidation: 6
1386	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	397	533.78	1065.54	533.78	1065.55	2	-5.74	18.3	32741	52	3	502 - 510	K.QFPTIGFEK.E
1386	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	561	801.41	2401.20	801.41	2401.20	3	-1.70	22.2	6348	58	3	50 - 70	K.QLNAPLEEVDPEIADIIEHEK.A
1386	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	188	871.42	870.41	871.42	870.41	1	-4.95	13.5	26718	36	1	449 - 455	K.VAEYFDK.A
1386	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	558	801.41	2401.20	801.41	2401.20	3	-1.34	22.2	9182	71	3	50 - 70	K.QLNAPLEEVDPEIADIIEHEK.A
1386	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	162	446.56	1336.66	446.56	1336.66	3	-3.57	12.9	7986	49	2	354 - 365	K.AYQEQVLSNSAK.F
1386	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	101	629.33	1256.64	629.33	1256.65	2	-6.57	11.6	29244	16	1	492 - 501	K.LRHEVEEFAK.Q
1386	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	557	801.40	2401.19	801.41	2401.20	3	-3.38	22.1	3449	52	3	50 - 70	K.QLNAPLEEVDPEIADIIEHEK.A
1386	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	254	546.31	1090.61	546.31	1090.61	2	-4.64	15	4061	79	3	226 - 236	K.LIVAGASAYAR.L
1386	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	175	590.84	1179.66	590.84	1179.66	2	-3.69	13.2	48208	86	2	404 - 414	K.VLEAVHIASNK.N
1386	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	550	738.37	3686.83	738.37	3686.83	5	0.15	22	3634	22	1	252 - 286	K.AVMLADMAHISGLVAANVIPSPFDYADVVTTTTHK.S	Oxidation: 3
1386	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	549	922.72	3686.83	922.72	3686.83	4	0.15	22	11498	37	1	252 - 286	K.AVMLADMAHISGLVAANVIPSPFDYADVVTTTTHK.S	Oxidation: 3
1386	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	296	529.27	1584.79	529.27	1584.79	3	-3.53	16	6924	51	1	415 - 430	K.NTVPGDVSAMVPGGIR.M	Oxidation: 10
1386	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	344	429.22	856.42	429.22	856.43	2	-6.92	17.1	27256	29	3	293 - 299	R.GAMIFFR.K	Oxidation: 3
1386	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	607	830.92	1659.83	830.92	1659.83	2	-2.84	24.1	25933	90	3	189 - 202	K.ISAVSIFFETMPYR.L
1386	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	380	564.06	2252.21	564.06	2252.22	4	-3.36	17.9	355577	42	2	374 - 394	R.GYELVSGGTDNHLVLVNLKPK.G
1386	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	191	436.21	870.41	436.21	870.41	2	-5.51	13.6	5796	37	2	449 - 455	K.VAEYFDK.A
1386	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	613	554.28	1659.83	554.28	1659.83	3	-3.24	24.2	10180	45	3	189 - 202	K.ISAVSIFFETMPYR.L
1386	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	242	498.25	994.48	498.25	994.49	2	-6.44	14.7	5909	54	3	366 - 373	K.FAQTLMER.G
1386	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	440	421.22	840.43	421.22	840.43	2	-3.83	19.2	136334	43	2	293 - 299	R.GAMIFFR.K
1386	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	354	579.27	1156.52	579.27	1156.53	2	-4.55	17.3	5765	46	1	311 - 319	K.EVLYDFEDK.I
1386	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	393	533.78	1065.54	533.78	1065.55	2	-5.72	18.2	31701	55	3	502 - 510	K.QFPTIGFEK.E
1386	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	322	729.70	2186.07	729.70	2186.08	3	-3.30	16.5	28187	97	1	472 - 491	K.LKDFVSAMESSSTIQSEIAK.L	Oxidation: 8
1386	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	295	793.40	1584.79	793.40	1584.79	2	-3.52	16	8345	68	3	415 - 430	K.NTVPGDVSAMVPGGIR.M	Oxidation: 10
1386	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	147	506.25	1010.48	506.25	1010.49	2	-5.03	12.6	53429	44	3	366 - 373	K.FAQTLMER.G	Oxidation: 6
1386	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	578	838.92	1675.82	838.92	1675.83	2	-3.49	22.6	3949	26	3	189 - 202	K.ISAVSIFFETMPYR.L	Oxidation: 11
1386	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	164	446.56	1336.66	446.56	1336.66	3	-2.20	13	6959	32	2	354 - 365	K.AYQEQVLSNSAK.F
1386	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	334	903.89	1805.76	903.89	1805.77	2	-3.68	16.8	20161	55	1	203 - 217	R.LDESTGYIDYDQMEK.S
1386	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	73	494.74	987.46	494.74	987.47	2	-7.45	10.9	50598	36	2	494 - 501	R.HEVEEFAK.Q
1386	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	574	559.61	1675.82	559.62	1675.83	3	-3.17	22.5	9285	55	1	189 - 202	K.ISAVSIFFETMPYR.L	Oxidation: 11
1386	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	381	751.74	2252.21	751.75	2252.22	3	-3.33	17.9	39489	32	2	374 - 394	R.GYELVSGGTDNHLVLVNLKPK.G
1386	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	608	554.28	1659.83	554.28	1659.83	3	-2.84	24.1	49231	40	3	189 - 202	K.ISAVSIFFETMPYR.L
1386	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	539	924.12	2769.35	924.13	2769.36	3	-1.34	21.5	14604	33	2	76 - 101	K.GLELIPSENFTSVSVMQAVGSVMTNK.Y	Oxidation: 16
1386	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	100	419.89	1256.64	419.89	1256.65	3	-6.56	11.5	41788	38	2	492 - 501	K.LRHEVEEFAK.Q
1386	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	468	755.15	3016.56	755.15	3016.57	4	-1.39	19.9	8412	17	1	140 - 166	K.WGVNVQPLSGSPANFHVYTALLKPHER.I
1386	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	163	669.34	1336.66	669.34	1336.66	2	-2.20	13	8412	64	2	354 - 365	K.AYQEQVLSNSAK.F
1386	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	469	604.32	3016.56	604.32	3016.57	5	-1.39	19.9	6959	22	1	140 - 166	K.WGVNVQPLSGSPANFHVYTALLKPHER.I
1386	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	573	838.92	1675.82	838.92	1675.83	2	-3.18	22.5	89818	77	3	189 - 202	K.ISAVSIFFETMPYR.L	Oxidation: 11
1386	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	159	467.24	932.47	467.24	932.47	2	-7.41	12.8	15295	46	2	431 - 439	R.MGTPALTSR.G
1386	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	610	554.28	1659.83	554.28	1659.83	3	-4.28	24.2	10748	61	3	189 - 202	K.ISAVSIFFETMPYR.L
1386	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	79	475.24	948.46	475.24	948.47	2	-9.19	11	10269	21	3	431 - 439	R.MGTPALTSR.G	Oxidation: 1
1445	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	64	475.24	948.47	475.24	948.47	2	-1.03	11	107419	44	4	431 - 439	R.MGTPALTSR.G	Oxidation: 1
1445	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	85	500.23	998.44	500.23	998.45	2	-3.59	11.5	8652	46	2	102 - 110	K.YSEGYPGAR.Y
1445	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	369	533.78	1065.54	533.78	1065.55	2	-4.73	18	107419	34	2	502 - 510	K.QFPTIGFEK.E
1445	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	298	687.62	2746.45	687.62	2746.44	4	0.79	16.3	9101	32	1	404 - 430	K.VLEAVHIASNKNTVPGDVSAMVPGGIR.M	Oxidation: 21
1445	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	217	498.25	994.49	498.25	994.49	2	-0.48	14.5	4855	42	1	366 - 373	K.FAQTLMER.G
1445	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	114	506.25	1010.48	506.25	1010.49	2	-5.24	12.2	16870	52	3	366 - 373	K.FAQTLMER.G	Oxidation: 6
1445	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	227	546.31	1090.61	546.31	1090.61	2	0.20	14.7	34316	79	3	226 - 236	K.LIVAGASAYAR.L
1445	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	302	729.70	2186.08	729.70	2186.08	3	-0.92	16.4	25428	55	1	472 - 491	K.LKDFVSAMESSSTIQSEIAK.L	Oxidation: 8
1445	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	163	436.21	870.41	436.21	870.41	2	-6.24	13.3	4139	36	2	449 - 455	K.VAEYFDK.A
1445	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	327	429.22	856.42	429.22	856.43	2	-2.02	17	16852	17	2	293 - 299	R.GAMIFFR.K	Oxidation: 3
1445	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	130	400.70	799.38	400.70	799.39	2	-2.70	12.5	6176	24	3	237 - 242	R.LYDYAR.I
1445	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	334	579.27	1156.52	579.27	1156.53	2	-3.38	17.1	23660	21	2	311 - 319	K.EVLYDFEDK.I
1445	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	230	546.31	1090.61	546.31	1090.61	2	-2.22	14.8	24806	87	3	226 - 236	K.LIVAGASAYAR.L
1445	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	161	436.21	870.40	436.21	870.41	2	-11.01	13.2	13235	17	2	449 - 455	K.VAEYFDK.A
1445	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	135	446.56	1336.66	446.56	1336.66	3	-2.25	12.6	5552	41	1	354 - 365	K.AYQEQVLSNSAK.F
1445	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	357	564.06	2252.21	564.06	2252.22	4	-1.48	17.7	7012	27	3	374 - 394	R.GYELVSGGTDNHLVLVNLKPK.G
1445	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	354	751.75	2252.21	751.75	2252.22	3	-1.23	17.6	16383	27	2	374 - 394	R.GYELVSGGTDNHLVLVNLKPK.G
1445	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	60	475.24	948.47	475.24	948.47	2	-2.21	10.9	4350	44	4	431 - 439	R.MGTPALTSR.G	Oxidation: 1
1445	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	372	533.78	1065.54	533.78	1065.55	2	-5.63	18.1	71309	42	2	502 - 510	K.QFPTIGFEK.E
1445	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	105	460.27	918.53	460.27	918.53	2	-0.08	11.9	5318	41	2	218 - 225	K.SATLFRPK.L
1445	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	508	838.92	1675.83	838.92	1675.83	2	-0.73	22.3	11312	21	2	189 - 202	K.ISAVSIFFETMPYR.L	Oxidation: 11
1445	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	405	523.29	1566.86	523.30	1566.87	3	-3.78	18.8	3776	16	1	449 - 462	K.VAEYFDKAVTIALK.V
1445	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	133	400.70	799.38	400.70	799.39	2	-2.15	12.6	8804	31	3	237 - 242	R.LYDYAR.I
1445	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	355	564.06	2252.21	564.06	2252.22	4	-1.24	17.6	23858	42	3	374 - 394	R.GYELVSGGTDNHLVLVNLKPK.G
1445	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	282	521.25	1040.48	521.25	1040.48	2	-2.04	15.9	15085	32	2	440 - 448	R.GFVEEDFAK.V
1445	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	109	460.27	918.53	460.27	918.53	2	-0.17	12	17403	40	2	218 - 225	K.SATLFRPK.L
1445	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	121	506.25	1010.48	506.25	1010.49	2	-3.01	12.3	10746	27	3	366 - 373	K.FAQTLMER.G	Oxidation: 6
1445	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	127	400.70	799.39	400.70	799.39	2	-0.08	12.5	8065	27	3	237 - 242	R.LYDYAR.I
1445	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	56	475.24	948.46	475.24	948.47	2	-5.81	10.7	4860	25	4	431 - 439	R.MGTPALTSR.G	Oxidation: 1
1445	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	271	793.40	1584.79	793.40	1584.79	2	-2.54	15.7	4111	54	1	415 - 430	K.NTVPGDVSAMVPGGIR.M	Oxidation: 10
1445	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	284	521.25	1040.48	521.25	1040.48	2	-1.89	16	12824	34	2	440 - 448	R.GFVEEDFAK.V
1445	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	226	546.31	1090.61	546.31	1090.61	2	-3.06	14.7	4802	82	3	226 - 236	K.LIVAGASAYAR.L
1445	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	331	579.27	1156.53	579.27	1156.53	2	-0.74	17	11586	34	2	311 - 319	K.EVLYDFEDK.I
1445	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	57	475.24	948.47	475.24	948.47	2	-4.27	10.8	4694	47	4	431 - 439	R.MGTPALTSR.G	Oxidation: 1
1445	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	356	751.74	2252.21	751.75	2252.22	3	-1.49	17.7	6255	28	2	374 - 394	R.GYELVSGGTDNHLVLVNLKPK.G
1445	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	82	419.89	1256.65	419.89	1256.65	3	-0.51	11.4	7917	47	2	492 - 501	K.LRHEVEEFAK.Q
1445	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	507	838.92	1675.82	838.92	1675.83	2	-2.69	22.3	17228	17	2	189 - 202	K.ISAVSIFFETMPYR.L	Oxidation: 11
1445	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	83	500.23	998.44	500.23	998.45	2	-1.55	11.4	5756	57	2	102 - 110	K.YSEGYPGAR.Y
1445	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	134	669.34	1336.66	669.34	1336.66	2	-2.25	12.6	841	70	2	354 - 365	K.AYQEQVLSNSAK.F
1445	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	243	911.89	1821.76	911.89	1821.76	2	-0.32	15.1	8477	71	1	203 - 217	R.LDESTGYIDYDQMEK.S	Oxidation: 13
1445	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	509	559.62	1675.83	559.62	1675.83	3	-0.74	22.3	7410	32	1	189 - 202	K.ISAVSIFFETMPYR.L	Oxidation: 11
1445	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	136	669.34	1336.66	669.34	1336.66	2	-1.83	12.7	17239	78	2	354 - 365	K.AYQEQVLSNSAK.F
1445	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	153	590.84	1179.66	590.84	1179.66	2	-3.68	13	5861	44	2	404 - 414	K.VLEAVHIASNK.N
1445	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	324	429.22	856.42	429.22	856.43	2	-3.63	16.9	11945	28	2	293 - 299	R.GAMIFFR.K	Oxidation: 3
1445	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	86	419.89	1256.65	419.89	1256.65	3	-2.32	11.5	9702	51	2	492 - 501	K.LRHEVEEFAK.Q
1445	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	358	564.06	2252.21	564.06	2252.22	4	-1.59	17.7	3873	17	3	374 - 394	R.GYELVSGGTDNHLVLVNLKPK.G
1445	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	151	590.84	1179.66	590.84	1179.66	2	-2.95	13	33086	79	2	404 - 414	K.VLEAVHIASNK.N
1445	AT4G37930.1	AHM (serine alanine hydroxymethyltransferase)	other photorespiratory enzymes	b) photorespiration	mitochondria	117	506.25	1010.48	506.25	1010.49	2	-3.05	12.2	2438	51	3	366 - 373	K.FAQTLMER.G	Oxidation: 6
1275	AT1G17290.1	AlaAT1 (alanine aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	21	610.31	1218.60	610.31	1218.60	2	0.24	8.9	18747	65	2	169 - 180	R.ATGAYSHSQGIK.G
1275	AT1G17290.1	AlaAT1 (alanine aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	24	610.31	1218.60	610.31	1218.60	2	0.24	9	5858	44	2	169 - 180	R.ATGAYSHSQGIK.G
1275	AT1G17290.1	AlaAT1 (alanine aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	17	407.21	1218.60	407.21	1218.60	3	-1.46	8.8	37564	57	3	169 - 180	R.ATGAYSHSQGIK.G
1275	AT1G17290.1	AlaAT1 (alanine aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	208	486.28	970.54	486.28	970.54	2	-0.57	13.4	7753	43	3	84 - 92	R.GEIVNIAQK.L
1275	AT1G17290.1	AlaAT1 (alanine aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	23	407.21	1218.60	407.21	1218.60	3	0.24	9	10447	52	3	169 - 180	R.ATGAYSHSQGIK.G
1275	AT1G17290.1	AlaAT1 (alanine aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	35	544.79	1087.57	544.80	1087.59	2	-12.14	9.3	6832	20	1	93 - 101	K.LQEDLKTNK.D
1275	AT1G17290.1	AlaAT1 (alanine aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	382	630.36	1258.70	630.36	1258.70	2	-2.37	17.3	9801	51	3	492 - 504	K.ATGIVVVPGSGFR.Q
1275	AT1G17290.1	AlaAT1 (alanine aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	233	515.76	1029.51	515.76	1029.51	2	-1.44	13.9	55171	44	1	184 - 193	R.DAIADGIEAR.D
1275	AT1G17290.1	AlaAT1 (alanine aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	406	759.85	1517.68	759.85	1517.68	2	0.57	17.9	16249	51	1	370 - 383	R.GGYMEVTGFTSDVR.E
1275	AT1G17290.1	AlaAT1 (alanine aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	20	407.21	1218.60	407.21	1218.60	3	0.24	8.9	31282	48	3	169 - 180	R.ATGAYSHSQGIK.G
1275	AT1G17290.1	AlaAT1 (alanine aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	379	630.36	1258.70	630.36	1258.70	2	-0.88	17.2	5858	50	3	492 - 504	K.ATGIVVVPGSGFR.Q
1275	AT1G17290.1	AlaAT1 (alanine aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	474	616.32	1845.93	616.32	1845.93	3	0.24	19.4	24552	31	2	438 - 453	K.TLEEALNKLEGVTCNR.A	Carbamidomethyl: 14
1275	AT1G17290.1	AlaAT1 (alanine aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	376	630.36	1258.71	630.36	1258.70	2	1.74	17.2	18747	29	3	492 - 504	K.ATGIVVVPGSGFR.Q
1275	AT1G17290.1	AlaAT1 (alanine aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	252	456.27	910.53	456.27	910.52	2	2.14	14.3	6179	48	3	161 - 168	K.ILDQIPGR.A
1275	AT1G17290.1	AlaAT1 (alanine aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	210	971.55	970.54	971.55	970.54	1	-0.58	13.4	10284	26	1	84 - 92	R.GEIVNIAQK.L
1275	AT1G17290.1	AlaAT1 (alanine aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	471	616.32	1845.93	616.32	1845.93	3	1.18	19.4	81714	49	2	438 - 453	K.TLEEALNKLEGVTCNR.A	Carbamidomethyl: 14
1275	AT1G17290.1	AlaAT1 (alanine aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	409	466.26	930.51	466.26	930.51	2	-7.57	17.9	10145	21	2	426 - 434	K.DGILSSLAR.R
1275	AT1G17290.1	AlaAT1 (alanine aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	390	1104.08	2206.14	1104.07	2206.13	2	1.31	17.4	6832	20	2	283 - 303	R.ALAVINPGNPTGQVLSEENQR.D
1275	AT1G17290.1	AlaAT1 (alanine aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	204	486.28	970.55	486.28	970.54	2	2.37	13.3	9071	31	3	84 - 92	R.GEIVNIAQK.L
1275	AT1G17290.1	AlaAT1 (alanine aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	34	437.24	872.46	437.24	872.46	2	-4.39	9.3	4731	57	2	470 - 478	K.AIAAAEAEK.T
1275	AT1G17290.1	AlaAT1 (alanine aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	249	456.27	910.52	456.27	910.52	2	-1.63	14.3	6439	49	3	161 - 168	K.ILDQIPGR.A
1275	AT1G17290.1	AlaAT1 (alanine aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	463	647.35	1292.68	647.36	1292.70	2	-9.89	19.2	34995	23	1	349 - 360	K.DLALVSFQSVSK.G
1275	AT1G17290.1	AlaAT1 (alanine aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	387	1104.08	2206.14	1104.07	2206.13	2	3.75	17.4	12217	46	2	283 - 303	R.ALAVINPGNPTGQVLSEENQR.D
1275	AT1G17290.1	AlaAT1 (alanine aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	440	581.93	1742.78	581.93	1742.77	3	1.87	18.7	12780	34	1	530 - 543	R.LTAFHQSFMDEFRD.-
1275	AT1G17290.1	AlaAT1 (alanine aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	410	466.26	930.51	466.26	930.51	2	-7.33	18	8035	17	2	426 - 434	K.DGILSSLAR.R
1275	AT1G17290.1	AlaAT1 (alanine aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	246	456.27	910.52	456.27	910.52	2	-2.38	14.2	5057	49	3	161 - 168	K.ILDQIPGR.A
1275	AT1G17290.1	AlaAT1 (alanine aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	31	437.24	872.46	437.24	872.46	2	0.94	9.2	140724	36	2	470 - 478	K.AIAAAEAEK.T
1275	AT1G17290.1	AlaAT1 (alanine aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	206	486.28	970.54	486.28	970.54	2	-3.16	13.3	19417	48	3	84 - 92	R.GEIVNIAQK.L
1333	AT1G17290.1	AlaAT1 (alanine aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	388	630.35	1258.69	630.36	1258.70	2	-7.13	17.3	26872	49	3	492 - 504	K.ATGIVVVPGSGFR.Q
1333	AT1G17290.1	AlaAT1 (alanine aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	395	1104.07	2206.12	1104.07	2206.13	2	-4.42	17.4	67764	40	1	283 - 303	R.ALAVINPGNPTGQVLSEENQR.D
1333	AT1G17290.1	AlaAT1 (alanine aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	215	971.54	970.54	971.55	970.54	1	-7.26	13.4	7807	36	2	84 - 92	R.GEIVNIAQK.L
1333	AT1G17290.1	AlaAT1 (alanine aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	498	630.98	1889.91	630.98	1889.92	3	-6.08	19.7	325754	29	2	454 - 469	R.AEGAMYLFPCLHLPQK.A	Oxidation: 5
1333	AT1G17290.1	AlaAT1 (alanine aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	368	587.26	1758.76	587.26	1758.77	3	-2.23	16.8	117680	40	1	530 - 543	R.LTAFHQSFMDEFRD.-	Oxidation: 9
1333	AT1G17290.1	AlaAT1 (alanine aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	392	630.35	1258.69	630.36	1258.70	2	-8.71	17.3	42084	34	3	492 - 504	K.ATGIVVVPGSGFR.Q
1333	AT1G17290.1	AlaAT1 (alanine aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	385	630.35	1258.69	630.36	1258.70	2	-10.09	17.2	64859	56	3	492 - 504	K.ATGIVVVPGSGFR.Q
1333	AT1G17290.1	AlaAT1 (alanine aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	43	544.79	1087.57	544.80	1087.59	2	-13.72	9.1	10744	38	1	93 - 101	K.LQEDLKTNK.D
1333	AT1G17290.1	AlaAT1 (alanine aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	353	452.91	1355.70	452.91	1355.72	3	-8.61	16.5	8833	36	2	181 - 193	K.GLRDAIADGIEAR.D
1333	AT1G17290.1	AlaAT1 (alanine aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	416	759.85	1517.68	759.85	1517.68	2	-3.81	17.9	12169	60	1	370 - 383	R.GGYMEVTGFTSDVR.E
1333	AT1G17290.1	AlaAT1 (alanine aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	211	486.28	970.54	486.28	970.54	2	-6.97	13.3	260265	44	3	84 - 92	R.GEIVNIAQK.L
1333	AT1G17290.1	AlaAT1 (alanine aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	239	515.76	1029.50	515.76	1029.51	2	-7.48	13.9	61051	50	1	184 - 193	R.DAIADGIEAR.D
1333	AT1G17290.1	AlaAT1 (alanine aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	501	630.98	1889.91	630.98	1889.92	3	-5.40	19.8	238275	30	2	454 - 469	R.AEGAMYLFPCLHLPQK.A	Oxidation: 5
1333	AT1G17290.1	AlaAT1 (alanine aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	605	850.44	2548.29	850.44	2548.31	3	-5.30	22.1	382783	32	1	311 - 332	K.QEGLVLLADEVYQENVYVPDKK.F
1333	AT1G17290.1	AlaAT1 (alanine aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	86	467.19	932.36	467.19	932.37	2	-6.82	10.5	141963	41	1	361 - 368	K.GYYGECGK.R	Carbamidomethyl: 6
1333	AT1G17290.1	AlaAT1 (alanine aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	350	452.91	1355.71	452.91	1355.72	3	-7.53	16.4	6619	49	2	181 - 193	K.GLRDAIADGIEAR.D
1333	AT1G17290.1	AlaAT1 (alanine aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	421	466.26	930.50	466.26	930.51	2	-10.83	18	73351	50	1	426 - 434	K.DGILSSLAR.R
1333	AT1G17290.1	AlaAT1 (alanine aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	27	407.20	1218.59	407.21	1218.60	3	-5.21	8.8	112094	52	2	169 - 180	R.ATGAYSHSQGIK.G
1333	AT1G17290.1	AlaAT1 (alanine aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	209	486.28	970.54	486.28	970.54	2	-7.96	13.2	71381	44	3	84 - 92	R.GEIVNIAQK.L
1333	AT1G17290.1	AlaAT1 (alanine aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	40	437.23	872.45	437.24	872.46	2	-7.78	9.1	8914	49	2	470 - 478	K.AIAAAEAEK.T
1333	AT1G17290.1	AlaAT1 (alanine aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	28	610.30	1218.59	610.31	1218.60	2	-5.22	8.8	83412	70	2	169 - 180	R.ATGAYSHSQGIK.G
1333	AT1G17290.1	AlaAT1 (alanine aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	25	610.30	1218.59	610.31	1218.60	2	-3.88	8.7	26282	72	2	169 - 180	R.ATGAYSHSQGIK.G
1333	AT1G17290.1	AlaAT1 (alanine aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	253	456.26	910.52	456.27	910.52	2	-9.17	14.2	324804	54	1	161 - 168	K.ILDQIPGR.A
1333	AT1G17290.1	AlaAT1 (alanine aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	212	971.55	970.54	971.55	970.54	1	-6.98	13.3	79307	28	2	84 - 92	R.GEIVNIAQK.L
1333	AT1G17290.1	AlaAT1 (alanine aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	451	581.93	1742.76	581.93	1742.77	3	-6.69	18.7	156415	45	1	530 - 543	R.LTAFHQSFMDEFRD.-
1333	AT1G17290.1	AlaAT1 (alanine aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	24	407.21	1218.59	407.21	1218.60	3	-3.89	8.7	29922	48	2	169 - 180	R.ATGAYSHSQGIK.G
1333	AT1G17290.1	AlaAT1 (alanine aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	84	745.40	744.40	745.41	744.40	1	-7.82	10.4	26801	35	1	93 - 98	K.LQEDLK.T
1333	AT1G17290.1	AlaAT1 (alanine aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	213	486.28	970.54	486.28	970.54	2	-7.26	13.3	44517	44	3	84 - 92	R.GEIVNIAQK.L
1333	AT1G17290.1	AlaAT1 (alanine aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	42	437.23	872.45	437.24	872.46	2	-8.21	9.1	7491	41	2	470 - 478	K.AIAAAEAEK.T
1333	AT1G72330.1	AlaAT2 (alanine aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	416	759.85	1517.68	759.85	1517.68	2	-3.81	17.9	12169	60	1	367 - 380	R.GGYMEVTGFTSDVR.E
1333	AT1G72330.1	AlaAT2 (alanine aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	303	448.22	894.42	448.22	894.43	2	-8.65	15.4	23992	35	2	301 - 307	R.DIVNFCK.Q	Carbamidomethyl: 6
1333	AT1G72330.1	AlaAT2 (alanine aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	84	745.40	744.40	745.41	744.40	1	-7.82	10.4	26801	35	1	90 - 95	K.LQEDLK.T
1333	AT1G72330.1	AlaAT2 (alanine aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	28	610.30	1218.59	610.31	1218.60	2	-5.22	8.8	83412	70	2	166 - 177	R.ATGAYSHSQGIK.G
1333	AT1G72330.1	AlaAT2 (alanine aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	408	523.22	1044.43	523.22	1044.43	2	1.06	17.7	16328	53	1	533 - 540	K.SFMDEFRN.-
1333	AT1G72330.1	AlaAT2 (alanine aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	159	469.23	936.45	469.24	936.46	2	-7.29	12.1	286029	26	1	423 - 431	R.DGILSSMAK.R	Oxidation: 7
1333	AT1G72330.1	AlaAT2 (alanine aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	196	460.77	919.52	460.77	919.52	2	-5.54	12.9	118359	39	1	158 - 165	R.ILDHIPGR.A
1333	AT1G72330.1	AlaAT2 (alanine aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	371	585.78	1169.54	585.78	1169.55	2	-9.77	16.9	65690	27	1	451 - 460	R.AEGAMYLFPR.I	Oxidation: 5
1333	AT1G72330.1	AlaAT2 (alanine aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	56	931.47	930.46	931.47	930.47	1	-7.45	9.4	17674	18	1	467 - 475	K.AIEAAEAEK.T
1333	AT1G72330.1	AlaAT2 (alanine aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	24	407.21	1218.59	407.21	1218.60	3	-3.89	8.7	29922	48	2	166 - 177	R.ATGAYSHSQGIK.G
1333	AT1G72330.1	AlaAT2 (alanine aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	52	466.24	930.46	466.24	930.47	2	-8.02	9.3	3877	68	2	467 - 475	K.AIEAAEAEK.T
1333	AT1G72330.1	AlaAT2 (alanine aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	25	610.30	1218.59	610.31	1218.60	2	-3.88	8.7	26282	72	2	166 - 177	R.ATGAYSHSQGIK.G
1333	AT1G72330.1	AlaAT2 (alanine aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	86	467.19	932.36	467.19	932.37	2	-6.82	10.5	141963	41	1	358 - 365	K.GYYGECGK.R	Carbamidomethyl: 6
1333	AT1G72330.1	AlaAT2 (alanine aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	43	544.79	1087.57	544.80	1087.59	2	-13.72	9.1	10744	38	1	90 - 98	K.LQEDLKTNK.D
1333	AT1G72330.1	AlaAT2 (alanine aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	27	407.20	1218.59	407.21	1218.60	3	-5.21	8.8	112094	52	2	166 - 177	R.ATGAYSHSQGIK.G
1333	AT1G72330.1	AlaAT2 (alanine aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	433	1110.08	2218.15	1110.09	2218.17	2	-8.55	18.3	169598	84	1	280 - 300	R.ALVVINPGNPTGQVLAEENQR.D
1333	AT1G72330.1	AlaAT2 (alanine aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	212	971.55	970.54	971.55	970.54	1	-6.98	13.3	79307	28	2	81 - 89	R.GEIVNIAQK.L
1333	AT1G72330.1	AlaAT2 (alanine aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	54	466.24	930.46	466.24	930.47	2	-7.44	9.4	8294	68	2	467 - 475	K.AIEAAEAEK.T
1333	AT1G72330.1	AlaAT2 (alanine aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	209	486.28	970.54	486.28	970.54	2	-7.96	13.2	71381	44	3	81 - 89	R.GEIVNIAQK.L
1333	AT1G72330.1	AlaAT2 (alanine aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	301	448.22	894.42	448.22	894.43	2	-7.69	15.3	72703	35	2	301 - 307	R.DIVNFCK.Q	Carbamidomethyl: 6
1333	AT1G72330.1	AlaAT2 (alanine aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	331	461.23	920.45	461.24	920.46	2	-10.66	16	115299	31	1	423 - 431	R.DGILSSMAK.R
1333	AT1G72330.1	AlaAT2 (alanine aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	213	486.28	970.54	486.28	970.54	2	-7.26	13.3	44517	44	3	81 - 89	R.GEIVNIAQK.L
1333	AT1G72330.1	AlaAT2 (alanine aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	215	971.54	970.54	971.55	970.54	1	-7.26	13.4	7807	36	2	81 - 89	R.GEIVNIAQK.L
1333	AT1G72330.1	AlaAT2 (alanine aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	605	850.44	2548.29	850.44	2548.31	3	-5.30	22.1	382783	32	1	308 - 329	K.QEGLVLLADEVYQENVYVPDKK.F
1333	AT1G72330.1	AlaAT2 (alanine aminotransferase 2)	amino acid metabolism	g) other metabolic pathways	mitochondria	211	486.28	970.54	486.28	970.54	2	-6.97	13.3	260265	44	3	81 - 89	R.GEIVNIAQK.L
651	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	326	749.39	1496.77	749.38	1496.75	2	13.32	20.5	6472	54	2	230 - 243	K.TAEQTPLTAFYAGK.L
651	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	284	513.79	1025.56	513.78	1025.55	2	8.12	19.2	64981	81	3	462 - 471	K.YGLAAGVFTK.N
651	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	358	641.88	1281.75	641.88	1281.74	2	1.06	21.5	552058	65	1	527 - 538	K.AVVTALNKPAWI.-
651	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	282	513.79	1025.56	513.78	1025.55	2	1.39	19.1	42083	87	3	462 - 471	K.YGLAAGVFTK.N
651	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	329	749.39	1496.76	749.38	1496.75	2	5.03	20.6	10639	22	2	230 - 243	K.TAEQTPLTAFYAGK.L
651	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	287	513.79	1025.56	513.78	1025.55	2	4.15	19.3	76537	65	3	462 - 471	K.YGLAAGVFTK.N
651	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	367	703.10	2106.26	703.09	2106.24	3	10.64	21.8	5818	43	1	289 - 309	K.VILGLAANSNLKPVTLELGGK.S
713	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	287	706.90	1411.79	706.90	1411.79	2	2.64	17.1	10909	27	1	216 - 229	K.VGPALACGNTIVLK.T	Carbamidomethyl: 7
713	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	201	403.21	1206.62	403.22	1206.62	3	-1.36	14.4	25518	40	1	447 - 456	K.FSDVDEVIKR.A
713	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	204	514.75	1027.48	514.75	1027.49	2	-1.34	14.5	7111	30	1	351 - 358	K.VYDEFVEK.S
713	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	198	411.22	820.43	411.22	820.43	2	-3.36	14.3	8511	37	1	128 - 134	R.FADLVEK.H
713	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	374	703.09	2106.25	703.09	2106.24	3	1.95	19.8	21530	20	1	289 - 309	K.VILGLAANSNLKPVTLELGGK.S
713	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	200	604.32	1206.62	604.32	1206.62	2	-1.36	14.4	18563	57	1	447 - 456	K.FSDVDEVIKR.A
713	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	164	549.28	1096.54	549.28	1096.54	2	1.01	13.3	34947	71	2	278 - 288	K.LAFTGSTDTGK.V
713	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	240	526.27	1050.52	526.27	1050.52	2	-0.26	15.6	12204	20	1	447 - 455	K.FSDVDEVIK.R
713	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	167	549.28	1096.54	549.28	1096.54	2	-1.24	13.4	11668	74	2	278 - 288	K.LAFTGSTDTGK.V
713	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	235	599.33	1196.64	599.33	1196.64	2	-1.31	15.5	4670	57	1	375 - 385	K.GIEQGPQIDLK.Q
713	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	327	749.39	1496.76	749.38	1496.75	2	3.80	18.4	20573	28	1	230 - 243	K.TAEQTPLTAFYAGK.L
781	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	211	526.26	1050.52	526.27	1050.52	2	-7.54	15.9	5659	54	2	447 - 455	K.FSDVDEVIK.R
781	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	210	599.32	1196.63	599.33	1196.64	2	-5.87	15.9	5429	74	1	375 - 385	K.GIEQGPQIDLK.Q
781	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	10	402.20	802.38	402.20	802.39	2	-11.02	8.6	6547	28	4	472 - 478	K.NLDTANR.V
781	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	332	641.87	1281.73	641.88	1281.74	2	-12.82	19.7	26035	72	2	527 - 538	K.AVVTALNKPAWI.-
781	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	259	574.27	1146.53	574.27	1146.53	2	-0.58	17.4	8577	27	3	106 - 115	R.TAFDEGPWPK.M
781	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	345	750.39	1498.77	750.40	1498.78	2	-7.17	20.2	77190	29	1	415 - 427	K.GYFIQPTVFSNVK.D
781	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	252	574.27	1146.53	574.27	1146.53	2	-3.35	17.2	3438	54	3	106 - 115	R.TAFDEGPWPK.M
781	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	449	812.05	2433.13	812.06	2433.15	3	-6.52	24.9	9502	38	1	485 - 506	K.AGTVWVNCFDVFDAAIPFGGYK.M	Carbamidomethyl: 8
781	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	340	703.08	2106.22	703.09	2106.24	3	-8.58	20	6140	43	2	289 - 309	K.VILGLAANSNLKPVTLELGGK.S
781	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	213	526.27	1050.52	526.27	1050.52	2	-7.14	16	3171	55	2	447 - 455	K.FSDVDEVIK.R
781	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	8	402.20	802.38	402.20	802.39	2	-10.92	8.5	51746	44	4	472 - 478	K.NLDTANR.V
781	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	139	549.27	1096.53	549.28	1096.54	2	-9.16	13.7	11297	66	2	278 - 288	K.LAFTGSTDTGK.V
781	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	198	632.64	1894.89	632.64	1894.90	3	-5.95	15.5	5459	101	1	82 - 99	R.TGEVIAHVAEGDAEDINR.A
781	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	6	402.20	802.39	402.20	802.39	2	-9.45	8.5	65290	44	4	472 - 478	K.NLDTANR.V
781	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	297	749.38	1496.74	749.38	1496.75	2	-5.25	18.7	142013	69	4	230 - 243	K.TAEQTPLTAFYAGK.L
781	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	333	641.87	1281.74	641.88	1281.74	2	-7.38	19.8	92555	74	2	527 - 538	K.AVVTALNKPAWI.-
781	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	263	513.78	1025.55	513.78	1025.55	2	-7.45	17.6	3647	70	1	462 - 471	K.YGLAAGVFTK.N
781	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	354	713.39	1424.76	713.39	1424.77	2	-7.40	20.5	11618	80	1	515 - 526	K.GIYSLNNYLQIK.A
781	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	307	561.64	1681.89	561.64	1681.90	3	-7.47	19	24277	15	1	513 - 526	R.EKGIYSLNNYLQIK.A
781	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	178	514.75	1027.48	514.75	1027.49	2	-6.53	14.9	26166	52	1	351 - 358	K.VYDEFVEK.S
781	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	298	749.38	1496.74	749.38	1496.75	2	-5.10	18.7	73119	94	4	230 - 243	K.TAEQTPLTAFYAGK.L
781	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	260	706.90	1411.78	706.90	1411.79	2	-4.59	17.5	12591	49	2	216 - 229	K.VGPALACGNTIVLK.T	Carbamidomethyl: 7
781	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	136	549.27	1096.53	549.28	1096.54	2	-6.25	13.6	3524	74	2	278 - 288	K.LAFTGSTDTGK.V
781	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	229	473.75	945.49	473.75	945.49	2	-6.22	16.5	4714	21	1	74 - 81	K.TFPTLDPR.T
781	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	5	402.20	802.39	402.20	802.39	2	-7.56	8.4	106713	34	4	472 - 478	K.NLDTANR.V
781	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	373	748.36	1494.71	748.37	1494.72	2	-6.36	21.1	10147	35	1	310 - 322	K.SPFIVFEDADIDK.A
781	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	342	703.08	2106.23	703.09	2106.24	3	-5.93	20.1	15254	26	2	289 - 309	K.VILGLAANSNLKPVTLELGGK.S
781	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	121	459.26	916.50	459.26	916.51	2	-11.15	13.1	2288	21	1	367 - 374	R.VVGDPFRK.G
781	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	172	604.31	1206.61	604.32	1206.62	2	-8.92	14.7	10048	83	1	447 - 456	K.FSDVDEVIKR.A
781	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	258	706.90	1411.78	706.90	1411.79	2	-6.30	17.4	4894	82	2	216 - 229	K.VGPALACGNTIVLK.T	Carbamidomethyl: 7
781	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	296	749.38	1496.74	749.38	1496.75	2	-6.47	18.6	19648	39	4	230 - 243	K.TAEQTPLTAFYAGK.L
781	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	255	574.27	1146.53	574.27	1146.53	2	-6.12	17.3	2657	58	3	106 - 115	R.TAFDEGPWPK.M
781	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	173	403.21	1206.61	403.22	1206.62	3	-8.92	14.7	4925	59	1	447 - 456	K.FSDVDEVIKR.A
781	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	169	411.22	820.43	411.22	820.43	2	-6.67	14.6	4362	42	1	128 - 134	R.FADLVEK.H
781	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	299	749.38	1496.74	749.38	1496.75	2	-5.30	18.7	49769	90	4	230 - 243	K.TAEQTPLTAFYAGK.L
840	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	371	713.38	1424.75	713.39	1424.77	2	-14.69	20.4	6228	75	3	515 - 526	K.GIYSLNNYLQIK.A
840	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	169	632.63	1894.88	632.64	1894.90	3	-10.19	15.4	8258	107	3	82 - 99	R.TGEVIAHVAEGDAEDINR.A
840	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	139	514.74	1027.47	514.75	1027.49	2	-12.49	14.7	3730	37	3	351 - 358	K.VYDEFVEK.S
840	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	250	513.78	1025.54	513.78	1025.55	2	-15.70	17.3	6664	39	2	462 - 471	K.YGLAAGVFTK.N
840	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	370	713.38	1424.75	713.39	1424.77	2	-14.90	20.3	14049	85	3	515 - 526	K.GIYSLNNYLQIK.A
840	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	143	1028.48	1027.47	1028.49	1027.49	1	-12.24	14.7	52352	40	1	351 - 358	K.VYDEFVEK.S
840	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	243	706.89	1411.77	706.90	1411.79	2	-12.63	17.1	6962	86	3	216 - 229	K.VGPALACGNTIVLK.T	Carbamidomethyl: 7
840	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	89	549.27	1096.53	549.28	1096.54	2	-12.39	13.5	13531	73	5	278 - 288	K.LAFTGSTDTGK.V
840	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	297	749.37	1496.73	749.38	1496.75	2	-14.37	18.5	4884	56	3	230 - 243	K.TAEQTPLTAFYAGK.L
840	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	246	706.89	1411.77	706.90	1411.79	2	-12.40	17.2	6109	92	3	216 - 229	K.VGPALACGNTIVLK.T	Carbamidomethyl: 7
840	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	372	475.92	1424.75	475.93	1424.77	3	-14.66	20.4	38333	65	2	515 - 526	K.GIYSLNNYLQIK.A
840	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	209	473.75	945.48	473.75	945.49	2	-13.97	16.3	49036	23	3	74 - 81	K.TFPTLDPR.T
840	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	301	749.37	1496.73	749.38	1496.75	2	-13.77	18.6	49962	79	3	230 - 243	K.TAEQTPLTAFYAGK.L
840	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	236	574.27	1146.52	574.27	1146.53	2	-11.34	16.9	4024	43	3	106 - 115	R.TAFDEGPWPK.M
840	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	114	442.58	1324.72	442.59	1324.74	3	-13.72	14.1	3933	47	2	374 - 385	R.KGIEQGPQIDLK.Q
840	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	146	973.43	972.42	973.44	972.43	1	-11.97	14.8	24226	28	1	168 - 175	R.YYAGWADK.I
840	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	390	748.36	1494.71	748.37	1494.72	2	-12.19	20.9	5832	39	3	310 - 322	K.SPFIVFEDADIDK.A
840	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	298	749.37	1496.73	749.38	1496.75	2	-13.57	18.5	146520	80	3	230 - 243	K.TAEQTPLTAFYAGK.L
840	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	207	473.75	945.48	473.75	945.49	2	-13.95	16.2	12471	23	3	74 - 81	K.TFPTLDPR.T
840	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	144	514.74	1027.47	514.75	1027.49	2	-12.82	14.8	14793	33	3	351 - 358	K.VYDEFVEK.S
840	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	171	474.73	1894.88	474.73	1894.90	4	-10.17	15.4	9930	19	1	82 - 99	R.TGEVIAHVAEGDAEDINR.A
840	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	128	821.43	820.42	821.44	820.43	1	-10.91	14.4	4316	35	1	128 - 134	R.FADLVEK.H
840	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	176	599.32	1196.63	599.33	1196.64	2	-11.83	15.5	5958	65	3	375 - 385	K.GIEQGPQIDLK.Q
840	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	369	713.38	1424.74	713.39	1424.77	2	-15.95	20.3	21104	62	3	515 - 526	K.GIYSLNNYLQIK.A
840	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	248	471.60	1411.77	471.60	1411.79	3	-12.40	17.2	6450	59	2	216 - 229	K.VGPALACGNTIVLK.T	Carbamidomethyl: 7
840	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	392	748.36	1494.71	748.37	1494.72	2	-12.16	20.9	10476	68	3	310 - 322	K.SPFIVFEDADIDK.A
840	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	341	428.25	1281.72	428.26	1281.74	3	-15.96	19.6	122607	36	2	527 - 538	K.AVVTALNKPAWI.-
840	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	83	549.27	1096.52	549.28	1096.54	2	-16.19	13.3	7674	75	5	278 - 288	K.LAFTGSTDTGK.V
840	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	112	663.36	1324.72	663.37	1324.74	2	-15.06	14.1	26219	31	1	374 - 385	R.KGIEQGPQIDLK.Q
840	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	242	706.89	1411.76	706.90	1411.79	2	-17.14	17.1	7586	76	3	216 - 229	K.VGPALACGNTIVLK.T	Carbamidomethyl: 7
840	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	126	411.22	820.42	411.22	820.43	2	-10.90	14.4	9289	31	3	128 - 134	R.FADLVEK.H
840	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	352	703.08	2106.21	703.09	2106.24	3	-15.50	19.9	16574	47	3	289 - 309	K.VILGLAANSNLKPVTLELGGK.S
840	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	185	526.26	1050.51	526.27	1050.52	2	-13.16	15.7	5477	40	2	447 - 455	K.FSDVDEVIK.R
840	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	123	411.22	820.42	411.22	820.43	2	-12.67	14.3	6000	33	3	128 - 134	R.FADLVEK.H
840	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	129	411.22	820.42	411.22	820.43	2	-13.11	14.5	17892	38	3	128 - 134	R.FADLVEK.H
840	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	340	641.87	1281.72	641.88	1281.74	2	-15.98	19.6	19252	74	1	527 - 538	K.AVVTALNKPAWI.-
840	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	145	487.22	972.42	487.22	972.43	2	-11.95	14.8	10055	40	2	168 - 175	R.YYAGWADK.I
840	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	396	748.36	1494.71	748.37	1494.72	2	-12.44	21	10926	57	3	310 - 322	K.SPFIVFEDADIDK.A
840	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	237	574.27	1146.52	574.27	1146.53	2	-11.88	17	4560	57	3	106 - 115	R.TAFDEGPWPK.M
840	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	182	599.32	1196.63	599.33	1196.64	2	-12.41	15.7	4095	56	3	375 - 385	K.GIEQGPQIDLK.Q
840	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	132	403.21	1206.61	403.22	1206.62	3	-13.21	14.5	4524	63	2	447 - 456	K.FSDVDEVIKR.A
840	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	137	604.31	1206.61	604.32	1206.62	2	-12.38	14.6	13055	65	2	447 - 456	K.FSDVDEVIKR.A
840	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	245	471.60	1411.77	471.60	1411.79	3	-12.63	17.1	7306	67	2	216 - 229	K.VGPALACGNTIVLK.T	Carbamidomethyl: 7
840	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	108	632.63	1894.88	632.64	1894.90	3	-9.96	13.9	7144	43	3	82 - 99	R.TGEVIAHVAEGDAEDINR.A
840	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	64	459.26	916.50	459.26	916.51	2	-16.57	12.9	44783	26	3	367 - 374	R.VVGDPFRK.G
840	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	252	1026.55	1025.54	1026.56	1025.55	1	-13.08	17.3	4551	44	2	462 - 471	K.YGLAAGVFTK.N
840	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	179	599.32	1196.63	599.33	1196.64	2	-11.31	15.6	10389	68	3	375 - 385	K.GIEQGPQIDLK.Q
840	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	258	513.78	1025.54	513.78	1025.55	2	-13.09	17.4	4548	61	2	462 - 471	K.YGLAAGVFTK.N
840	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	350	703.08	2106.21	703.09	2106.24	3	-16.44	19.8	107621	52	3	289 - 309	K.VILGLAANSNLKPVTLELGGK.S
840	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	343	428.25	1281.73	428.26	1281.74	3	-14.44	19.7	19065	32	2	527 - 538	K.AVVTALNKPAWI.-
840	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	255	1026.55	1025.54	1026.56	1025.55	1	-13.66	17.4	7344	52	2	462 - 471	K.YGLAAGVFTK.N
840	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	88	549.27	1096.53	549.28	1096.54	2	-11.89	13.4	21532	74	5	278 - 288	K.LAFTGSTDTGK.V
840	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	312	561.63	1681.88	561.64	1681.90	3	-15.91	18.8	5985	53	2	513 - 526	R.EKGIYSLNNYLQIK.A
840	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	133	604.31	1206.61	604.32	1206.62	2	-13.23	14.5	5766	84	2	447 - 456	K.FSDVDEVIKR.A
840	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	183	526.26	1050.51	526.27	1050.52	2	-13.64	15.7	3753	37	2	447 - 455	K.FSDVDEVIK.R
840	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	85	1097.53	1096.53	1097.55	1096.54	1	-13.17	13.3	18697	22	1	278 - 288	K.LAFTGSTDTGK.V
840	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	360	750.39	1498.76	750.40	1498.78	2	-13.49	20	5286	52	1	415 - 427	K.GYFIQPTVFSNVK.D
840	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	135	403.21	1206.61	403.22	1206.62	3	-12.37	14.6	13283	69	2	447 - 456	K.FSDVDEVIKR.A
840	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	240	574.27	1146.52	574.27	1146.53	2	-13.45	17	5252	58	3	106 - 115	R.TAFDEGPWPK.M
840	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	141	514.74	1027.47	514.75	1027.49	2	-12.24	14.7	6367	38	3	351 - 358	K.VYDEFVEK.S
840	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	313	561.63	1681.88	561.64	1681.90	3	-14.52	18.9	5765	38	2	513 - 526	R.EKGIYSLNNYLQIK.A
840	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	168	948.45	1894.88	948.46	1894.90	2	-10.58	15.3	9347	31	1	82 - 99	R.TGEVIAHVAEGDAEDINR.A
840	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	355	703.08	2106.21	703.09	2106.24	3	-16.91	19.9	20432	38	3	289 - 309	K.VILGLAANSNLKPVTLELGGK.S
840	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	84	549.27	1096.53	549.28	1096.54	2	-13.17	13.3	7350	75	5	278 - 288	K.LAFTGSTDTGK.V
840	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	69	459.26	916.50	459.26	916.51	2	-14.81	13	65947	47	3	367 - 374	R.VVGDPFRK.G
840	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	142	487.22	972.42	487.22	972.43	2	-12.75	14.7	7125	45	2	168 - 175	R.YYAGWADK.I
840	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	86	549.27	1096.53	549.28	1096.54	2	-12.77	13.4	12970	84	5	278 - 288	K.LAFTGSTDTGK.V
840	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	204	473.75	945.48	473.75	945.49	2	-13.61	16.2	3730	22	3	74 - 81	K.TFPTLDPR.T
840	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	166	632.63	1894.88	632.64	1894.90	3	-10.58	15.3	3174	121	3	82 - 99	R.TGEVIAHVAEGDAEDINR.A
840	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	375	475.92	1424.75	475.93	1424.77	3	-12.77	20.4	82702	49	2	515 - 526	K.GIYSLNNYLQIK.A
840	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	111	442.58	1324.72	442.59	1324.74	3	-15.05	14	5234	43	2	374 - 385	R.KGIEQGPQIDLK.Q
840	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	66	459.26	916.50	459.26	916.51	2	-14.31	12.9	71797	44	3	367 - 374	R.VVGDPFRK.G
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	147	549.27	1096.53	549.28	1096.54	2	-6.74	13.1	114378	73	3	278 - 288	K.LAFTGSTDTGK.V
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	464	713.38	1424.75	713.39	1424.77	2	-8.86	20.3	13720	83	7	515 - 526	K.GIYSLNNYLQIK.A
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	239	948.45	1894.89	948.46	1894.90	2	-7.87	15.1	20374	104	2	82 - 99	R.TGEVIAHVAEGDAEDINR.A
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	153	1097.54	1096.53	1097.55	1096.54	1	-6.02	13.2	110296	57	3	278 - 288	K.LAFTGSTDTGK.V
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	208	514.75	1027.48	514.75	1027.49	2	-8.22	14.5	4503	39	4	351 - 358	K.VYDEFVEK.S
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	321	1147.53	1146.52	1147.54	1146.53	1	-9.94	17	26898	35	3	106 - 115	R.TAFDEGPWPK.M
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	435	703.08	2106.22	703.09	2106.24	3	-9.22	19.6	61207	70	3	289 - 309	K.VILGLAANSNLKPVTLELGGK.S
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	334	513.78	1025.54	513.78	1025.55	2	-12.61	17.3	7744	75	4	462 - 471	K.YGLAAGVFTK.N
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	179	442.58	1324.72	442.59	1324.74	3	-9.56	13.8	4894	51	3	374 - 385	R.KGIEQGPQIDLK.Q
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	458	713.38	1424.75	713.39	1424.77	2	-8.94	20.2	56032	78	7	515 - 526	K.GIYSLNNYLQIK.A
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	200	604.31	1206.61	604.32	1206.62	2	-9.09	14.3	7086	80	3	447 - 456	K.FSDVDEVIKR.A
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	562	812.05	2433.12	812.06	2433.15	3	-10.86	24.9	21460	54	3	485 - 506	K.AGTVWVNCFDVFDAAIPFGGYK.M	Carbamidomethyl: 8
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	185	442.58	1324.72	442.59	1324.74	3	-9.76	13.9	18319	44	3	374 - 385	R.KGIEQGPQIDLK.Q
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	393	561.64	1681.89	561.64	1681.90	3	-9.13	18.7	7500	41	2	513 - 526	R.EKGIYSLNNYLQIK.A
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	305	574.27	1146.52	574.27	1146.53	2	-8.90	16.6	21804	40	3	106 - 115	R.TAFDEGPWPK.M
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	327	1026.55	1025.54	1026.56	1025.55	1	-11.78	17.1	480802	62	3	462 - 471	K.YGLAAGVFTK.N
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	482	748.36	1494.71	748.37	1494.72	2	-9.09	20.8	8549	90	3	310 - 322	K.SPFIVFEDADIDK.A
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	480	748.36	1494.71	748.37	1494.72	2	-8.94	20.7	48535	72	3	310 - 322	K.SPFIVFEDADIDK.A
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	251	1197.64	1196.63	1197.65	1196.64	1	-8.11	15.4	6259	31	2	375 - 385	K.GIEQGPQIDLK.Q
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	314	706.89	1411.77	706.90	1411.79	2	-9.70	16.8	12340	79	3	216 - 229	K.VGPALACGNTIVLK.T	Carbamidomethyl: 7
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	160	473.26	944.51	473.27	944.52	2	-13.43	13.3	207846	16	2	366 - 373	K.RVVGDPFR.K
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	127	459.26	916.50	459.26	916.51	2	-8.91	12.6	8549	44	3	367 - 374	R.VVGDPFRK.G
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	244	632.64	1894.89	632.64	1894.90	3	-8.19	15.3	92610	108	7	82 - 99	R.TGEVIAHVAEGDAEDINR.A
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	463	866.91	3463.61	866.92	3463.64	4	-8.38	20.2	8037	17	1	135 - 164	K.HSEELASLETWDNGKPYQQSLTAEIPMFAR.L	Oxidation: 27
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	152	549.27	1096.53	549.28	1096.54	2	-6.01	13.2	335017	69	3	278 - 288	K.LAFTGSTDTGK.V
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	128	459.26	916.51	459.26	916.51	2	-8.15	12.7	13754	42	3	367 - 374	R.VVGDPFRK.G
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	428	428.25	1281.73	428.26	1281.74	3	-9.75	19.5	518174	37	3	527 - 538	K.AVVTALNKPAWI.-
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	394	841.95	1681.89	841.96	1681.90	2	-9.13	18.7	10893	65	2	513 - 526	R.EKGIYSLNNYLQIK.A
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	155	1097.54	1096.53	1097.55	1096.54	1	-7.90	13.3	7024	47	3	278 - 288	K.LAFTGSTDTGK.V
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	311	574.27	1146.52	574.27	1146.53	2	-9.55	16.8	31580	56	3	106 - 115	R.TAFDEGPWPK.M
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	560	1217.57	2433.12	1217.58	2433.15	2	-10.58	24.8	19838	82	3	485 - 506	K.AGTVWVNCFDVFDAAIPFGGYK.M	Carbamidomethyl: 8
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	459	475.93	1424.75	475.93	1424.77	3	-8.95	20.2	15831	67	2	515 - 526	K.GIYSLNNYLQIK.A
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	242	948.45	1894.89	948.46	1894.90	2	-7.36	15.2	15779	74	2	82 - 99	R.TGEVIAHVAEGDAEDINR.A
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	481	713.88	1425.75	713.39	1424.77	2	688.78	20.7	13907	42	7	515 - 526	K.GIYSLNNYLQIK.A
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	207	973.43	972.43	973.44	972.43	1	-7.96	14.4	21460	47	2	168 - 175	R.YYAGWADK.I
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	206	487.22	972.43	487.22	972.43	2	-7.95	14.4	3705	40	3	168 - 175	R.YYAGWADK.I
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	444	750.39	1498.77	750.40	1498.78	2	-8.75	19.8	70402	60	2	415 - 427	K.GYFIQPTVFSNVK.D
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	559	812.05	2433.12	812.06	2433.15	3	-10.35	24.8	8781	72	3	485 - 506	K.AGTVWVNCFDVFDAAIPFGGYK.M	Carbamidomethyl: 8
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	274	473.75	945.48	473.75	945.49	2	-10.80	15.9	9464	36	3	74 - 81	K.TFPTLDPR.T
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	330	1026.55	1025.54	1026.56	1025.55	1	-12.08	17.2	633734	60	3	462 - 471	K.YGLAAGVFTK.N
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	397	841.95	1681.89	841.96	1681.90	2	-8.71	18.8	40320	18	2	513 - 526	R.EKGIYSLNNYLQIK.A
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	501	863.16	3448.59	862.92	3447.64	4	275.88	21.3	151320	34	2	135 - 164	K.HSEELASLETWDNGKPYQQSLTAEIPMFAR.L
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	196	403.21	1206.61	403.22	1206.62	3	-9.86	14.2	15785	60	4	447 - 456	K.FSDVDEVIKR.A
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	174	411.22	820.43	411.22	820.43	2	-6.84	13.7	20767	33	5	128 - 134	R.FADLVEK.H
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	205	514.75	1027.48	514.75	1027.49	2	-7.40	14.4	19838	36	4	351 - 358	K.VYDEFVEK.S
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	325	1026.55	1025.54	1026.56	1025.55	1	-12.02	17.1	26946	74	3	462 - 471	K.YGLAAGVFTK.N
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	249	1197.64	1196.63	1197.65	1196.64	1	-9.89	15.3	4537	23	2	375 - 385	K.GIEQGPQIDLK.Q
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	436	1054.12	2106.22	1054.13	2106.24	2	-9.22	19.6	53174	54	2	289 - 309	K.VILGLAANSNLKPVTLELGGK.S
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	424	1282.74	1281.73	1282.75	1281.74	1	-10.10	19.4	12167	52	2	527 - 538	K.AVVTALNKPAWI.-
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	439	1054.12	2106.22	1054.13	2106.24	2	-9.23	19.7	17059	24	2	289 - 309	K.VILGLAANSNLKPVTLELGGK.S
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	202	514.75	1027.48	514.75	1027.49	2	-8.70	14.3	3822	39	4	351 - 358	K.VYDEFVEK.S
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	329	513.78	1025.54	513.78	1025.55	2	-12.06	17.2	15945	61	4	462 - 471	K.YGLAAGVFTK.N
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	317	706.89	1411.77	706.90	1411.79	2	-9.03	16.9	5417	94	3	216 - 229	K.VGPALACGNTIVLK.T	Carbamidomethyl: 7
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	461	713.38	1424.75	713.39	1424.77	2	-8.07	20.2	39329	82	7	515 - 526	K.GIYSLNNYLQIK.A
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	252	526.26	1050.51	526.27	1050.52	2	-10.60	15.4	4255	42	3	447 - 455	K.FSDVDEVIK.R
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	210	973.43	972.43	973.44	972.43	1	-8.49	14.5	7246	34	2	168 - 175	R.YYAGWADK.I
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	478	748.36	1494.71	748.37	1494.72	2	-7.00	20.6	35551	53	3	310 - 322	K.SPFIVFEDADIDK.A
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	240	474.73	1894.89	474.73	1894.90	4	-7.87	15.1	12755	58	1	82 - 99	R.TGEVIAHVAEGDAEDINR.A
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	447	750.39	1498.77	750.40	1498.78	2	-9.15	19.9	34946	56	2	415 - 427	K.GYFIQPTVFSNVK.D
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	277	473.75	945.48	473.75	945.49	2	-9.70	16	3492	36	3	74 - 81	K.TFPTLDPR.T
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	209	487.22	972.43	487.22	972.43	2	-8.48	14.5	5369	45	3	168 - 175	R.YYAGWADK.I
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	373	749.38	1496.74	749.38	1496.75	2	-9.69	18.2	49766	78	3	230 - 243	K.TAEQTPLTAFYAGK.L
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	140	403.21	1206.61	403.22	1206.62	3	-9.39	12.9	264917	44	4	447 - 456	K.FSDVDEVIKR.A
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	204	487.22	972.43	487.22	972.43	2	-9.08	14.3	8781	42	3	168 - 175	R.YYAGWADK.I
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	385	499.92	1496.74	499.92	1496.75	3	-8.15	18.5	91749	74	3	230 - 243	K.TAEQTPLTAFYAGK.L
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	483	713.89	1425.76	713.39	1424.77	2	697.12	20.8	13754	24	7	515 - 526	K.GIYSLNNYLQIK.A
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	197	411.22	820.42	411.22	820.43	2	-10.02	14.2	13617	38	5	128 - 134	R.FADLVEK.H
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	212	632.64	1894.89	632.64	1894.90	3	-7.12	14.5	13185	66	7	82 - 99	R.TGEVIAHVAEGDAEDINR.A
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	308	574.27	1146.52	574.27	1146.53	2	-9.64	16.7	20239	53	3	106 - 115	R.TAFDEGPWPK.M
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	423	641.87	1281.73	641.88	1281.74	2	-10.10	19.4	16121	74	3	527 - 538	K.AVVTALNKPAWI.-
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	557	1217.57	2433.12	1217.58	2433.15	2	-11.79	24.7	3822	86	3	485 - 506	K.AGTVWVNCFDVFDAAIPFGGYK.M	Carbamidomethyl: 8
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	425	428.25	1281.73	428.26	1281.74	3	-10.08	19.4	177159	38	3	527 - 538	K.AVVTALNKPAWI.-
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	183	663.37	1324.72	663.37	1324.74	2	-8.26	13.9	7418	81	1	374 - 385	R.KGIEQGPQIDLK.Q
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	137	403.21	1206.62	403.22	1206.62	3	-5.20	12.9	189373	62	4	447 - 456	K.FSDVDEVIKR.A
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	216	632.64	1894.89	632.64	1894.90	3	-6.99	14.6	6277	97	7	82 - 99	R.TGEVIAHVAEGDAEDINR.A
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	326	513.78	1025.54	513.78	1025.55	2	-11.77	17.1	11269	68	4	462 - 471	K.YGLAAGVFTK.N
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	379	499.92	1496.74	499.92	1496.75	3	-8.85	18.4	92217	73	3	230 - 243	K.TAEQTPLTAFYAGK.L
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	176	411.22	820.43	411.22	820.43	2	-6.37	13.7	7476	25	5	128 - 134	R.FADLVEK.H
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	241	632.64	1894.89	632.64	1894.90	3	-7.36	15.2	66907	112	7	82 - 99	R.TGEVIAHVAEGDAEDINR.A
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	434	703.08	2106.22	703.09	2106.24	3	-8.48	19.6	277729	56	3	289 - 309	K.VILGLAANSNLKPVTLELGGK.S
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	273	473.75	945.48	473.75	945.49	2	-14.45	15.9	4175	29	3	74 - 81	K.TFPTLDPR.T
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	191	821.43	820.43	821.44	820.43	1	-6.74	14.1	7099	39	2	128 - 134	R.FADLVEK.H
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	238	632.64	1894.89	632.64	1894.90	3	-7.86	15.1	18533	116	7	82 - 99	R.TGEVIAHVAEGDAEDINR.A
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	558	1217.57	2433.12	1217.58	2433.15	2	-10.35	24.8	4852	60	3	485 - 506	K.AGTVWVNCFDVFDAAIPFGGYK.M	Carbamidomethyl: 8
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	247	599.32	1196.63	599.33	1196.64	2	-9.89	15.3	3956	68	3	375 - 385	K.GIEQGPQIDLK.Q
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	199	403.21	1206.61	403.22	1206.62	3	-9.09	14.3	9925	60	4	447 - 456	K.FSDVDEVIKR.A
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	96	408.25	814.48	408.25	814.49	2	-14.46	11.9	12489	42	1	527 - 534	K.AVVTALNK.P
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	479	713.38	1424.74	713.39	1424.77	2	-16.12	20.7	14968	47	7	515 - 526	K.GIYSLNNYLQIK.A
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	322	471.60	1411.77	471.60	1411.79	3	-9.96	17	10617	48	3	216 - 229	K.VGPALACGNTIVLK.T	Carbamidomethyl: 7
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	150	1097.54	1096.53	1097.55	1096.54	1	-6.70	13.1	128913	75	3	278 - 288	K.LAFTGSTDTGK.V
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	258	1051.52	1050.51	1051.53	1050.52	1	-9.56	15.6	5036	37	1	447 - 455	K.FSDVDEVIK.R
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	323	513.78	1025.54	513.78	1025.55	2	-12.00	17	8846	65	4	462 - 471	K.YGLAAGVFTK.N
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	312	706.89	1411.77	706.90	1411.79	2	-11.26	16.8	13208	69	3	216 - 229	K.VGPALACGNTIVLK.T	Carbamidomethyl: 7
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	457	713.38	1424.75	713.39	1424.77	2	-14.06	20.1	49130	63	7	515 - 526	K.GIYSLNNYLQIK.A
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	253	526.26	1050.51	526.27	1050.52	2	-10.03	15.5	13801	41	3	447 - 455	K.FSDVDEVIK.R
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	438	703.08	2106.22	703.09	2106.24	3	-9.22	19.7	20532	67	3	289 - 309	K.VILGLAANSNLKPVTLELGGK.S
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	316	471.60	1411.77	471.60	1411.79	3	-9.70	16.9	8479	59	3	216 - 229	K.VGPALACGNTIVLK.T	Carbamidomethyl: 7
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	139	604.32	1206.62	604.32	1206.62	2	-5.20	12.9	16371	26	3	447 - 456	K.FSDVDEVIKR.A
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	181	442.58	1324.72	442.59	1324.74	3	-8.25	13.9	6529	52	3	374 - 385	R.KGIEQGPQIDLK.Q
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	256	526.26	1050.51	526.27	1050.52	2	-9.55	15.5	67820	42	3	447 - 455	K.FSDVDEVIK.R
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	148	415.21	1242.60	415.21	1242.61	3	-8.39	13.1	45014	48	1	351 - 360	K.VYDEFVEKSK.A
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	431	428.25	1281.73	428.26	1281.74	3	-8.82	19.5	201625	47	3	527 - 538	K.AVVTALNKPAWI.-
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	378	749.38	1496.74	749.38	1496.75	2	-8.86	18.4	156565	96	3	230 - 243	K.TAEQTPLTAFYAGK.L
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	344	577.30	1728.89	577.31	1728.90	3	-11.20	17.6	11215	26	1	375 - 389	K.GIEQGPQIDLKQFEK.V
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	375	749.38	1496.74	749.38	1496.75	2	-8.66	18.3	453420	62	3	230 - 243	K.TAEQTPLTAFYAGK.L
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	194	821.43	820.43	821.44	820.43	1	-8.85	14.1	5320	30	2	128 - 134	R.FADLVEK.H
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	250	599.32	1196.63	599.33	1196.64	2	-8.10	15.4	19973	68	3	375 - 385	K.GIEQGPQIDLK.Q
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	278	946.49	945.48	946.50	945.49	1	-9.71	16	3825	16	1	74 - 81	K.TFPTLDPR.T
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	190	411.22	820.43	411.22	820.43	2	-6.74	14.1	5211	33	5	128 - 134	R.FADLVEK.H
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	381	499.92	1496.74	499.92	1496.75	3	-8.47	18.4	192262	67	3	230 - 243	K.TAEQTPLTAFYAGK.L
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	462	475.93	1424.75	475.93	1424.77	3	-8.06	20.2	14629	67	2	515 - 526	K.GIYSLNNYLQIK.A
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	315	1147.53	1146.52	1147.54	1146.53	1	-9.94	16.9	24954	35	3	106 - 115	R.TAFDEGPWPK.M
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	427	1282.74	1281.73	1282.75	1281.74	1	-9.77	19.4	21563	25	2	527 - 538	K.AVVTALNKPAWI.-
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	561	812.05	2433.12	812.06	2433.15	3	-10.58	24.8	3705	76	3	485 - 506	K.AGTVWVNCFDVFDAAIPFGGYK.M	Carbamidomethyl: 8
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	396	561.64	1681.89	561.64	1681.90	3	-8.72	18.8	14942	31	2	513 - 526	R.EKGIYSLNNYLQIK.A
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	162	473.26	944.51	473.27	944.52	2	-10.79	13.4	337431	24	2	366 - 373	K.RVVGDPFR.K
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	318	471.60	1411.77	471.60	1411.79	3	-9.03	16.9	14635	63	3	216 - 229	K.VGPALACGNTIVLK.T	Carbamidomethyl: 7
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	180	632.64	1894.89	632.64	1894.90	3	-5.35	13.8	12719	32	7	82 - 99	R.TGEVIAHVAEGDAEDINR.A
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	319	1147.53	1146.52	1147.54	1146.53	1	-9.53	16.9	9441	36	3	106 - 115	R.TAFDEGPWPK.M
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	172	514.75	1027.48	514.75	1027.49	2	-6.57	13.6	9809	29	4	351 - 358	K.VYDEFVEK.S
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	198	604.31	1206.61	604.32	1206.62	2	-9.87	14.2	7545	75	3	447 - 456	K.FSDVDEVIKR.A
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	254	599.32	1196.63	599.33	1196.64	2	-9.12	15.5	14342	57	3	375 - 385	K.GIEQGPQIDLK.Q
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	175	632.64	1894.89	632.64	1894.90	3	-6.33	13.7	15353	120	7	82 - 99	R.TGEVIAHVAEGDAEDINR.A
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	213	650.96	1949.85	650.96	1949.86	3	-6.49	14.5	4602	54	1	396 - 414	K.SGIESNATLECGGDQIGDK.G	Carbamidomethyl: 11
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	149	549.27	1096.53	549.28	1096.54	2	-6.69	13.1	366789	68	3	278 - 288	K.LAFTGSTDTGK.V
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	131	459.26	916.51	459.26	916.51	2	-8.26	12.7	48402	48	3	367 - 374	R.VVGDPFRK.G
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	505	863.16	3448.59	862.92	3447.64	4	276.28	21.4	128913	34	2	135 - 164	K.HSEELASLETWDNGKPYQQSLTAEIPMFAR.L
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	193	411.22	820.43	411.22	820.43	2	-8.83	14.1	6486	38	5	128 - 134	R.FADLVEK.H
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	421	641.87	1281.73	641.88	1281.74	2	-11.44	19.3	27140	73	3	527 - 538	K.AVVTALNKPAWI.-
878	AT3G48000.1	ALDH2 (aldehyde dehydrogenase 2)	other processes	g) other metabolic pathways	mitochondria	426	641.87	1281.73	641.88	1281.74	2	-9.77	19.4	59908	70	3	527 - 538	K.AVVTALNKPAWI.-
840	AT1G23800.1	ALDH2B7 (aldehyde dehydrogenase 2B7)	other processes	g) other metabolic pathways	mitochondrion	144	514.74	1027.47	514.75	1027.49	2	-12.82	14.8	14793	33	3	347 - 354	R.VYDEFVEK.A
840	AT1G23800.1	ALDH2B7 (aldehyde dehydrogenase 2B7)	other processes	g) other metabolic pathways	mitochondrion	204	473.75	945.48	473.75	945.49	2	-13.61	16.2	3730	22	3	70 - 77	K.TFPTLDPR.N
840	AT1G23800.1	ALDH2B7 (aldehyde dehydrogenase 2B7)	other processes	g) other metabolic pathways	mitochondrion	207	473.75	945.48	473.75	945.49	2	-13.95	16.2	12471	23	3	70 - 77	K.TFPTLDPR.N
840	AT1G23800.1	ALDH2B7 (aldehyde dehydrogenase 2B7)	other processes	g) other metabolic pathways	mitochondrion	146	973.43	972.42	973.44	972.43	1	-11.97	14.8	24226	28	1	164 - 171	R.YYAGWADK.I
840	AT1G23800.1	ALDH2B7 (aldehyde dehydrogenase 2B7)	other processes	g) other metabolic pathways	mitochondrion	142	487.22	972.42	487.22	972.43	2	-12.75	14.7	7125	45	2	164 - 171	R.YYAGWADK.I
840	AT1G23800.1	ALDH2B7 (aldehyde dehydrogenase 2B7)	other processes	g) other metabolic pathways	mitochondrion	143	1028.48	1027.47	1028.49	1027.49	1	-12.24	14.7	52352	40	1	347 - 354	R.VYDEFVEK.A
840	AT1G23800.1	ALDH2B7 (aldehyde dehydrogenase 2B7)	other processes	g) other metabolic pathways	mitochondrion	209	473.75	945.48	473.75	945.49	2	-13.97	16.3	49036	23	3	70 - 77	K.TFPTLDPR.N
840	AT1G23800.1	ALDH2B7 (aldehyde dehydrogenase 2B7)	other processes	g) other metabolic pathways	mitochondrion	187	418.22	834.44	418.23	834.45	2	-15.89	15.7	5342	25	1	124 - 130	R.FADLIEK.H
840	AT1G23800.1	ALDH2B7 (aldehyde dehydrogenase 2B7)	other processes	g) other metabolic pathways	mitochondrion	141	514.74	1027.47	514.75	1027.49	2	-12.24	14.7	6367	38	3	347 - 354	R.VYDEFVEK.A
840	AT1G23800.1	ALDH2B7 (aldehyde dehydrogenase 2B7)	other processes	g) other metabolic pathways	mitochondrion	145	487.22	972.42	487.22	972.43	2	-11.95	14.8	10055	40	2	164 - 171	R.YYAGWADK.I
840	AT1G23800.1	ALDH2B7 (aldehyde dehydrogenase 2B7)	other processes	g) other metabolic pathways	mitochondrion	139	514.74	1027.47	514.75	1027.49	2	-12.49	14.7	3730	37	3	347 - 354	R.VYDEFVEK.A
878	AT1G23800.1	ALDH2B7 (aldehyde dehydrogenase 2B7)	other processes	g) other metabolic pathways	mitochondrion	276	402.55	1204.63	402.56	1204.65	3	-12.13	16	8868	18	2	443 - 452	K.FKDLDEVIAR.A
878	AT1G23800.1	ALDH2B7 (aldehyde dehydrogenase 2B7)	other processes	g) other metabolic pathways	mitochondrion	143	541.28	1080.54	541.28	1080.55	2	-6.37	13	45024	60	2	274 - 284	K.VAFTGSTDVGK.I
878	AT1G23800.1	ALDH2B7 (aldehyde dehydrogenase 2B7)	other processes	g) other metabolic pathways	mitochondrion	84	411.72	821.42	411.72	821.43	2	-10.68	11.6	17059	56	3	62 - 69	R.FVDAVSGK.T
878	AT1G23800.1	ALDH2B7 (aldehyde dehydrogenase 2B7)	other processes	g) other metabolic pathways	mitochondrion	307	443.78	885.54	443.78	885.55	2	-13.96	16.7	91872	40	3	285 - 292	K.IILELASK.S
878	AT1G23800.1	ALDH2B7 (aldehyde dehydrogenase 2B7)	other processes	g) other metabolic pathways	mitochondrion	313	443.78	885.54	443.78	885.55	2	-13.71	16.8	7006	36	3	285 - 292	K.IILELASK.S
878	AT1G23800.1	ALDH2B7 (aldehyde dehydrogenase 2B7)	other processes	g) other metabolic pathways	mitochondrion	172	514.75	1027.48	514.75	1027.49	2	-6.57	13.6	9809	29	4	347 - 354	R.VYDEFVEK.A
878	AT1G23800.1	ALDH2B7 (aldehyde dehydrogenase 2B7)	other processes	g) other metabolic pathways	mitochondrion	206	487.22	972.43	487.22	972.43	2	-7.95	14.4	3705	40	3	164 - 171	R.YYAGWADK.I
878	AT1G23800.1	ALDH2B7 (aldehyde dehydrogenase 2B7)	other processes	g) other metabolic pathways	mitochondrion	309	443.78	885.54	443.78	885.55	2	-13.56	16.7	130095	38	3	285 - 292	K.IILELASK.S
878	AT1G23800.1	ALDH2B7 (aldehyde dehydrogenase 2B7)	other processes	g) other metabolic pathways	mitochondrion	146	541.28	1080.54	541.28	1080.55	2	-6.51	13.1	151320	67	2	274 - 284	K.VAFTGSTDVGK.I
878	AT1G23800.1	ALDH2B7 (aldehyde dehydrogenase 2B7)	other processes	g) other metabolic pathways	mitochondrion	312	706.89	1411.77	706.90	1411.79	2	-11.26	16.8	13208	40	2	212 - 225	K.LGPALACGNTVVLK.T	Carbamidomethyl: 7
878	AT1G23800.1	ALDH2B7 (aldehyde dehydrogenase 2B7)	other processes	g) other metabolic pathways	mitochondrion	230	444.26	886.50	444.26	886.51	2	-14.36	14.9	5298	36	3	297 - 305	K.AVTLELGGK.S
878	AT1G23800.1	ALDH2B7 (aldehyde dehydrogenase 2B7)	other processes	g) other metabolic pathways	mitochondrion	204	487.22	972.43	487.22	972.43	2	-9.08	14.3	8781	42	3	164 - 171	R.YYAGWADK.I
878	AT1G23800.1	ALDH2B7 (aldehyde dehydrogenase 2B7)	other processes	g) other metabolic pathways	mitochondrion	209	487.22	972.43	487.22	972.43	2	-8.48	14.5	5369	45	3	164 - 171	R.YYAGWADK.I
878	AT1G23800.1	ALDH2B7 (aldehyde dehydrogenase 2B7)	other processes	g) other metabolic pathways	mitochondrion	210	973.43	972.43	973.44	972.43	1	-8.49	14.5	7246	34	2	164 - 171	R.YYAGWADK.I
878	AT1G23800.1	ALDH2B7 (aldehyde dehydrogenase 2B7)	other processes	g) other metabolic pathways	mitochondrion	370	611.97	1832.90	611.98	1832.92	3	-9.68	18.2	37794	52	2	458 - 474	R.YGLAAGVFTQNLDTAHR.L
878	AT1G23800.1	ALDH2B7 (aldehyde dehydrogenase 2B7)	other processes	g) other metabolic pathways	mitochondrion	365	556.96	1667.87	556.97	1667.89	3	-10.33	18	52305	38	1	509 - 522	R.EKGIYSLNNYLQVK.A
878	AT1G23800.1	ALDH2B7 (aldehyde dehydrogenase 2B7)	other processes	g) other metabolic pathways	mitochondrion	278	946.49	945.48	946.50	945.49	1	-9.71	16	3825	16	1	70 - 77	K.TFPTLDPR.N
878	AT1G23800.1	ALDH2B7 (aldehyde dehydrogenase 2B7)	other processes	g) other metabolic pathways	mitochondrion	207	973.43	972.43	973.44	972.43	1	-7.96	14.4	21460	47	2	164 - 171	R.YYAGWADK.I
878	AT1G23800.1	ALDH2B7 (aldehyde dehydrogenase 2B7)	other processes	g) other metabolic pathways	mitochondrion	202	514.75	1027.48	514.75	1027.49	2	-8.70	14.3	3822	39	4	347 - 354	R.VYDEFVEK.A
878	AT1G23800.1	ALDH2B7 (aldehyde dehydrogenase 2B7)	other processes	g) other metabolic pathways	mitochondrion	420	649.87	1297.73	649.88	1297.74	2	-9.92	19.3	157042	56	2	523 - 534	K.AVVTSLKNPAWL.-
878	AT1G23800.1	ALDH2B7 (aldehyde dehydrogenase 2B7)	other processes	g) other metabolic pathways	mitochondrion	417	649.87	1297.72	649.88	1297.74	2	-11.23	19.2	117392	54	2	523 - 534	K.AVVTSLKNPAWL.-
878	AT1G23800.1	ALDH2B7 (aldehyde dehydrogenase 2B7)	other processes	g) other metabolic pathways	mitochondrion	208	514.75	1027.48	514.75	1027.49	2	-8.22	14.5	4503	39	4	347 - 354	R.VYDEFVEK.A
878	AT1G23800.1	ALDH2B7 (aldehyde dehydrogenase 2B7)	other processes	g) other metabolic pathways	mitochondrion	272	402.55	1204.63	402.56	1204.65	3	-11.88	15.9	3932	38	2	443 - 452	K.FKDLDEVIAR.A
878	AT1G23800.1	ALDH2B7 (aldehyde dehydrogenase 2B7)	other processes	g) other metabolic pathways	mitochondrion	314	706.89	1411.77	706.90	1411.79	2	-9.70	16.8	12340	18	2	212 - 225	K.LGPALACGNTVVLK.T	Carbamidomethyl: 7
878	AT1G23800.1	ALDH2B7 (aldehyde dehydrogenase 2B7)	other processes	g) other metabolic pathways	mitochondrion	541	837.91	3347.62	837.93	3347.68	4	-17.55	23	33483	28	1	240 - 273	K.LLHEAGLPDGVVNIVSGFGATAGAAIASHMDVDK.V	Oxidation: 30
878	AT1G23800.1	ALDH2B7 (aldehyde dehydrogenase 2B7)	other processes	g) other metabolic pathways	mitochondrion	310	886.55	885.54	886.56	885.55	1	-13.58	16.7	89480	41	1	285 - 292	K.IILELASK.S
878	AT1G23800.1	ALDH2B7 (aldehyde dehydrogenase 2B7)	other processes	g) other metabolic pathways	mitochondrion	232	444.26	886.50	444.26	886.51	2	-12.73	15	4656	48	3	297 - 305	K.AVTLELGGK.S
878	AT1G23800.1	ALDH2B7 (aldehyde dehydrogenase 2B7)	other processes	g) other metabolic pathways	mitochondrion	88	411.72	821.42	411.72	821.43	2	-10.80	11.7	22883	57	3	62 - 69	R.FVDAVSGK.T
878	AT1G23800.1	ALDH2B7 (aldehyde dehydrogenase 2B7)	other processes	g) other metabolic pathways	mitochondrion	205	514.75	1027.48	514.75	1027.49	2	-7.40	14.4	19838	36	4	347 - 354	R.VYDEFVEK.A
878	AT1G23800.1	ALDH2B7 (aldehyde dehydrogenase 2B7)	other processes	g) other metabolic pathways	mitochondrion	366	611.97	1832.90	611.98	1832.92	3	-9.09	18.1	42397	87	2	458 - 474	R.YGLAAGVFTQNLDTAHR.L
878	AT1G23800.1	ALDH2B7 (aldehyde dehydrogenase 2B7)	other processes	g) other metabolic pathways	mitochondrion	60	480.24	1437.68	480.24	1437.70	3	-8.71	11	16471	59	1	392 - 406	K.HGVEAGATLQAGGDR.L
878	AT1G23800.1	ALDH2B7 (aldehyde dehydrogenase 2B7)	other processes	g) other metabolic pathways	mitochondrion	86	411.72	821.42	411.72	821.43	2	-10.02	11.6	22547	50	3	62 - 69	R.FVDAVSGK.T
878	AT1G23800.1	ALDH2B7 (aldehyde dehydrogenase 2B7)	other processes	g) other metabolic pathways	mitochondrion	255	418.23	834.44	418.23	834.45	2	-13.07	15.5	11568	33	2	124 - 130	R.FADLIEK.H
878	AT1G23800.1	ALDH2B7 (aldehyde dehydrogenase 2B7)	other processes	g) other metabolic pathways	mitochondrion	235	444.26	886.50	444.26	886.51	2	-12.53	15.1	13507	54	3	297 - 305	K.AVTLELGGK.S
878	AT1G23800.1	ALDH2B7 (aldehyde dehydrogenase 2B7)	other processes	g) other metabolic pathways	mitochondrion	277	473.75	945.48	473.75	945.49	2	-9.70	16	3492	36	3	70 - 77	K.TFPTLDPR.N
878	AT1G23800.1	ALDH2B7 (aldehyde dehydrogenase 2B7)	other processes	g) other metabolic pathways	mitochondrion	87	822.43	821.42	822.44	821.43	1	-10.04	11.7	17527	29	1	62 - 69	R.FVDAVSGK.T
878	AT1G23800.1	ALDH2B7 (aldehyde dehydrogenase 2B7)	other processes	g) other metabolic pathways	mitochondrion	257	418.23	834.44	418.23	834.45	2	-12.07	15.5	6667	42	2	124 - 130	R.FADLIEK.H
878	AT1G23800.1	ALDH2B7 (aldehyde dehydrogenase 2B7)	other processes	g) other metabolic pathways	mitochondrion	273	473.75	945.48	473.75	945.49	2	-14.45	15.9	4175	29	3	70 - 77	K.TFPTLDPR.N
878	AT1G23800.1	ALDH2B7 (aldehyde dehydrogenase 2B7)	other processes	g) other metabolic pathways	mitochondrion	274	473.75	945.48	473.75	945.49	2	-10.80	15.9	9464	36	3	70 - 77	K.TFPTLDPR.N
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	121	605.34	1208.67	605.35	1208.68	2	-4.99	12.7	6253	41	2	271 - 282	K.ITFTGSTAVGKK.L
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	24	586.25	1170.49	586.25	1170.49	2	3.20	9.9	34493	22	5	417 - 426	R.DVSDNMIMSK.E	Oxidation: 6
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	428	654.32	1959.95	654.32	1959.94	3	5.58	20.3	139403	62	3	72 - 90	K.VNNPATGEIIADVACMGTK.E	Carbamidomethyl: 15
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	505	761.75	2282.24	761.75	2282.22	3	4.84	24.1	13938	48	3	187 - 207	K.QPVGVVGAITPWNFPLAMITR.K	Oxidation: 18
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	291	538.96	1613.86	538.96	1613.85	3	2.69	16.7	23494	33	2	168 - 181	R.VYGDIIPPNLSDRR.L
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	251	613.81	1225.60	613.81	1225.60	2	4.30	15.8	16326	54	3	347 - 357	K.FAEAFSEAVQK.L
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	499	786.41	2356.21	786.41	2356.20	3	5.46	23.3	35062	49	2	337 - 357	R.VLVQDGIYDKFAEAFSEAVQK.L
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	1	633.77	1265.53	633.77	1265.52	2	5.76	8.7	5313	70	2	326 - 336	R.NSGQTCVCANR.V	Carbamidomethyl: 6
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	93	550.83	1099.64	550.83	1099.64	2	-0.09	11.9	9915	55	3	282 - 292	K.KLMAAAAPTVK.K
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	449	670.89	1339.76	670.88	1339.75	2	6.05	20.8	8194	62	3	427 - 438	K.EEIFGPVAPLIR.F
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	344	825.92	1649.83	825.92	1649.82	2	4.64	18.1	4559	64	2	403 - 416	R.HSLGMTFYEPTVIR.D
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	343	729.89	1457.76	729.88	1457.75	2	5.70	18.1	6366	50	3	168 - 180	R.VYGDIIPPNLSDR.R
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	375	630.80	1259.58	630.79	1259.57	2	3.37	18.9	78262	76	3	509 - 518	K.YGMDEYLEIK.Y
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	132	403.90	1208.68	403.90	1208.68	3	2.18	12.9	5090	49	3	270 - 281	R.KITFTGSTAVGK.K
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	429	980.98	1959.95	980.98	1959.94	2	5.87	20.4	5050	104	3	72 - 90	K.VNNPATGEIIADVACMGTK.E	Carbamidomethyl: 15
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	77	427.52	1279.55	427.52	1279.54	3	2.60	11.5	8099	36	3	519 - 528	K.YVCLGDMNRH.-	Oxidation: 7
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	224	559.93	1676.77	559.93	1676.76	3	2.80	15.2	10605	25	1	505 - 518	R.EGSKYGMDEYLEIK.Y	Oxidation: 7
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	438	831.76	2492.24	831.75	2492.23	3	6.24	20.6	6051	51	3	417 - 438	R.DVSDNMIMSKEEIFGPVAPLIR.F	Oxidation: 6
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	491	822.74	2465.19	822.73	2465.18	3	5.20	22.7	12936	79	2	146 - 167	K.EAIGEVAYGASFIEYYAEEAKR.V
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	285	556.28	1665.82	556.28	1665.82	3	3.73	16.6	12630	53	2	403 - 416	R.HSLGMTFYEPTVIR.D	Oxidation: 5
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	289	807.94	1613.86	807.93	1613.85	2	2.76	16.7	16249	17	1	168 - 181	R.VYGDIIPPNLSDRR.L
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	242	1222.64	1221.63	1222.63	1221.62	1	4.49	15.6	68423	23	1	382 - 392	K.VETFVQDAVSK.G
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	308	834.43	2500.27	834.43	2500.26	3	3.86	17.1	18295	48	3	358 - 381	K.LEVGDGFRDGTTQGPLINDAAVQK.V
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	205	585.44	584.43	585.43	584.43	1	4.01	14.8	5785	31	2	182 - 186	R.LLVLK.Q
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	74	640.78	1279.55	640.78	1279.54	2	2.21	11.4	5050	46	1	519 - 528	K.YVCLGDMNRH.-	Oxidation: 7
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	112	578.26	1154.50	578.25	1154.49	2	4.16	12.5	5267	60	4	417 - 426	R.DVSDNMIMSK.E	Oxidation: 6
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	507	761.75	2282.23	761.75	2282.22	3	3.06	24.1	3718	63	3	187 - 207	K.QPVGVVGAITPWNFPLAMITR.K	Oxidation: 18
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	452	670.89	1339.76	670.88	1339.75	2	6.01	20.9	3464	65	3	427 - 438	K.EEIFGPVAPLIR.F
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	182	541.30	1080.58	541.30	1080.58	2	2.68	14.3	7825	61	3	271 - 281	K.ITFTGSTAVGK.K
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	476	678.98	2033.91	678.97	2033.90	3	4.74	21.7	6253	75	2	91 - 108	K.ETNDAIASSYEAFTSWSR.L
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	200	1149.62	1148.61	1149.62	1148.61	1	4.12	14.7	3756	26	1	337 - 346	R.VLVQDGIYDK.F
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	31	586.25	1170.49	586.25	1170.49	2	4.21	10.1	4506	41	5	417 - 426	R.DVSDNMIMSK.E	Oxidation: 6
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	70	494.78	987.54	494.78	987.54	2	1.86	11.3	23604	57	3	283 - 292	K.LMAAAAPTVK.K	Oxidation: 2
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	214	446.73	891.45	446.73	891.45	2	1.97	15	4394	57	3	358 - 365	K.LEVGDGFR.D
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	113	578.26	1154.50	578.25	1154.49	2	3.10	12.5	7525	22	3	417 - 426	R.DVSDNMIMSK.E	Oxidation: 8
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	213	1040.47	1039.46	1040.47	1039.46	1	3.47	14.9	15877	30	1	61 - 68	K.WLDSYDNK.T
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	204	814.42	1626.83	814.42	1626.82	2	5.20	14.7	5546	98	4	366 - 381	R.DGTTQGPLINDAAVQK.V
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	76	554.79	1107.56	554.79	1107.56	2	2.30	11.5	4462	52	3	439 - 447	R.FKTEEDAIR.I
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	339	729.89	1457.76	729.88	1457.75	2	5.84	18	7103	32	3	168 - 180	R.VYGDIIPPNLSDR.R
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	161	422.19	1263.55	422.19	1263.55	3	2.18	13.8	10002	32	3	519 - 528	K.YVCLGDMNRH.-	Carbamidomethyl: 3
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	311	834.43	2500.27	834.43	2500.26	3	5.29	17.2	6150	65	3	358 - 381	K.LEVGDGFRDGTTQGPLINDAAVQK.V
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	426	980.98	1959.95	980.98	1959.94	2	5.58	20.3	10371	76	3	72 - 90	K.VNNPATGEIIADVACMGTK.E	Carbamidomethyl: 15
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	125	486.78	971.55	486.78	971.55	2	0.92	12.8	7880	49	3	283 - 292	K.LMAAAAPTVK.K
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	222	446.73	891.45	446.73	891.45	2	0.69	15.1	11211	43	3	358 - 365	K.LEVGDGFR.D
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	478	678.98	2033.91	678.97	2033.90	3	4.14	21.7	6234	75	2	91 - 108	K.ETNDAIASSYEAFTSWSR.L
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	243	611.82	1221.63	611.82	1221.62	2	3.83	15.7	62715	70	3	382 - 392	K.VETFVQDAVSK.G
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	90	550.83	1099.64	550.83	1099.64	2	1.25	11.9	10475	54	3	282 - 292	K.KLMAAAAPTVK.K
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	208	520.74	1039.47	520.74	1039.46	2	4.72	14.9	11776	41	2	61 - 68	K.WLDSYDNK.T
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	89	550.83	1099.64	550.83	1099.64	2	1.14	11.8	9569	41	3	282 - 292	K.KLMAAAAPTVK.K
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	312	554.60	1660.77	554.60	1660.77	3	5.00	17.2	3705	34	2	505 - 518	R.EGSKYGMDEYLEIK.Y
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	309	554.60	1660.77	554.60	1660.77	3	5.72	17.1	8153	29	2	505 - 518	R.EGSKYGMDEYLEIK.Y
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	38	558.83	1115.64	558.83	1115.64	2	2.45	10.4	42100	51	3	282 - 292	K.KLMAAAAPTVK.K	Oxidation: 3
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	75	988.55	987.54	988.55	987.54	1	2.30	11.4	210329	22	1	283 - 292	K.LMAAAAPTVK.K	Oxidation: 2
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	35	558.83	1115.64	558.83	1115.64	2	2.81	10.4	69651	61	3	282 - 292	K.KLMAAAAPTVK.K	Oxidation: 3
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	441	831.75	2492.24	831.75	2492.23	3	5.10	20.7	6847	50	3	417 - 438	R.DVSDNMIMSKEEIFGPVAPLIR.F	Oxidation: 6
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	346	825.92	1649.83	825.92	1649.82	2	4.41	18.2	6736	56	2	403 - 416	R.HSLGMTFYEPTVIR.D
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	369	630.80	1259.58	630.79	1259.57	2	3.80	18.7	23787	61	3	509 - 518	K.YGMDEYLEIK.Y
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	134	403.90	1208.68	403.90	1208.68	3	2.53	13	6189	51	3	270 - 281	R.KITFTGSTAVGK.K
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	288	538.96	1613.86	538.96	1613.85	3	2.75	16.7	13748	37	2	168 - 181	R.VYGDIIPPNLSDRR.L
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	510	761.75	2282.23	761.75	2282.22	3	3.66	24.2	3607	46	3	187 - 207	K.QPVGVVGAITPWNFPLAMITR.K	Oxidation: 18
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	372	630.80	1259.58	630.79	1259.57	2	3.64	18.8	21595	55	3	509 - 518	K.YGMDEYLEIK.Y
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	240	611.82	1221.63	611.82	1221.62	2	4.49	15.6	55915	77	3	382 - 392	K.VETFVQDAVSK.G
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	345	550.95	1649.83	550.95	1649.82	3	4.64	18.1	17764	56	2	403 - 416	R.HSLGMTFYEPTVIR.D
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	475	1017.96	2033.91	1017.96	2033.90	2	4.74	21.7	13699	116	4	91 - 108	K.ETNDAIASSYEAFTSWSR.L
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	26	586.25	1170.49	586.25	1170.49	2	3.71	9.9	76068	44	5	417 - 426	R.DVSDNMIMSK.E	Oxidation: 6
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	473	1017.96	2033.91	1017.96	2033.90	2	5.35	21.6	4938	86	4	91 - 108	K.ETNDAIASSYEAFTSWSR.L
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	506	1142.12	2282.23	1142.12	2282.22	2	3.07	24.1	7535	36	3	187 - 207	K.QPVGVVGAITPWNFPLAMITR.K	Oxidation: 18
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	255	613.81	1225.60	613.81	1225.60	2	3.62	15.9	4252	76	3	347 - 357	K.FAEAFSEAVQK.L
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	434	654.32	1959.95	654.32	1959.94	3	5.89	20.5	118039	55	3	72 - 90	K.VNNPATGEIIADVACMGTK.E	Carbamidomethyl: 15
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	340	729.89	1457.76	729.88	1457.75	2	5.57	18	18276	63	3	168 - 180	R.VYGDIIPPNLSDR.R
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	374	579.82	1157.63	579.82	1157.62	2	2.72	18.8	7659	22	2	121 - 129	R.WYDLLIAHK.E
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	207	814.42	1626.83	814.42	1626.82	2	7.39	14.8	12995	92	4	366 - 381	R.DGTTQGPLINDAAVQK.V
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	377	599.35	1795.02	599.34	1795.01	3	4.57	18.9	4391	22	2	130 - 145	K.EELGQLITLEQGKPLK.E
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	2	633.77	1265.53	633.77	1265.52	2	3.32	8.7	38295	71	2	326 - 336	R.NSGQTCVCANR.V	Carbamidomethyl: 6
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	430	654.32	1959.95	654.32	1959.94	3	5.87	20.4	210329	65	3	72 - 90	K.VNNPATGEIIADVACMGTK.E	Carbamidomethyl: 15
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	111	578.26	1154.50	578.25	1154.49	2	4.10	12.5	16801	52	4	417 - 426	R.DVSDNMIMSK.E	Oxidation: 6
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	348	988.98	1975.94	988.97	1975.93	2	4.62	18.2	17478	100	1	72 - 90	K.VNNPATGEIIADVACMGTK.E	Oxidation: 16
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	159	422.19	1263.56	422.19	1263.55	3	7.27	13.7	4572	29	3	519 - 528	K.YVCLGDMNRH.-	Carbamidomethyl: 3
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	179	541.30	1080.59	541.30	1080.58	2	3.51	14.2	7014	56	3	271 - 281	K.ITFTGSTAVGK.K
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	252	613.81	1225.60	613.81	1225.60	2	3.49	15.9	8036	58	3	347 - 357	K.FAEAFSEAVQK.L
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	85	600.41	599.40	600.41	599.40	1	1.83	11.7	9093	21	2	396 - 401	K.IIIGGK.R
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	54	773.45	772.45	773.45	772.44	1	2.15	10.9	5009	19	1	53 - 60	R.TQGLIGGK.W
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	82	600.41	599.40	600.41	599.40	1	3.09	11.6	3741	21	2	396 - 401	K.IIIGGK.R
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	162	632.78	1263.55	632.78	1263.55	2	2.19	13.8	6504	32	2	519 - 528	K.YVCLGDMNRH.-	Carbamidomethyl: 3
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	195	575.32	1148.62	575.31	1148.61	2	14.42	14.5	29353	23	3	337 - 346	R.VLVQDGIYDK.F
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	69	494.78	987.54	494.78	987.54	2	1.38	11.3	7466	58	3	283 - 292	K.LMAAAAPTVK.K	Oxidation: 2
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	283	833.92	1665.82	833.92	1665.82	2	3.38	16.5	6410	50	2	403 - 416	R.HSLGMTFYEPTVIR.D	Oxidation: 5
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	84	554.79	1107.56	554.79	1107.56	2	1.29	11.6	13627	41	3	439 - 447	R.FKTEEDAIR.I
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	113	578.26	1154.50	578.25	1154.49	2	3.10	12.5	7525	46	4	417 - 426	R.DVSDNMIMSK.E	Oxidation: 6
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	128	486.78	971.55	486.78	971.55	2	2.07	12.9	20599	57	3	283 - 292	K.LMAAAAPTVK.K
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	164	422.19	1263.56	422.19	1263.55	3	5.99	13.9	17470	28	3	519 - 528	K.YVCLGDMNRH.-	Carbamidomethyl: 3
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	284	638.79	1275.57	638.79	1275.57	2	3.27	16.5	16661	53	3	509 - 518	K.YGMDEYLEIK.Y	Oxidation: 3
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	509	1142.12	2282.23	1142.12	2282.22	2	3.66	24.2	17752	29	3	187 - 207	K.QPVGVVGAITPWNFPLAMITR.K	Oxidation: 18
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	210	814.42	1626.83	814.42	1626.82	2	7.13	14.9	6790	81	4	366 - 381	R.DGTTQGPLINDAAVQK.V
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	130	403.90	1208.68	403.90	1208.68	3	2.92	12.9	3666	40	3	270 - 281	R.KITFTGSTAVGK.K
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	79	554.79	1107.56	554.79	1107.56	2	3.20	11.5	118039	55	3	439 - 447	R.FKTEEDAIR.I
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	131	605.35	1208.68	605.35	1208.68	2	2.16	12.9	4032	66	3	270 - 281	R.KITFTGSTAVGK.K
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	123	403.90	1208.67	403.90	1208.68	3	-4.43	12.7	6234	55	2	271 - 282	K.ITFTGSTAVGKK.L
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	371	579.82	1157.62	579.82	1157.62	2	-0.09	18.7	4135	45	2	121 - 129	R.WYDLLIAHK.E
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	135	605.35	1208.68	605.35	1208.68	2	2.53	13	4408	59	3	270 - 281	R.KITFTGSTAVGK.K
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	124	605.34	1208.67	605.35	1208.68	2	-4.43	12.8	5002	19	2	271 - 282	K.ITFTGSTAVGKK.L
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	238	611.82	1221.63	611.82	1221.62	2	4.09	15.5	4560	72	3	382 - 392	K.VETFVQDAVSK.G
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	472	1017.96	2033.91	1017.96	2033.90	2	7.38	21.6	15702	83	4	91 - 108	K.ETNDAIASSYEAFTSWSR.L
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	187	541.30	1080.58	541.30	1080.58	2	3.18	14.4	62383	63	3	271 - 281	K.ITFTGSTAVGK.K
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	490	822.74	2465.19	822.73	2465.18	3	5.32	22.7	4408	78	2	146 - 167	K.EAIGEVAYGASFIEYYAEEAKR.V
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	228	814.91	1627.81	814.42	1626.82	2	607.62	15.3	5503	24	4	366 - 381	R.DGTTQGPLINDAAVQK.V
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	129	605.35	1208.68	605.35	1208.68	2	2.92	12.9	4476	90	3	270 - 281	R.KITFTGSTAVGK.K
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	197	575.31	1148.61	575.31	1148.61	2	6.26	14.6	13167	57	3	337 - 346	R.VLVQDGIYDK.F
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	202	585.44	584.43	585.43	584.43	1	2.97	14.7	6689	27	2	182 - 186	R.LLVLK.Q
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	279	638.79	1275.57	638.79	1275.57	2	4.01	16.5	14769	63	3	509 - 518	K.YGMDEYLEIK.Y	Oxidation: 3
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	73	427.52	1279.55	427.52	1279.54	3	2.20	11.4	139403	44	3	519 - 528	K.YVCLGDMNRH.-	Oxidation: 7
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	199	575.31	1148.61	575.31	1148.61	2	4.11	14.7	4014	59	3	337 - 346	R.VLVQDGIYDK.F
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	119	403.90	1208.67	403.90	1208.68	3	-5.00	12.7	4316	48	2	271 - 282	K.ITFTGSTAVGKK.L
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	498	786.41	2356.20	786.41	2356.20	3	3.04	23.3	19027	51	2	337 - 357	R.VLVQDGIYDKFAEAFSEAVQK.L
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	112	578.26	1154.50	578.25	1154.49	2	4.16	12.5	5267	28	3	417 - 426	R.DVSDNMIMSK.E	Oxidation: 8
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	276	638.80	1275.58	638.79	1275.57	2	5.65	16.4	17962	62	3	509 - 518	K.YGMDEYLEIK.Y	Oxidation: 3
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	109	578.26	1154.50	578.25	1154.49	2	5.19	12.4	22137	35	4	417 - 426	R.DVSDNMIMSK.E	Oxidation: 6
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	282	556.28	1665.82	556.28	1665.82	3	3.38	16.5	6523	50	2	403 - 416	R.HSLGMTFYEPTVIR.D	Oxidation: 5
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	212	520.74	1039.46	520.74	1039.46	2	3.47	14.9	23052	36	2	61 - 68	K.WLDSYDNK.T
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	71	427.52	1279.55	427.52	1279.54	3	3.82	11.4	10371	43	3	519 - 528	K.YVCLGDMNRH.-	Oxidation: 7
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	286	833.92	1665.82	833.92	1665.82	2	3.74	16.6	5239	35	2	403 - 416	R.HSLGMTFYEPTVIR.D	Oxidation: 5
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	165	632.79	1263.56	632.78	1263.55	2	5.99	13.9	13861	32	2	519 - 528	K.YVCLGDMNRH.-	Carbamidomethyl: 3
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	217	446.73	891.45	446.73	891.45	2	1.61	15.1	8560	55	3	358 - 365	K.LEVGDGFR.D
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	111	578.26	1154.50	578.25	1154.49	2	4.10	12.5	16801	30	3	417 - 426	R.DVSDNMIMSK.E	Oxidation: 8
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	504	1142.13	2282.24	1142.12	2282.22	2	4.84	24	23422	32	3	187 - 207	K.QPVGVVGAITPWNFPLAMITR.K	Oxidation: 18
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	427	980.98	1959.95	980.98	1959.94	2	5.58	20.3	6774	109	3	72 - 90	K.VNNPATGEIIADVACMGTK.E	Carbamidomethyl: 15
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	67	494.78	987.54	494.78	987.54	2	0.23	11.3	31273	41	3	283 - 292	K.LMAAAAPTVK.K	Oxidation: 2
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	33	586.26	1170.50	586.25	1170.49	2	5.61	10.1	10059	52	5	417 - 426	R.DVSDNMIMSK.E	Oxidation: 6
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	444	831.76	2492.25	831.75	2492.23	3	7.49	20.7	9569	51	3	417 - 438	R.DVSDNMIMSKEEIFGPVAPLIR.F	Oxidation: 6
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	373	599.35	1795.02	599.34	1795.01	3	4.29	18.8	13253	34	2	130 - 145	K.EELGQLITLEQGKPLK.E
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	347	550.95	1649.83	550.95	1649.82	3	4.40	18.2	4804	56	2	403 - 416	R.HSLGMTFYEPTVIR.D
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	34	558.83	1115.64	558.83	1115.64	2	2.11	10.3	5062	42	3	282 - 292	K.KLMAAAAPTVK.K	Oxidation: 3
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	133	486.78	971.55	486.78	971.55	2	2.55	13	6440	61	3	283 - 292	K.LMAAAAPTVK.K
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	342	486.93	1457.76	486.92	1457.75	3	5.56	18.1	29611	32	1	168 - 180	R.VYGDIIPPNLSDR.R
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	314	834.43	2500.27	834.43	2500.26	3	5.57	17.2	24188	59	3	358 - 381	K.LEVGDGFRDGTTQGPLINDAAVQK.V
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	480	1017.96	2033.90	1017.96	2033.90	2	3.81	21.8	7880	110	4	91 - 108	K.ETNDAIASSYEAFTSWSR.L
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	455	670.89	1339.76	670.88	1339.75	2	5.92	21	20783	58	3	427 - 438	K.EEIFGPVAPLIR.F
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	25	586.25	1170.49	586.25	1170.49	2	3.71	9.9	26846	49	5	417 - 426	R.DVSDNMIMSK.E	Oxidation: 6
934	AT1G79440.1	ALDH5F1 (aldehyde dehydrogenase 5F1)	other processes	g) other metabolic pathways	mitochondria	454	1340.77	1339.76	1340.76	1339.75	1	6.01	20.9	87008	22	1	427 - 438	K.EEIFGPVAPLIR.F
878	AT2G14170.1	ALDH6B2 (3-chloroallyl aldehyde dehydrogenase)	other processes	g) other metabolic pathways	mitochondria	93	575.94	1724.79	575.94	1724.81	3	-7.15	11.8	18663	43	2	189 - 203	K.NMDKLAMNITTEQGK.T	Oxidation: 2
878	AT2G14170.1	ALDH6B2 (3-chloroallyl aldehyde dehydrogenase)	other processes	g) other metabolic pathways	mitochondria	82	890.46	889.46	890.47	889.47	1	-9.20	11.5	54701	32	2	585 - 591	K.TVTQQWK.D
878	AT2G14170.1	ALDH6B2 (3-chloroallyl aldehyde dehydrogenase)	other processes	g) other metabolic pathways	mitochondria	429	563.29	1124.57	563.30	1124.59	2	-10.85	19.5	75289	49	3	575 - 584	K.AGVDFFTQIK.T
878	AT2G14170.1	ALDH6B2 (3-chloroallyl aldehyde dehydrogenase)	other processes	g) other metabolic pathways	mitochondria	201	589.30	1176.59	589.31	1176.60	2	-8.68	14.3	3772	78	1	145 - 154	K.VPLTTNEEFK.A
878	AT2G14170.1	ALDH6B2 (3-chloroallyl aldehyde dehydrogenase)	other processes	g) other metabolic pathways	mitochondria	263	859.93	1717.84	859.94	1717.86	2	-8.05	15.7	16364	82	1	592 - 607	K.DIPTSVSLAMPTSQKQ.-	Oxidation: 10
878	AT2G14170.1	ALDH6B2 (3-chloroallyl aldehyde dehydrogenase)	other processes	g) other metabolic pathways	mitochondria	260	872.92	1743.82	872.92	1743.83	2	-9.01	15.6	14681	68	1	419 - 435	K.VTCGSEPDADLGPVISK.Q	Carbamidomethyl: 3
878	AT2G14170.1	ALDH6B2 (3-chloroallyl aldehyde dehydrogenase)	other processes	g) other metabolic pathways	mitochondria	114	430.22	1287.65	430.23	1287.66	3	-8.89	12.3	7137	51	2	204 - 214	K.TLKDSHGDIFR.G
878	AT2G14170.1	ALDH6B2 (3-chloroallyl aldehyde dehydrogenase)	other processes	g) other metabolic pathways	mitochondria	77	445.74	889.46	445.74	889.47	2	-10.01	11.4	283586	43	3	585 - 591	K.TVTQQWK.D
878	AT2G14170.1	ALDH6B2 (3-chloroallyl aldehyde dehydrogenase)	other processes	g) other metabolic pathways	mitochondria	265	795.90	1589.78	795.91	1589.80	2	-8.54	15.7	4676	66	1	592 - 606	K.DIPTSVSLAMPTSQK.Q	Oxidation: 10
878	AT2G14170.1	ALDH6B2 (3-chloroallyl aldehyde dehydrogenase)	other processes	g) other metabolic pathways	mitochondria	220	403.23	804.44	403.23	804.45	2	-12.18	14.7	12170	29	3	182 - 187	K.FQELIR.K
878	AT2G14170.1	ALDH6B2 (3-chloroallyl aldehyde dehydrogenase)	other processes	g) other metabolic pathways	mitochondria	383	645.31	1288.60	645.31	1288.61	2	-7.99	18.4	492163	64	3	563 - 574	K.ASFAGDLNFYGK.A
878	AT2G14170.1	ALDH6B2 (3-chloroallyl aldehyde dehydrogenase)	other processes	g) other metabolic pathways	mitochondria	51	551.79	1101.56	551.79	1101.57	2	-8.01	10.7	17814	65	3	444 - 454	R.LIQSGVDDGAK.L
878	AT2G14170.1	ALDH6B2 (3-chloroallyl aldehyde dehydrogenase)	other processes	g) other metabolic pathways	mitochondria	221	599.62	1795.85	599.63	1795.87	3	-8.90	14.7	6647	59	2	330 - 346	R.AVSFVGSNTAGMHIYAR.A	Oxidation: 12
878	AT2G14170.1	ALDH6B2 (3-chloroallyl aldehyde dehydrogenase)	other processes	g) other metabolic pathways	mitochondria	7	401.72	801.43	401.72	801.43	2	-11.55	9.3	50964	24	4	169 - 175	R.NTPITTR.Q
878	AT2G14170.1	ALDH6B2 (3-chloroallyl aldehyde dehydrogenase)	other processes	g) other metabolic pathways	mitochondria	136	473.72	945.42	473.72	945.43	2	-6.79	12.8	24351	26	2	207 - 214	K.DSHGDIFR.G
878	AT2G14170.1	ALDH6B2 (3-chloroallyl aldehyde dehydrogenase)	other processes	g) other metabolic pathways	mitochondria	296	594.29	1779.85	594.30	1779.87	3	-10.44	16.4	9446	58	1	330 - 346	R.AVSFVGSNTAGMHIYAR.A
878	AT2G14170.1	ALDH6B2 (3-chloroallyl aldehyde dehydrogenase)	other processes	g) other metabolic pathways	mitochondria	79	890.47	889.46	890.47	889.47	1	-7.44	11.5	277729	36	2	585 - 591	K.TVTQQWK.D
878	AT2G14170.1	ALDH6B2 (3-chloroallyl aldehyde dehydrogenase)	other processes	g) other metabolic pathways	mitochondria	432	563.30	1124.58	563.30	1124.59	2	-9.22	19.6	283586	61	3	575 - 584	K.AGVDFFTQIK.T
878	AT2G14170.1	ALDH6B2 (3-chloroallyl aldehyde dehydrogenase)	other processes	g) other metabolic pathways	mitochondria	66	611.31	1220.60	611.31	1220.61	2	-7.77	11.1	27140	67	2	193 - 203	K.LAMNITTEQGK.T	Oxidation: 3
878	AT2G14170.1	ALDH6B2 (3-chloroallyl aldehyde dehydrogenase)	other processes	g) other metabolic pathways	mitochondria	97	575.94	1724.79	575.94	1724.81	3	-9.27	11.9	107163	34	2	189 - 203	K.NMDKLAMNITTEQGK.T	Oxidation: 2
878	AT2G14170.1	ALDH6B2 (3-chloroallyl aldehyde dehydrogenase)	other processes	g) other metabolic pathways	mitochondria	261	1019.53	1018.52	1019.54	1018.53	1	-10.30	15.6	8930	20	1	461 - 469	R.DIVVPGYEK.G
878	AT2G14170.1	ALDH6B2 (3-chloroallyl aldehyde dehydrogenase)	other processes	g) other metabolic pathways	mitochondria	364	757.37	1512.72	757.37	1512.73	2	-8.36	18	24510	61	2	391 - 404	R.CMALSTVVFVGDAK.S	Oxidation: 2
878	AT2G14170.1	ALDH6B2 (3-chloroallyl aldehyde dehydrogenase)	other processes	g) other metabolic pathways	mitochondria	81	445.74	889.46	445.74	889.47	2	-9.20	11.5	53174	42	3	585 - 591	K.TVTQQWK.D
878	AT2G14170.1	ALDH6B2 (3-chloroallyl aldehyde dehydrogenase)	other processes	g) other metabolic pathways	mitochondria	408	459.25	916.48	459.25	916.49	2	-12.99	19	21241	44	3	162 - 168	K.QAFPLWR.N
878	AT2G14170.1	ALDH6B2 (3-chloroallyl aldehyde dehydrogenase)	other processes	g) other metabolic pathways	mitochondria	47	551.78	1101.55	551.79	1101.57	2	-11.18	10.6	59753	60	3	444 - 454	R.LIQSGVDDGAK.L
878	AT2G14170.1	ALDH6B2 (3-chloroallyl aldehyde dehydrogenase)	other processes	g) other metabolic pathways	mitochondria	48	551.79	1101.56	551.79	1101.57	2	-9.93	10.6	24546	60	3	444 - 454	R.LIQSGVDDGAK.L
878	AT2G14170.1	ALDH6B2 (3-chloroallyl aldehyde dehydrogenase)	other processes	g) other metabolic pathways	mitochondria	248	581.29	1160.57	581.30	1160.58	2	-11.87	15.3	15447	45	2	405 - 413	K.SWEDKLVER.A
878	AT2G14170.1	ALDH6B2 (3-chloroallyl aldehyde dehydrogenase)	other processes	g) other metabolic pathways	mitochondria	78	445.74	889.46	445.74	889.47	2	-7.43	11.4	70677	38	3	585 - 591	K.TVTQQWK.D
878	AT2G14170.1	ALDH6B2 (3-chloroallyl aldehyde dehydrogenase)	other processes	g) other metabolic pathways	mitochondria	115	467.28	932.54	467.28	932.54	2	-8.91	12.3	4457	50	2	182 - 188	K.FQELIRK.N
878	AT2G14170.1	ALDH6B2 (3-chloroallyl aldehyde dehydrogenase)	other processes	g) other metabolic pathways	mitochondria	237	586.29	1755.84	585.96	1754.87	3	552.40	15.1	4492	40	1	515 - 532	K.NKYGNGAAIFTSSGAAAR.K
878	AT2G14170.1	ALDH6B2 (3-chloroallyl aldehyde dehydrogenase)	other processes	g) other metabolic pathways	mitochondria	287	757.86	1513.71	757.37	1512.73	2	647.57	16.2	62737	27	2	517 - 532	K.YGNGAAIFTSSGAAAR.K
878	AT2G14170.1	ALDH6B2 (3-chloroallyl aldehyde dehydrogenase)	other processes	g) other metabolic pathways	mitochondria	405	459.25	916.48	459.25	916.49	2	-12.54	19	15369	39	3	162 - 168	K.QAFPLWR.N
878	AT2G14170.1	ALDH6B2 (3-chloroallyl aldehyde dehydrogenase)	other processes	g) other metabolic pathways	mitochondria	437	563.29	1124.57	563.30	1124.59	2	-10.39	19.7	54701	64	3	575 - 584	K.AGVDFFTQIK.T
878	AT2G14170.1	ALDH6B2 (3-chloroallyl aldehyde dehydrogenase)	other processes	g) other metabolic pathways	mitochondria	399	562.98	1685.92	562.99	1685.94	3	-10.58	18.8	53331	30	1	455 - 469	K.LLLDGRDIVVPGYEK.G
878	AT2G14170.1	ALDH6B2 (3-chloroallyl aldehyde dehydrogenase)	other processes	g) other metabolic pathways	mitochondria	223	403.23	804.44	403.23	804.45	2	-12.92	14.8	3144	28	3	182 - 187	K.FQELIR.K
878	AT2G14170.1	ALDH6B2 (3-chloroallyl aldehyde dehydrogenase)	other processes	g) other metabolic pathways	mitochondria	111	430.22	1287.65	430.23	1287.66	3	-9.27	12.3	13378	51	2	204 - 214	K.TLKDSHGDIFR.G
878	AT2G14170.1	ALDH6B2 (3-chloroallyl aldehyde dehydrogenase)	other processes	g) other metabolic pathways	mitochondria	543	1083.55	3247.63	1083.56	3247.66	3	-8.38	23.2	4690	59	2	114 - 144	R.VPNLIGGSFVESQSSSFIDVINPATQEVVSK.V
878	AT2G14170.1	ALDH6B2 (3-chloroallyl aldehyde dehydrogenase)	other processes	g) other metabolic pathways	mitochondria	8	401.72	801.43	401.72	801.43	2	-10.60	9.3	71418	23	4	169 - 175	R.NTPITTR.Q
878	AT2G14170.1	ALDH6B2 (3-chloroallyl aldehyde dehydrogenase)	other processes	g) other metabolic pathways	mitochondria	289	757.87	1513.72	757.37	1512.73	2	649.27	16.3	49662	22	2	517 - 532	K.YGNGAAIFTSSGAAAR.K
878	AT2G14170.1	ALDH6B2 (3-chloroallyl aldehyde dehydrogenase)	other processes	g) other metabolic pathways	mitochondria	117	467.27	932.54	467.28	932.54	2	-9.93	12.4	20345	47	2	182 - 188	K.FQELIRK.N
878	AT2G14170.1	ALDH6B2 (3-chloroallyl aldehyde dehydrogenase)	other processes	g) other metabolic pathways	mitochondria	224	599.62	1795.85	599.63	1795.87	3	-8.46	14.8	8038	60	2	330 - 346	R.AVSFVGSNTAGMHIYAR.A	Oxidation: 12
878	AT2G14170.1	ALDH6B2 (3-chloroallyl aldehyde dehydrogenase)	other processes	g) other metabolic pathways	mitochondria	133	473.72	945.42	473.72	945.43	2	-7.66	12.7	21521	37	2	207 - 214	K.DSHGDIFR.G
878	AT2G14170.1	ALDH6B2 (3-chloroallyl aldehyde dehydrogenase)	other processes	g) other metabolic pathways	mitochondria	542	1083.55	3247.63	1083.56	3247.66	3	-9.18	23.1	3632	78	2	114 - 144	R.VPNLIGGSFVESQSSSFIDVINPATQEVVSK.V
878	AT2G14170.1	ALDH6B2 (3-chloroallyl aldehyde dehydrogenase)	other processes	g) other metabolic pathways	mitochondria	11	401.72	801.43	401.72	801.43	2	-10.55	9.4	42397	38	4	169 - 175	R.NTPITTR.Q
878	AT2G14170.1	ALDH6B2 (3-chloroallyl aldehyde dehydrogenase)	other processes	g) other metabolic pathways	mitochondria	259	510.27	1018.52	510.27	1018.53	2	-10.29	15.6	115250	38	2	461 - 469	R.DIVVPGYEK.G
878	AT2G14170.1	ALDH6B2 (3-chloroallyl aldehyde dehydrogenase)	other processes	g) other metabolic pathways	mitochondria	219	403.22	804.43	403.23	804.45	2	-19.74	14.7	4670	27	3	182 - 187	K.FQELIR.K
878	AT2G14170.1	ALDH6B2 (3-chloroallyl aldehyde dehydrogenase)	other processes	g) other metabolic pathways	mitochondria	433	1125.58	1124.58	1125.59	1124.59	1	-9.22	19.6	70677	27	1	575 - 584	K.AGVDFFTQIK.T
878	AT2G14170.1	ALDH6B2 (3-chloroallyl aldehyde dehydrogenase)	other processes	g) other metabolic pathways	mitochondria	6	401.72	801.43	401.72	801.43	2	-8.89	9.2	110577	31	4	169 - 175	R.NTPITTR.Q
878	AT2G14170.1	ALDH6B2 (3-chloroallyl aldehyde dehydrogenase)	other processes	g) other metabolic pathways	mitochondria	411	459.25	916.48	459.25	916.49	2	-14.06	19.1	26450	46	3	162 - 168	K.QAFPLWR.N
878	AT2G14170.1	ALDH6B2 (3-chloroallyl aldehyde dehydrogenase)	other processes	g) other metabolic pathways	mitochondria	262	510.27	1018.52	510.27	1018.53	2	-10.25	15.7	44383	33	2	461 - 469	R.DIVVPGYEK.G
878	AT2G14170.1	ALDH6B2 (3-chloroallyl aldehyde dehydrogenase)	other processes	g) other metabolic pathways	mitochondria	387	645.31	1288.60	645.31	1288.61	2	-9.63	18.6	172653	87	3	563 - 574	K.ASFAGDLNFYGK.A
878	AT2G14170.1	ALDH6B2 (3-chloroallyl aldehyde dehydrogenase)	other processes	g) other metabolic pathways	mitochondria	245	581.29	1160.57	581.30	1160.58	2	-11.51	15.3	7409	54	2	405 - 413	K.SWEDKLVER.A
878	AT2G14170.1	ALDH6B2 (3-chloroallyl aldehyde dehydrogenase)	other processes	g) other metabolic pathways	mitochondria	360	757.37	1512.72	757.37	1512.73	2	-8.46	18	130504	103	2	391 - 404	R.CMALSTVVFVGDAK.S	Oxidation: 2
878	AT2G14170.1	ALDH6B2 (3-chloroallyl aldehyde dehydrogenase)	other processes	g) other metabolic pathways	mitochondria	386	645.31	1288.60	645.31	1288.61	2	-9.34	18.5	358626	90	3	563 - 574	K.ASFAGDLNFYGK.A
878	AT2G14170.1	ALDH6B2 (3-chloroallyl aldehyde dehydrogenase)	other processes	g) other metabolic pathways	mitochondria	63	611.31	1220.60	611.31	1220.61	2	-7.69	11	20576	66	2	193 - 203	K.LAMNITTEQGK.T	Oxidation: 3
1337	AT3G14415.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	476	554.29	1106.57	554.30	1106.58	2	-10.39	20.1	20050	52	1	125 - 132	R.FFQLYVYK.N
1337	AT3G14415.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	388	529.80	1057.58	529.80	1057.59	2	-13.33	18.1	17522	39	2	280 - 289	R.VPVFLDGGVR.R
1337	AT3G14415.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	289	528.80	1055.59	528.81	1055.60	2	-9.65	15.9	10245	58	2	151 - 160	K.AIALTVDTPR.L
1337	AT3G14415.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	605	938.00	1873.99	938.01	1874.00	2	-6.06	24.1	15365	18	1	258 - 274	R.QLDYVPATISALEEVVK.A
1337	AT3G14415.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	110	459.23	916.45	459.24	916.46	2	-9.37	11.8	15312	54	1	231 - 239	K.GVLTGEDAR.I
1337	AT3G14415.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	30	445.53	1333.57	445.53	1333.57	3	-5.25	9.9	6408	42	2	83 - 94	K.MAHPDGEYATAR.A	Oxidation: 1
1337	AT3G14415.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	390	529.80	1057.58	529.80	1057.59	2	-15.27	18.1	5994	32	2	280 - 289	R.VPVFLDGGVR.R
1337	AT3G14415.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	287	528.80	1055.58	528.81	1055.60	2	-12.99	15.8	9885	66	2	151 - 160	K.AIALTVDTPR.L
1337	AT3G14415.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	33	445.53	1333.57	445.53	1333.57	3	-4.42	9.9	5060	23	2	83 - 94	K.MAHPDGEYATAR.A	Oxidation: 1
1393	AT3G14415.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	235	528.81	1055.60	528.81	1055.60	2	-1.19	15.7	30258	66	3	151 - 160	K.AIALTVDTPR.L
1393	AT3G14415.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	233	528.81	1055.60	528.81	1055.60	2	-0.02	15.6	12729	57	3	151 - 160	K.AIALTVDTPR.L
1393	AT3G14415.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	338	529.80	1057.59	529.80	1057.59	2	1.41	18	6734	67	3	280 - 289	R.VPVFLDGGVR.R
1393	AT3G14415.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	408	572.34	1142.67	572.34	1142.67	2	-0.77	19.6	6519	35	3	172 - 181	R.FTLPPNLTLK.N
1393	AT3G14415.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	8	445.53	1333.57	445.53	1333.57	3	1.53	9.7	15720	23	3	83 - 94	K.MAHPDGEYATAR.A	Oxidation: 1
1393	AT3G14415.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	9	445.53	1333.57	445.53	1333.57	3	0.72	9.8	15306	51	3	83 - 94	K.MAHPDGEYATAR.A	Oxidation: 1
1393	AT3G14415.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	405	572.34	1142.66	572.34	1142.67	2	-5.45	19.5	9429	32	3	172 - 181	R.FTLPPNLTLK.N
1393	AT3G14415.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	342	529.80	1057.59	529.80	1057.59	2	-0.04	18.1	9845	60	3	280 - 289	R.VPVFLDGGVR.R
1393	AT3G14415.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	282	573.66	1717.96	573.66	1717.96	3	2.42	16.7	2238	32	1	240 - 257	R.IAIQAGAAGIIVSNHGAR.Q
1393	AT3G14415.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	11	445.53	1333.57	445.53	1333.57	3	1.24	9.8	19911	34	3	83 - 94	K.MAHPDGEYATAR.A	Oxidation: 1
1393	AT3G14415.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	385	828.40	1654.78	828.40	1654.78	2	0.91	19.1	3833	66	1	1 - 14	-.MEITNVTEYDAIAK.A	Acetyl: 1
1393	AT3G14415.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	429	554.30	1106.58	554.30	1106.58	2	-0.74	20.1	5754	52	3	125 - 132	R.FFQLYVYK.N
1393	AT3G14415.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	238	528.81	1055.60	528.81	1055.60	2	-1.17	15.7	15699	47	3	151 - 160	K.AIALTVDTPR.L
1393	AT3G14415.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	136	401.25	800.49	401.26	800.50	2	-12.17	13.3	3431	21	1	45 - 50	R.ILFRPR.I
1393	AT3G14415.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	65	459.24	916.46	459.24	916.46	2	-3.66	11.6	5574	50	2	231 - 239	K.GVLTGEDAR.I
1393	AT3G14415.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	424	554.30	1106.58	554.30	1106.58	2	-1.21	20	4189	38	3	125 - 132	R.FFQLYVYK.N
1393	AT3G14415.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	410	572.34	1142.67	572.34	1142.67	2	-1.66	19.7	7502	29	3	172 - 181	R.FTLPPNLTLK.N
1393	AT3G14415.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	427	554.30	1106.58	554.30	1106.58	2	-0.76	20.1	4974	54	3	125 - 132	R.FFQLYVYK.N
1393	AT3G14415.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	428	1107.59	1106.58	1107.59	1106.58	1	-0.75	20.1	5374	18	1	125 - 132	R.FFQLYVYK.N
1393	AT3G14415.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	340	529.80	1057.59	529.80	1057.59	2	-3.65	18	8408	53	3	280 - 289	R.VPVFLDGGVR.R
1393	AT3G14415.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	456	669.71	2006.12	669.71	2006.11	3	2.13	21.7	4313	25	1	51 - 68	R.ILIDVNKIDMATTVLGFK.I	Oxidation: 10
1393	AT3G14415.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	310	496.76	991.50	496.76	991.50	2	2.84	17.3	8123	29	1	182 - 190	K.NFEGLDLGK.M
1393	AT3G14415.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	278	859.99	1717.96	859.99	1717.96	2	2.53	16.6	4004	46	1	240 - 257	R.IAIQAGAAGIIVSNHGAR.Q
1393	AT3G14415.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	128	421.76	841.50	421.76	841.50	2	0.61	13.1	10277	34	1	136 - 142	K.VVEQLVR.R
1393	AT3G14415.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	68	459.24	916.46	459.24	916.46	2	-1.24	11.7	8612	50	2	231 - 239	K.GVLTGEDAR.I
1393	AT3G14420.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	235	528.81	1055.60	528.81	1055.60	2	-1.19	15.7	30258	66	3	151 - 160	K.AIALTVDTPR.L
1393	AT3G14420.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	318	621.33	1240.64	621.33	1240.64	2	0.69	17.5	8534	68	2	58 - 68	K.IDMTTTVLGFK.I	Oxidation: 3
1393	AT3G14420.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	8	445.53	1333.57	445.53	1333.57	3	1.53	9.7	15720	23	3	83 - 94	K.MAHPDGEYATAR.A	Oxidation: 1
1393	AT3G14420.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	282	573.66	1717.96	573.66	1717.96	3	2.42	16.7	2238	32	1	240 - 257	R.IAIQAGAAGIIVSNHGAR.Q
1393	AT3G14420.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	378	536.81	1071.60	536.81	1071.61	2	-4.05	18.9	4328	52	1	280 - 289	R.IPVFLDGGVR.R
1393	AT3G14420.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	136	401.25	800.49	401.26	800.50	2	-12.17	13.3	3431	21	1	45 - 50	R.ILFRPR.I
1393	AT3G14420.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	278	859.99	1717.96	859.99	1717.96	2	2.53	16.6	4004	46	1	240 - 257	R.IAIQAGAAGIIVSNHGAR.Q
1393	AT3G14420.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	408	572.34	1142.67	572.34	1142.67	2	-0.77	19.6	6519	35	3	172 - 181	R.FTLPPNLTLK.N
1393	AT3G14420.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	428	1107.59	1106.58	1107.59	1106.58	1	-0.75	20.1	5374	18	1	125 - 132	R.FFQLYVYK.N
1393	AT3G14420.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	410	572.34	1142.67	572.34	1142.67	2	-1.66	19.7	7502	29	3	172 - 181	R.FTLPPNLTLK.N
1393	AT3G14420.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	320	621.33	1240.64	621.33	1240.64	2	-0.13	17.6	6574	47	2	58 - 68	K.IDMTTTVLGFK.I	Oxidation: 3
1393	AT3G14420.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	310	496.76	991.50	496.76	991.50	2	2.84	17.3	8123	29	1	182 - 190	K.NFEGLDLGK.M
1393	AT3G14420.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	427	554.30	1106.58	554.30	1106.58	2	-0.76	20.1	4974	54	3	125 - 132	R.FFQLYVYK.N
1393	AT3G14420.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	68	459.24	916.46	459.24	916.46	2	-1.24	11.7	8612	50	2	231 - 239	K.GVLTGEDAR.I
1393	AT3G14420.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	65	459.24	916.46	459.24	916.46	2	-3.66	11.6	5574	50	2	231 - 239	K.GVLTGEDAR.I
1393	AT3G14420.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	405	572.34	1142.66	572.34	1142.67	2	-5.45	19.5	9429	32	3	172 - 181	R.FTLPPNLTLK.N
1393	AT3G14420.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	385	828.40	1654.78	828.40	1654.78	2	0.91	19.1	3833	66	1	1 - 14	-.MEITNVTEYDAIAK.Q	Acetyl: 1
1393	AT3G14420.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	238	528.81	1055.60	528.81	1055.60	2	-1.17	15.7	15699	47	3	151 - 160	K.AIALTVDTPR.L
1393	AT3G14420.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	11	445.53	1333.57	445.53	1333.57	3	1.24	9.8	19911	34	3	83 - 94	K.MAHPDGEYATAR.A	Oxidation: 1
1393	AT3G14420.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	266	478.78	955.55	478.78	955.55	2	1.34	16.3	15028	20	2	135 - 142	R.NVVEQLVR.R
1393	AT3G14420.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	429	554.30	1106.58	554.30	1106.58	2	-0.74	20.1	5754	52	3	125 - 132	R.FFQLYVYK.N
1393	AT3G14420.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	424	554.30	1106.58	554.30	1106.58	2	-1.21	20	4189	38	3	125 - 132	R.FFQLYVYK.N
1393	AT3G14420.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	9	445.53	1333.57	445.53	1333.57	3	0.72	9.8	15306	51	3	83 - 94	K.MAHPDGEYATAR.A	Oxidation: 1
1393	AT3G14420.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	233	528.81	1055.60	528.81	1055.60	2	-0.02	15.6	12729	57	3	151 - 160	K.AIALTVDTPR.L
1393	AT3G14420.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	264	478.78	955.54	478.78	955.55	2	-1.48	16.3	19326	30	2	135 - 142	R.NVVEQLVR.R
1448	AT3G14415.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	325	405.57	1213.69	405.57	1213.69	3	-2.90	15.8	3189	17	1	280 - 290	R.VPVFLDGGVRR.G
1448	AT3G14415.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	129	459.24	916.46	459.24	916.46	2	-3.64	11.4	56944	46	3	231 - 239	K.GVLTGEDAR.I
1448	AT3G14415.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	39	445.53	1333.57	445.53	1333.57	3	-2.24	9.4	4237	48	2	83 - 94	K.MAHPDGEYATAR.A	Oxidation: 1
1448	AT3G14415.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	154	403.22	804.43	403.22	804.43	2	-2.11	12	28558	22	2	345 - 351	R.SLSEITR.N
1448	AT3G14415.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	124	459.24	916.46	459.24	916.46	2	-3.99	11.3	27452	50	3	231 - 239	K.GVLTGEDAR.I
1448	AT3G14415.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	408	529.80	1057.59	529.80	1057.59	2	-2.44	17.7	11534	54	2	280 - 289	R.VPVFLDGGVR.R
1448	AT3G14415.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	42	445.53	1333.57	445.53	1333.57	3	-1.01	9.5	12429	51	2	83 - 94	K.MAHPDGEYATAR.A	Oxidation: 1
1448	AT3G14415.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	306	528.80	1055.59	528.81	1055.60	2	-7.53	15.4	9494	47	3	151 - 160	K.AIALTVDTPR.L
1448	AT3G14415.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	126	459.24	916.46	459.24	916.46	2	-3.07	11.3	21623	46	3	231 - 239	K.GVLTGEDAR.I
1448	AT3G14415.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	639	938.01	1874.00	938.01	1874.00	2	-2.93	23.8	21218	15	1	258 - 274	R.QLDYVPATISALEEVVK.A
1448	AT3G14415.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	301	528.80	1055.58	528.81	1055.60	2	-15.38	15.3	4058	60	3	151 - 160	K.AIALTVDTPR.L
1448	AT3G14415.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	502	1107.58	1106.57	1107.59	1106.58	1	-4.95	19.8	57533	32	1	125 - 132	R.FFQLYVYK.N
1448	AT3G14415.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	498	554.29	1106.57	554.30	1106.58	2	-5.23	19.7	91789	51	2	125 - 132	R.FFQLYVYK.N
1448	AT3G14415.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	641	625.67	1874.00	625.68	1874.00	3	-2.93	23.8	37285	38	2	258 - 274	R.QLDYVPATISALEEVVK.A
1448	AT3G14415.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	642	625.67	1874.00	625.68	1874.00	3	-1.59	23.9	28403	37	2	258 - 274	R.QLDYVPATISALEEVVK.A
1448	AT3G14415.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	501	554.29	1106.57	554.30	1106.58	2	-4.94	19.8	27416	50	2	125 - 132	R.FFQLYVYK.N
1448	AT3G14415.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	304	528.80	1055.59	528.81	1055.60	2	-7.30	15.3	9873	50	3	151 - 160	K.AIALTVDTPR.L
1448	AT3G14415.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	411	529.80	1057.59	529.80	1057.59	2	-3.97	17.7	22943	67	2	280 - 289	R.VPVFLDGGVR.R
1448	AT3G14415.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	89	440.20	1317.58	440.20	1317.58	3	-1.41	10.5	60762	38	1	83 - 94	K.MAHPDGEYATAR.A
1448	AT3G14415.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	156	403.22	804.43	403.22	804.43	2	-1.27	12	66926	22	2	345 - 351	R.SLSEITR.N
1448	AT3G14415.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	459	828.39	1654.77	828.40	1654.78	2	-1.05	18.8	28558	84	2	1 - 14	-.MEITNVTEYDAIAK.A	Acetyl: 1
1448	AT3G14415.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	463	828.39	1654.77	828.40	1654.78	2	-1.23	18.9	22542	73	2	1 - 14	-.MEITNVTEYDAIAK.A	Acetyl: 1
1448	AT3G14420.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	306	528.80	1055.59	528.81	1055.60	2	-7.53	15.4	9494	47	3	151 - 160	K.AIALTVDTPR.L
1448	AT3G14420.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	335	478.78	955.54	478.78	955.55	2	-6.95	16	14943	24	1	135 - 142	R.NVVEQLVR.R
1448	AT3G14420.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	304	528.80	1055.59	528.81	1055.60	2	-7.30	15.3	9873	50	3	151 - 160	K.AIALTVDTPR.L
1448	AT3G14420.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	639	938.01	1874.00	938.01	1874.00	2	-2.93	23.8	21218	15	1	258 - 274	R.QLDYVPATISALEEVVK.A
1448	AT3G14420.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	642	625.67	1874.00	625.68	1874.00	3	-1.59	23.9	28403	37	2	258 - 274	R.QLDYVPATISALEEVVK.A
1448	AT3G14420.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	42	445.53	1333.57	445.53	1333.57	3	-1.01	9.5	12429	51	2	83 - 94	K.MAHPDGEYATAR.A	Oxidation: 1
1448	AT3G14420.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	385	621.33	1240.64	621.33	1240.64	2	-1.30	17.1	309201	42	3	58 - 68	K.IDMTTTVLGFK.I	Oxidation: 3
1448	AT3G14420.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	498	554.29	1106.57	554.30	1106.58	2	-5.23	19.7	91789	51	2	125 - 132	R.FFQLYVYK.N
1448	AT3G14420.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	198	445.97	1779.87	445.97	1779.87	4	-0.04	13	31135	38	1	352 - 366	R.NHITTEWDTPRPSAR.L
1448	AT3G14420.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	451	536.81	1071.60	536.81	1071.61	2	-3.50	18.6	64385	48	3	280 - 289	R.IPVFLDGGVR.R
1448	AT3G14420.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	455	536.81	1071.60	536.81	1071.61	2	-5.43	18.7	58468	51	3	280 - 289	R.IPVFLDGGVR.R
1448	AT3G14420.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	124	459.24	916.46	459.24	916.46	2	-3.99	11.3	27452	50	3	231 - 239	K.GVLTGEDAR.I
1448	AT3G14420.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	388	621.33	1240.64	621.33	1240.64	2	0.63	17.2	52200	43	3	58 - 68	K.IDMTTTVLGFK.I	Oxidation: 3
1448	AT3G14420.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	392	621.32	1240.63	621.33	1240.64	2	-2.24	17.3	32060	22	3	58 - 68	K.IDMTTTVLGFK.I	Oxidation: 3
1448	AT3G14420.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	39	445.53	1333.57	445.53	1333.57	3	-2.24	9.4	4237	48	2	83 - 94	K.MAHPDGEYATAR.A	Oxidation: 1
1448	AT3G14420.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	463	828.39	1654.77	828.40	1654.78	2	-1.23	18.9	22542	73	2	1 - 14	-.MEITNVTEYDAIAK.Q	Acetyl: 1
1448	AT3G14420.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	502	1107.58	1106.57	1107.59	1106.58	1	-4.95	19.8	57533	32	1	125 - 132	R.FFQLYVYK.N
1448	AT3G14420.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	641	625.67	1874.00	625.68	1874.00	3	-2.93	23.8	37285	38	2	258 - 274	R.QLDYVPATISALEEVVK.A
1448	AT3G14420.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	501	554.29	1106.57	554.30	1106.58	2	-4.94	19.8	27416	50	2	125 - 132	R.FFQLYVYK.N
1448	AT3G14420.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	126	459.24	916.46	459.24	916.46	2	-3.07	11.3	21623	46	3	231 - 239	K.GVLTGEDAR.I
1448	AT3G14420.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	449	536.81	1071.60	536.81	1071.61	2	-3.59	18.6	106280	51	3	280 - 289	R.IPVFLDGGVR.R
1448	AT3G14420.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	89	440.20	1317.58	440.20	1317.58	3	-1.41	10.5	60762	38	1	83 - 94	K.MAHPDGEYATAR.A
1448	AT3G14420.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	500	616.33	1230.65	616.34	1230.66	2	-7.80	19.7	38563	37	1	215 - 224	K.DVQWLQTITK.L
1448	AT3G14420.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	301	528.80	1055.58	528.81	1055.60	2	-15.38	15.3	4058	60	3	151 - 160	K.AIALTVDTPR.L
1448	AT3G14420.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	129	459.24	916.46	459.24	916.46	2	-3.64	11.4	56944	46	3	231 - 239	K.GVLTGEDAR.I
1448	AT3G14420.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	459	828.39	1654.77	828.40	1654.78	2	-1.05	18.8	28558	84	2	1 - 14	-.MEITNVTEYDAIAK.Q	Acetyl: 1
1496	AT3G14415.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	119	528.80	1055.59	528.81	1055.60	2	-4.98	15.7	4104	66	3	151 - 160	K.AIALTVDTPR.L
1496	AT3G14415.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	17	459.24	916.46	459.24	916.46	2	-0.48	11.7	10527	50	5	231 - 239	K.GVLTGEDAR.I
1496	AT3G14415.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	164	529.80	1057.59	529.80	1057.59	2	-2.34	18.2	4020	67	3	280 - 289	R.VPVFLDGGVR.R
1496	AT3G14415.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	120	528.81	1055.60	528.81	1055.60	2	-0.15	15.7	7321	67	3	151 - 160	K.AIALTVDTPR.L
1496	AT3G14415.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	121	528.81	1055.60	528.81	1055.60	2	3.44	15.7	11025	62	3	151 - 160	K.AIALTVDTPR.L
1496	AT3G14415.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	167	529.80	1057.59	529.80	1057.59	2	-1.17	18.2	7511	67	3	280 - 289	R.VPVFLDGGVR.R
1496	AT3G14415.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	20	459.24	916.46	459.24	916.46	2	1.35	11.8	12856	30	5	231 - 239	K.GVLTGEDAR.I
1496	AT3G14415.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	2	445.53	1333.58	445.53	1333.57	3	4.13	9.8	6356	29	2	83 - 94	K.MAHPDGEYATAR.A	Oxidation: 1
1496	AT3G14415.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	16	459.24	916.46	459.24	916.46	2	-2.22	11.6	5241	22	5	231 - 239	K.GVLTGEDAR.I
1496	AT3G14415.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	165	529.80	1057.59	529.80	1057.59	2	-2.74	18.2	8324	56	3	280 - 289	R.VPVFLDGGVR.R
1496	AT3G14415.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	177	828.40	1654.78	828.40	1654.78	2	1.09	19.2	3955	43	3	1 - 14	-.MEITNVTEYDAIAK.A	Acetyl: 1
1496	AT3G14415.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	18	459.24	916.46	459.24	916.46	2	2.22	11.7	17537	50	5	231 - 239	K.GVLTGEDAR.I
1496	AT3G14415.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	179	828.40	1654.78	828.40	1654.78	2	1.03	19.2	8562	67	3	1 - 14	-.MEITNVTEYDAIAK.A	Acetyl: 1
1496	AT3G14415.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	1	445.53	1333.58	445.53	1333.57	3	4.40	9.8	4444	34	2	83 - 94	K.MAHPDGEYATAR.A	Oxidation: 1
1496	AT3G14415.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	178	828.40	1654.78	828.40	1654.78	2	0.33	19.2	8146	77	3	1 - 14	-.MEITNVTEYDAIAK.A	Acetyl: 1
1496	AT3G14415.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	185	572.34	1142.66	572.34	1142.67	2	-6.48	19.7	4377	17	1	172 - 181	R.FTLPPNLTLK.N
1496	AT3G14415.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	19	459.24	916.46	459.24	916.46	2	0.45	11.7	19151	47	5	231 - 239	K.GVLTGEDAR.I
1496	AT3G14420.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	130	478.78	955.55	478.78	955.55	2	2.01	16.4	5286	23	3	135 - 142	R.NVVEQLVR.R
1496	AT3G14420.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	119	528.80	1055.59	528.81	1055.60	2	-4.98	15.7	4104	66	3	151 - 160	K.AIALTVDTPR.L
1496	AT3G14420.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	18	459.24	916.46	459.24	916.46	2	2.22	11.7	17537	50	5	231 - 239	K.GVLTGEDAR.I
1496	AT3G14420.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	174	536.81	1071.60	536.81	1071.61	2	-6.29	19	8375	61	4	280 - 289	R.IPVFLDGGVR.R
1496	AT3G14420.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	132	478.78	955.55	478.78	955.55	2	2.10	16.4	9002	22	3	135 - 142	R.NVVEQLVR.R
1496	AT3G14420.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	2	445.53	1333.58	445.53	1333.57	3	4.13	9.8	6356	29	2	83 - 94	K.MAHPDGEYATAR.A	Oxidation: 1
1496	AT3G14420.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	135	478.78	955.55	478.78	955.55	2	6.84	16.5	10228	32	3	135 - 142	R.NVVEQLVR.R
1496	AT3G14420.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	175	536.81	1071.61	536.81	1071.61	2	-2.41	19.1	10698	56	4	280 - 289	R.IPVFLDGGVR.R
1496	AT3G14420.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	16	459.24	916.46	459.24	916.46	2	-2.22	11.6	5241	22	5	231 - 239	K.GVLTGEDAR.I
1496	AT3G14420.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	17	459.24	916.46	459.24	916.46	2	-0.48	11.7	10527	50	5	231 - 239	K.GVLTGEDAR.I
1496	AT3G14420.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	20	459.24	916.46	459.24	916.46	2	1.35	11.8	12856	30	5	231 - 239	K.GVLTGEDAR.I
1496	AT3G14420.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	185	572.34	1142.66	572.34	1142.67	2	-6.48	19.7	4377	17	1	172 - 181	R.FTLPPNLTLK.N
1496	AT3G14420.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	120	528.81	1055.60	528.81	1055.60	2	-0.15	15.7	7321	67	3	151 - 160	K.AIALTVDTPR.L
1496	AT3G14420.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	178	828.40	1654.78	828.40	1654.78	2	0.33	19.2	8146	77	3	1 - 14	-.MEITNVTEYDAIAK.Q	Acetyl: 1
1496	AT3G14420.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	177	828.40	1654.78	828.40	1654.78	2	1.09	19.2	3955	43	3	1 - 14	-.MEITNVTEYDAIAK.Q	Acetyl: 1
1496	AT3G14420.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	176	536.81	1071.60	536.81	1071.61	2	-3.76	19.1	9228	61	4	280 - 289	R.IPVFLDGGVR.R
1496	AT3G14420.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	173	536.81	1071.60	536.81	1071.61	2	-3.59	19	4684	67	4	280 - 289	R.IPVFLDGGVR.R
1496	AT3G14420.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	121	528.81	1055.60	528.81	1055.60	2	3.44	15.7	11025	62	3	151 - 160	K.AIALTVDTPR.L
1496	AT3G14420.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	19	459.24	916.46	459.24	916.46	2	0.45	11.7	19151	47	5	231 - 239	K.GVLTGEDAR.I
1496	AT3G14420.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	179	828.40	1654.78	828.40	1654.78	2	1.03	19.2	8562	67	3	1 - 14	-.MEITNVTEYDAIAK.Q	Acetyl: 1
1496	AT3G14420.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	1	445.53	1333.58	445.53	1333.57	3	4.40	9.8	4444	34	2	83 - 94	K.MAHPDGEYATAR.A	Oxidation: 1
1496	AT3G14420.1	aldolase-type TIM barrel family protein	signal transduction	g) other metabolic pathways	peroxisome	162	621.33	1240.64	621.33	1240.64	2	1.22	17.7	4209	76	1	58 - 68	K.IDMTTTVLGFK.I	Oxidation: 3
572	AT1G56560.1	alkaline neutral invertase A	sugar catabolism	g) other metabolic pathways	mitochondrion	90	457.28	912.54	457.28	912.54	2	-2.23	15	7200	49	1	138 - 145	R.ILENAVVR.Y
572	AT1G56560.1	alkaline neutral invertase A	sugar catabolism	g) other metabolic pathways	mitochondrion	76	437.26	872.50	437.26	872.50	2	1.14	14.6	3462	16	2	279 - 286	R.IDVQTGIK.L
572	AT1G56560.1	alkaline neutral invertase A	sugar catabolism	g) other metabolic pathways	mitochondrion	78	437.26	872.50	437.26	872.50	2	0.22	14.6	5919	20	2	279 - 286	R.IDVQTGIK.L
649	AT1G56560.1	alkaline neutral invertase A	sugar catabolism	g) other metabolic pathways	mitochondrion	274	586.33	1755.96	586.32	1755.93	3	15.44	23	6341	32	1	193 - 206	R.NFLLHTLQLQSWEK.T
649	AT1G56560.1	alkaline neutral invertase A	sugar catabolism	g) other metabolic pathways	mitochondrion	55	437.26	872.50	437.26	872.50	2	8.41	15.3	7747	51	3	279 - 286	R.IDVQTGIK.L
649	AT1G56560.1	alkaline neutral invertase A	sugar catabolism	g) other metabolic pathways	mitochondrion	263	860.09	2577.26	860.08	2577.21	3	18.60	22.7	2592	18	1	226 - 249	R.TVALDENTTEEVLDPDFGESAIGR.V
649	AT1G56560.1	alkaline neutral invertase A	sugar catabolism	g) other metabolic pathways	mitochondrion	131	583.31	1164.60	583.30	1164.58	2	18.21	17.8	4727	73	2	269 - 278	K.ITGDFSLQER.I
649	AT1G56560.1	alkaline neutral invertase A	sugar catabolism	g) other metabolic pathways	mitochondrion	266	678.39	1354.77	678.38	1354.75	2	17.35	22.7	11711	79	1	447 - 458	K.QNEAILNLIEAK.W
649	AT1G56560.1	alkaline neutral invertase A	sugar catabolism	g) other metabolic pathways	mitochondrion	58	437.26	872.51	437.26	872.50	2	9.71	15.4	7215	70	3	279 - 286	R.IDVQTGIK.L
649	AT1G56560.1	alkaline neutral invertase A	sugar catabolism	g) other metabolic pathways	mitochondrion	307	807.94	1613.87	807.93	1613.85	2	17.71	24.7	5005	31	1	555 - 568	R.LYQTWTVAGFLTSK.L
649	AT1G56560.1	alkaline neutral invertase A	sugar catabolism	g) other metabolic pathways	mitochondrion	57	437.26	872.51	437.26	872.50	2	9.99	15.4	11232	34	3	279 - 286	R.IDVQTGIK.L
649	AT1G56560.1	alkaline neutral invertase A	sugar catabolism	g) other metabolic pathways	mitochondrion	133	583.30	1164.59	583.30	1164.58	2	14.20	17.9	12240	44	2	269 - 278	K.ITGDFSLQER.I
649	AT1G56560.1	alkaline neutral invertase A	sugar catabolism	g) other metabolic pathways	mitochondrion	68	457.28	912.55	457.28	912.54	2	7.22	15.8	14459	48	1	138 - 145	R.ILENAVVR.Y
649	AT1G56560.1	alkaline neutral invertase A	sugar catabolism	g) other metabolic pathways	mitochondrion	43	643.33	1926.98	643.33	1926.95	3	13.47	14.6	5662	35	1	107 - 123	R.IHKNEEEVETVSIGSEK.V
649	AT1G56560.1	alkaline neutral invertase A	sugar catabolism	g) other metabolic pathways	mitochondrion	190	566.62	1696.85	566.61	1696.82	3	18.32	19.8	6787	30	1	532 - 544	R.LLADRWPEYYDTR.S
782	AT3G61540.1	alpha/beta-hydrolases superfamily protein	other processes	g) other metabolic pathways	cytosol	103	461.92	1382.73	461.92	1382.75	3	-13.04	14	9481	54	1	469 - 481	K.LVTETASHISGIR.L
782	AT3G61540.1	alpha/beta-hydrolases superfamily protein	other processes	g) other metabolic pathways	cytosol	255	541.30	1080.58	541.30	1080.59	2	-7.19	19.2	13109	27	1	87 - 95	R.FIVPLDYSK.S
782	AT3G61540.1	alpha/beta-hydrolases superfamily protein	other processes	g) other metabolic pathways	cytosol	230	505.59	1513.75	505.59	1513.76	3	-4.54	18.2	4221	18	1	435 - 446	K.KEDWPPLYDVPR.L
782	AT3G61540.1	alpha/beta-hydrolases superfamily protein	other processes	g) other metabolic pathways	cytosol	264	631.83	1261.64	631.83	1261.65	2	-7.78	19.6	3972	48	2	177 - 186	K.ELADYLVHFR.A
782	AT3G61540.1	alpha/beta-hydrolases superfamily protein	other processes	g) other metabolic pathways	cytosol	265	631.82	1261.63	631.83	1261.65	2	-9.43	19.7	4618	50	2	177 - 186	K.ELADYLVHFR.A
782	AT3G61540.1	alpha/beta-hydrolases superfamily protein	other processes	g) other metabolic pathways	cytosol	276	648.37	1294.72	648.37	1294.73	2	-9.28	20	6099	21	1	330 - 341	R.VWDPILVTGAPK.C
782	AT3G61540.1	alpha/beta-hydrolases superfamily protein	other processes	g) other metabolic pathways	cytosol	275	890.46	1778.91	890.47	1778.92	2	-5.00	20	6751	17	1	305 - 322	K.GLQTLGLSGLGSSTGFER.L
253	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	41	414.87	1241.59	414.88	1241.61	3	-13.78	10.04943333	9777	32	2	143 - 153	K.SVHEPMQTGLK.A	Oxidation: 6
253	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	312	625.82	1249.62	625.82	1249.63	2	-9.92	19.14116667	10471	71	2	7 - 17	R.AAELTNLFESR.I
253	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	314	665.88	1329.74	665.88	1329.75	2	-10.01	19.22179167	9283	83	2	178 - 189	K.TTIAIDTILNQK.Q
253	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	235	513.79	1025.58	513.80	1025.59	2	-11.38	16.62738333	14827	57	2	154 - 163	K.AVDSLVPIGR.G
253	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	253	656.37	1966.10	656.38	1966.11	3	-6.67	17.19143333	4235	53	2	427 - 443	R.LTEVLKQPQYAPLPIEK.Q
253	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	307	625.82	1249.62	625.82	1249.63	2	-8.16	19.02039167	28977	91	2	7 - 17	R.AAELTNLFESR.I
253	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	141	522.28	1042.55	522.29	1042.57	2	-11.51	13.644625	24629	51	1	93 - 103	R.TGSIVDVPAGK.A
253	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	310	665.88	1329.74	665.88	1329.75	2	-11.06	19.11438333	13486	70	2	178 - 189	K.TTIAIDTILNQK.Q
253	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	1	506.74	1011.46	506.74	1011.47	2	-12.75	8.335875	5846	58	1	121 - 129	K.GALSDHEQR.R
253	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	39	414.87	1241.59	414.88	1241.61	3	-14.02	9.98221667	8345	28	2	143 - 153	K.SVHEPMQTGLK.A	Oxidation: 6
253	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	296	614.64	1840.90	614.65	1840.92	3	-10.82	18.65741667	4309	54	1	18 - 32	R.IRNFYANFQVDEIGR.V
253	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	137	608.81	1215.60	608.82	1215.62	2	-10.74	13.537225	21905	64	1	109 - 120	R.VVDAMGVPIDGK.G	Oxidation: 5
253	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	240	513.80	1025.58	513.80	1025.59	2	-10.80	16.74816667	19041	39	2	154 - 163	K.AVDSLVPIGR.G
253	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	320	546.33	1635.97	546.34	1635.99	3	-12.19	19.54560833	9175	27	1	470 - 484	K.AILNSVKPELLQALK.G
253	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	281	574.27	1719.80	574.28	1719.81	3	-7.73	18.1191	4448	52	1	262 - 276	R.DNGMHALIIYDDLSK.Q	Oxidation: 4
253	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	11	457.57	1369.69	457.57	1369.70	3	-12.10	8.71305	8184	40	1	142 - 153	R.KSVHEPMQTGLK.A	Oxidation: 7
253	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	257	656.37	1966.10	656.38	1966.11	3	-7.59	17.29883333	7049	33	2	427 - 443	R.LTEVLKQPQYAPLPIEK.Q
449	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	295	625.81	1249.61	625.82	1249.63	2	-17.34	21	79489	73	3	7 - 17	R.AAELTNLFESR.I
449	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	265	574.27	1719.79	574.28	1719.81	3	-15.32	20	31834	27	2	262 - 276	R.DNGMHALIIYDDLSK.Q	Oxidation: 4
449	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	252	491.74	981.47	491.75	981.48	2	-19.17	19.6	13856	40	3	493 - 500	K.MELDAFLK.E	Oxidation: 1
449	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	211	513.79	1025.57	513.80	1025.59	2	-18.56	18.3	140396	54	3	154 - 163	K.AVDSLVPIGR.G
449	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	281	513.24	1536.71	513.25	1536.74	3	-18.98	20.6	46296	46	3	295 - 307	R.EAFPGDVFYLHSR.L
449	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	107	608.80	1215.60	608.82	1215.62	2	-17.85	15	146914	93	3	109 - 120	R.VVDAMGVPIDGK.G	Oxidation: 5
449	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	236	656.37	1966.08	656.38	1966.11	3	-17.34	19.1	92317	59	3	427 - 443	R.LTEVLKQPQYAPLPIEK.Q
449	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	24	414.87	1241.58	414.88	1241.61	3	-19.71	11.2	4752	28	3	143 - 153	K.SVHEPMQTGLK.A	Oxidation: 6
449	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	190	600.81	1199.60	600.82	1199.62	2	-18.33	17.6	11952	73	2	109 - 120	R.VVDAMGVPIDGK.G
449	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	113	522.28	1042.55	522.29	1042.57	2	-17.68	15.2	233095	77	3	93 - 103	R.TGSIVDVPAGK.A
449	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	104	608.80	1215.59	608.82	1215.62	2	-19.87	14.9	7744	84	3	109 - 120	R.VVDAMGVPIDGK.G	Oxidation: 5
449	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	199	642.34	1282.67	642.35	1282.69	2	-17.51	17.9	58084	60	3	433 - 443	K.QPQYAPLPIEK.Q
449	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	79	600.33	1198.65	600.34	1198.67	2	-10.94	13.9	14074	19	1	92 - 103	K.RTGSIVDVPAGK.A
449	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	108	522.28	1042.55	522.29	1042.57	2	-19.67	15	12300	77	3	93 - 103	R.TGSIVDVPAGK.A
449	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	147	446.74	891.46	446.75	891.48	2	-19.51	16.2	20639	53	3	395 - 401	K.LELAQYR.E
449	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	193	600.81	1199.60	600.82	1199.62	2	-19.16	17.7	29989	92	2	109 - 120	R.VVDAMGVPIDGK.G
449	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	280	769.36	1536.71	769.38	1536.74	2	-18.60	20.5	9328	16	1	295 - 307	R.EAFPGDVFYLHSR.L
449	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	73	702.43	701.42	702.44	701.43	1	-18.48	13.7	32381	47	2	427 - 432	R.LTEVLK.Q
449	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	278	513.24	1536.71	513.25	1536.74	3	-18.59	20.5	29488	68	3	295 - 307	R.EAFPGDVFYLHSR.L
449	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	299	665.87	1329.73	665.88	1329.75	2	-16.66	21.1	64434	81	3	178 - 189	K.TTIAIDTILNQK.Q
449	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	152	446.74	891.46	446.75	891.48	2	-19.48	16.4	121619	56	3	395 - 401	K.LELAQYR.E
449	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	194	642.34	1282.67	642.35	1282.69	2	-18.92	17.7	24782	48	3	433 - 443	K.QPQYAPLPIEK.Q
449	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	284	513.24	1536.71	513.25	1536.74	3	-18.28	20.6	59385	58	3	295 - 307	R.EAFPGDVFYLHSR.L
449	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	290	625.81	1249.61	625.82	1249.63	2	-16.81	20.8	222911	95	3	7 - 17	R.AAELTNLFESR.I
449	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	28	621.80	1241.58	621.81	1241.61	2	-19.10	11.3	23712	25	3	143 - 153	K.SVHEPMQTGLK.A	Oxidation: 6
449	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	197	555.79	1109.56	555.80	1109.58	2	-17.99	17.8	73692	71	2	492 - 500	R.KMELDAFLK.E	Oxidation: 2
449	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	240	656.37	1966.08	656.38	1966.11	3	-17.86	19.2	31187	49	3	427 - 443	R.LTEVLKQPQYAPLPIEK.Q
449	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	313	546.33	1635.96	546.34	1635.99	3	-18.61	21.6	89027	43	3	470 - 484	K.AILNSVKPELLQALK.G
449	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	287	625.81	1249.61	625.82	1249.63	2	-15.00	20.7	262124	89	3	7 - 17	R.AAELTNLFESR.I
449	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	27	414.87	1241.58	414.88	1241.61	3	-19.08	11.3	101092	46	3	143 - 153	K.SVHEPMQTGLK.A	Oxidation: 6
449	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	310	546.33	1635.96	546.34	1635.99	3	-17.38	21.5	199505	60	3	470 - 484	K.AILNSVKPELLQALK.G
449	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	196	642.34	1282.67	642.35	1282.69	2	-16.56	17.8	94005	64	3	433 - 443	K.QPQYAPLPIEK.Q
449	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	111	1043.55	1042.55	1043.57	1042.57	1	-17.55	15.1	18730	22	1	93 - 103	R.TGSIVDVPAGK.A
449	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	106	608.80	1215.60	608.82	1215.62	2	-17.75	14.9	44612	82	3	109 - 120	R.VVDAMGVPIDGK.G	Oxidation: 5
449	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	26	621.80	1241.58	621.81	1241.61	2	-19.01	11.3	7960	30	3	143 - 153	K.SVHEPMQTGLK.A	Oxidation: 6
449	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	7	457.57	1369.68	457.57	1369.70	3	-19.16	10	32827	45	1	142 - 153	R.KSVHEPMQTGLK.A	Oxidation: 7
449	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	306	786.86	1571.71	786.88	1571.74	2	-15.89	21.3	3793	52	1	20 - 32	R.NFYANFQVDEIGR.V
449	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	296	665.87	1329.73	665.88	1329.75	2	-17.07	21	120903	80	3	178 - 189	K.TTIAIDTILNQK.Q
449	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	25	414.87	1241.58	414.88	1241.61	3	-18.99	11.2	35461	42	3	143 - 153	K.SVHEPMQTGLK.A	Oxidation: 6
449	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	308	546.33	1635.96	546.34	1635.99	3	-17.86	21.4	115051	65	3	470 - 484	K.AILNSVKPELLQALK.G
449	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	293	665.87	1329.73	665.88	1329.75	2	-17.01	20.9	52150	81	3	178 - 189	K.TTIAIDTILNQK.Q
449	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	309	818.99	1635.96	819.00	1635.99	2	-17.87	21.4	42692	24	1	470 - 484	K.AILNSVKPELLQALK.G
449	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	201	480.28	1437.82	480.29	1437.84	3	-17.88	17.9	23616	58	2	363 - 376	R.GIRPAINVGLSVSR.V
449	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	311	500.34	499.33	500.34	499.34	1	-17.49	21.5	130891	22	2	503 - 507	R.ALALI.-
449	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	212	1026.58	1025.57	1026.59	1025.59	1	-18.60	18.3	13378	19	1	154 - 163	K.AVDSLVPIGR.G
449	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	149	446.74	891.46	446.75	891.48	2	-18.54	16.3	204732	59	3	395 - 401	K.LELAQYR.E
449	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	253	491.74	981.47	491.75	981.48	2	-18.84	19.6	15040	48	3	493 - 500	K.MELDAFLK.E	Oxidation: 1
449	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	217	513.79	1025.57	513.80	1025.59	2	-19.28	18.5	111049	54	3	154 - 163	K.AVDSLVPIGR.G
449	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	264	547.79	1093.56	547.80	1093.58	2	-17.89	20	38917	48	1	492 - 500	R.KMELDAFLK.E
449	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	195	555.79	1109.56	555.80	1109.58	2	-18.04	17.7	13015	79	2	492 - 500	R.KMELDAFLK.E	Oxidation: 2
449	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	307	500.34	499.33	500.34	499.34	1	-17.45	21.4	171979	28	2	503 - 507	R.ALALI.-
449	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	77	702.43	701.42	702.44	701.43	1	-18.09	13.8	20202	24	2	427 - 432	R.LTEVLK.Q
449	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	260	574.27	1719.78	574.28	1719.81	3	-17.04	19.9	13871	48	2	262 - 276	R.DNGMHALIIYDDLSK.Q	Oxidation: 4
449	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	214	513.79	1025.57	513.80	1025.59	2	-18.60	18.4	238959	58	3	154 - 163	K.AVDSLVPIGR.G
449	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	233	656.37	1966.08	656.38	1966.11	3	-17.54	19	14097	69	3	427 - 443	R.LTEVLKQPQYAPLPIEK.Q
449	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	226	555.62	1663.84	555.63	1663.87	3	-18.87	18.8	3811	36	1	388 - 401	K.QVCGSLKLELAQYR.E	Carbamidomethyl: 3
449	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	110	522.28	1042.55	522.29	1042.57	2	-17.53	15.1	219708	77	3	93 - 103	R.TGSIVDVPAGK.A
449	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	204	480.28	1437.81	480.29	1437.84	3	-19.49	18	13726	41	2	363 - 376	R.GIRPAINVGLSVSR.V
449	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	251	491.74	981.47	491.75	981.48	2	-17.99	19.6	6880	32	3	493 - 500	K.MELDAFLK.E	Oxidation: 1
449	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	31	621.80	1241.58	621.81	1241.61	2	-19.13	11.4	11124	17	3	143 - 153	K.SVHEPMQTGLK.A	Oxidation: 6
515	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	210	665.88	1329.75	665.88	1329.75	2	3.08	21	32346	77	3	178 - 189	K.TTIAIDTILNQK.Q
515	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	171	656.38	1966.12	656.38	1966.11	3	0.82	19.1	12435	53	4	427 - 443	R.LTEVLKQPQYAPLPIEK.Q
515	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	2	457.57	1369.70	457.57	1369.70	3	-0.61	10	10954	25	3	142 - 153	R.KSVHEPMQTGLK.A	Oxidation: 7
515	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	204	625.82	1249.63	625.82	1249.63	2	1.09	20.8	42588	80	3	7 - 17	R.AAELTNLFESR.I
515	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	99	438.75	875.49	438.75	875.49	2	-3.08	16.6	14753	48	3	283 - 289	R.QMSLLLR.R	Oxidation: 2
515	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	211	665.88	1329.75	665.88	1329.75	2	2.80	21.1	44676	80	3	178 - 189	K.TTIAIDTILNQK.Q
515	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	169	656.38	1966.12	656.38	1966.11	3	1.66	19	5010	37	4	427 - 443	R.LTEVLKQPQYAPLPIEK.Q
515	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	21	414.88	1241.61	414.88	1241.61	3	0.03	11.4	12695	34	3	143 - 153	K.SVHEPMQTGLK.A	Oxidation: 6
515	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	19	414.88	1241.61	414.88	1241.61	3	-1.44	11.3	11872	28	3	143 - 153	K.SVHEPMQTGLK.A	Oxidation: 6
515	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	149	513.80	1025.59	513.80	1025.59	2	-0.52	18.3	7256	35	3	154 - 163	K.AVDSLVPIGR.G
515	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	134	642.35	1282.70	642.35	1282.69	2	2.30	17.8	7152	57	2	433 - 443	K.QPQYAPLPIEK.Q
515	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	20	414.88	1241.61	414.88	1241.61	3	0.61	11.4	18087	29	3	143 - 153	K.SVHEPMQTGLK.A	Oxidation: 6
515	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	4	457.57	1369.70	457.57	1369.70	3	0.07	10.1	9887	23	3	142 - 153	R.KSVHEPMQTGLK.A	Oxidation: 7
515	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	104	438.75	875.49	438.75	875.49	2	-3.52	16.8	8972	19	3	283 - 289	R.QMSLLLR.R	Oxidation: 2
515	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	203	625.82	1249.63	625.82	1249.63	2	2.64	20.8	6001	77	3	7 - 17	R.AAELTNLFESR.I
515	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	207	625.82	1249.63	625.82	1249.63	2	1.41	20.9	27253	80	3	7 - 17	R.AAELTNLFESR.I
515	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	220	546.34	1635.99	546.34	1635.99	3	-0.14	21.5	23508	23	2	470 - 484	K.AILNSVKPELLQALK.G
515	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	3	457.57	1369.70	457.57	1369.70	3	-1.35	10	13020	43	3	142 - 153	R.KSVHEPMQTGLK.A	Oxidation: 7
515	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	209	665.88	1329.75	665.88	1329.75	2	2.24	21	13866	80	3	178 - 189	K.TTIAIDTILNQK.Q
515	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	101	438.75	875.49	438.75	875.49	2	-2.47	16.7	18467	36	3	283 - 289	R.QMSLLLR.R	Oxidation: 2
515	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	52	608.82	1215.62	608.82	1215.62	2	0.79	15	5716	84	3	109 - 120	R.VVDAMGVPIDGK.G	Oxidation: 5
515	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	218	500.34	499.34	500.34	499.34	1	-1.48	21.4	9685	19	2	503 - 507	R.ALALI.-
515	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	156	513.80	1025.58	513.80	1025.59	2	-2.02	18.5	14856	21	3	154 - 163	K.AVDSLVPIGR.G
515	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	152	513.80	1025.59	513.80	1025.59	2	0.16	18.4	30310	44	3	154 - 163	K.AVDSLVPIGR.G
515	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	53	608.82	1215.62	608.82	1215.62	2	2.15	15.1	28669	95	3	109 - 120	R.VVDAMGVPIDGK.G	Oxidation: 5
515	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	93	446.75	891.48	446.75	891.48	2	-3.57	16.4	16151	36	2	395 - 401	K.LELAQYR.E
515	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	219	546.34	1635.99	546.34	1635.99	3	-1.73	21.4	5918	22	2	470 - 484	K.AILNSVKPELLQALK.G
515	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	170	656.38	1966.11	656.38	1966.11	3	0.12	19.1	11594	46	4	427 - 443	R.LTEVLKQPQYAPLPIEK.Q
515	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	57	608.82	1215.62	608.82	1215.62	2	2.19	15.2	25866	53	3	109 - 120	R.VVDAMGVPIDGK.G	Oxidation: 5
515	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	172	656.38	1966.12	656.38	1966.11	3	1.52	19.2	7744	36	4	427 - 443	R.LTEVLKQPQYAPLPIEK.Q
515	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	133	600.82	1199.62	600.82	1199.62	2	-0.95	17.8	5338	54	1	109 - 120	R.VVDAMGVPIDGK.G
515	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	138	642.36	1282.70	642.35	1282.69	2	2.75	17.9	10313	38	2	433 - 443	K.QPQYAPLPIEK.Q
515	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	62	553.28	2209.09	553.28	2209.08	4	2.41	15.4	4072	25	1	109 - 129	R.VVDAMGVPIDGKGALSDHEQR.R	Oxidation: 5
515	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	221	500.34	499.34	500.34	499.34	1	-1.18	21.5	15303	15	2	503 - 507	R.ALALI.-
515	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	201	513.25	1536.73	513.25	1536.74	3	-1.31	20.7	9183	17	1	295 - 307	R.EAFPGDVFYLHSR.L
515	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	91	446.75	891.48	446.75	891.48	2	-0.28	16.4	8508	42	2	395 - 401	K.LELAQYR.E
574	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	208	446.75	891.49	446.75	891.48	2	4.96	16.3	13522	34	1	395 - 401	K.LELAQYR.E
574	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	371	546.34	1636.00	546.34	1635.99	3	7.60	21.4	11410	28	2	470 - 484	K.AILNSVKPELLQALK.G
574	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	374	546.34	1636.00	546.34	1635.99	3	7.11	21.5	38454	25	2	470 - 484	K.AILNSVKPELLQALK.G
574	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	270	513.80	1025.59	513.80	1025.59	2	5.14	18.3	24968	46	2	154 - 163	K.AVDSLVPIGR.G
574	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	212	438.75	875.49	438.75	875.49	2	-0.60	16.4	17878	49	2	283 - 289	R.QMSLLLR.R	Oxidation: 2
574	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	213	438.75	875.49	438.75	875.49	2	1.27	16.5	17651	46	2	283 - 289	R.QMSLLLR.R	Oxidation: 2
574	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	49	414.88	1241.61	414.88	1241.61	3	3.28	11.3	7112	19	2	143 - 153	K.SVHEPMQTGLK.A	Oxidation: 6
574	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	351	625.83	1249.64	625.82	1249.63	2	8.49	20.8	53968	76	2	7 - 17	R.AAELTNLFESR.I
574	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	273	513.80	1025.59	513.80	1025.59	2	3.91	18.4	197981	55	2	154 - 163	K.AVDSLVPIGR.G
574	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	170	608.82	1215.63	608.82	1215.62	2	6.64	15.1	108161	55	2	109 - 120	R.VVDAMGVPIDGK.G	Oxidation: 5
574	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	348	625.83	1249.64	625.82	1249.63	2	9.13	20.7	45793	78	2	7 - 17	R.AAELTNLFESR.I
574	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	294	656.38	1966.13	656.38	1966.11	3	8.09	19	136586	62	1	427 - 443	R.LTEVLKQPQYAPLPIEK.Q
574	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	50	414.88	1241.61	414.88	1241.61	3	2.51	11.3	7297	28	2	143 - 153	K.SVHEPMQTGLK.A	Oxidation: 6
574	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	3	457.58	1369.71	457.57	1369.70	3	3.72	9.8	9636	28	2	142 - 153	R.KSVHEPMQTGLK.A	Oxidation: 7
574	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	251	642.35	1282.69	642.35	1282.69	2	1.75	17.7	59817	51	1	433 - 443	K.QPQYAPLPIEK.Q
574	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	250	600.82	1199.63	600.82	1199.62	2	5.91	17.6	129437	49	1	109 - 120	R.VVDAMGVPIDGK.G
574	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	1	457.58	1369.70	457.57	1369.70	3	1.36	9.8	47817	32	2	142 - 153	R.KSVHEPMQTGLK.A	Oxidation: 7
574	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	166	608.82	1215.63	608.82	1215.62	2	7.79	15	111139	77	2	109 - 120	R.VVDAMGVPIDGK.G	Oxidation: 5
650	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	122	546.34	1636.01	546.34	1635.99	3	9.49	21.6	5133	25	3	470 - 484	K.AILNSVKPELLQALK.G
650	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	110	625.83	1249.65	625.82	1249.63	2	12.78	20.9	5333	63	3	7 - 17	R.AAELTNLFESR.I
650	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	124	546.34	1636.01	546.34	1635.99	3	9.30	21.7	10595	37	3	470 - 484	K.AILNSVKPELLQALK.G
650	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	115	665.89	1329.77	665.88	1329.75	2	11.31	21.2	6603	85	4	178 - 189	K.TTIAIDTILNQK.Q
650	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	21	522.30	1042.58	522.29	1042.57	2	11.19	15.3	7564	64	2	93 - 103	R.TGSIVDVPAGK.A
650	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	88	513.81	1025.60	513.80	1025.59	2	8.41	18.5	14095	54	4	154 - 163	K.AVDSLVPIGR.G
650	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	116	665.89	1329.77	665.88	1329.75	2	12.48	21.2	12701	64	4	178 - 189	K.TTIAIDTILNQK.Q
650	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	117	665.89	1329.77	665.88	1329.75	2	11.24	21.2	14743	76	4	178 - 189	K.TTIAIDTILNQK.Q
650	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	76	642.36	1282.70	642.35	1282.69	2	9.66	18	3768	58	3	433 - 443	K.QPQYAPLPIEK.Q
650	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	86	513.80	1025.59	513.80	1025.59	2	6.97	18.5	5618	45	4	154 - 163	K.AVDSLVPIGR.G
650	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	63	438.75	875.49	438.75	875.49	2	4.21	16.8	3988	35	2	283 - 289	R.QMSLLLR.R	Oxidation: 2
650	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	112	625.83	1249.64	625.82	1249.63	2	11.44	21	19973	91	3	7 - 17	R.AAELTNLFESR.I
650	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	118	665.89	1329.77	665.88	1329.75	2	12.44	21.3	11216	73	4	178 - 189	K.TTIAIDTILNQK.Q
650	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	19	608.82	1215.63	608.82	1215.62	2	9.32	15.2	5665	55	2	109 - 120	R.VVDAMGVPIDGK.G	Oxidation: 5
650	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	59	446.75	891.49	446.75	891.48	2	9.66	16.7	5936	22	2	395 - 401	K.LELAQYR.E
650	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	23	522.30	1042.58	522.29	1042.57	2	9.97	15.4	10761	59	2	93 - 103	R.TGSIVDVPAGK.A
650	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	89	513.81	1025.60	513.80	1025.59	2	8.98	18.6	15082	54	4	154 - 163	K.AVDSLVPIGR.G
650	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	125	546.34	1636.01	546.34	1635.99	3	8.37	21.7	9849	21	3	470 - 484	K.AILNSVKPELLQALK.G
650	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	56	446.75	891.49	446.75	891.48	2	5.85	16.6	5505	37	2	395 - 401	K.LELAQYR.E
650	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	64	438.75	875.49	438.75	875.49	2	4.37	16.9	6395	50	2	283 - 289	R.QMSLLLR.R	Oxidation: 2
650	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	114	625.83	1249.65	625.82	1249.63	2	13.10	21.1	13171	67	3	7 - 17	R.AAELTNLFESR.I
650	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	20	608.82	1215.63	608.82	1215.62	2	12.93	15.3	12713	59	2	109 - 120	R.VVDAMGVPIDGK.G	Oxidation: 5
650	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	90	513.80	1025.59	513.80	1025.59	2	7.52	18.6	10069	45	4	154 - 163	K.AVDSLVPIGR.G
650	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	79	642.36	1282.71	642.35	1282.69	2	11.89	18.1	7630	31	3	433 - 443	K.QPQYAPLPIEK.Q
650	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	77	642.36	1282.71	642.35	1282.69	2	10.17	18	5819	34	3	433 - 443	K.QPQYAPLPIEK.Q
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	171	522.29	1042.57	522.29	1042.57	2	1.49	13.8	51886	81	3	93 - 103	R.TGSIVDVPAGK.A
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	164	737.37	2209.08	737.37	2209.08	3	1.59	13.6	5537	23	1	109 - 129	R.VVDAMGVPIDGKGALSDHEQR.R	Oxidation: 5
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	10	408.73	815.45	408.73	815.45	2	-3.90	8.5	20821	50	1	86 - 92	K.EGDLVKR.T
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	377	500.35	499.34	500.34	499.34	1	1.80	20.3	3159	30	3	503 - 507	R.ALALI.-
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	212	446.75	891.48	446.75	891.48	2	0.84	15.1	137287	53	2	395 - 401	K.LELAQYR.E
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	347	665.89	1329.76	665.88	1329.75	2	5.32	19.3	423113	106	3	178 - 189	K.TTIAIDTILNQK.Q
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	296	430.75	859.50	430.75	859.49	2	0.38	17.7	93277	53	1	283 - 289	R.QMSLLLR.R
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	416	793.08	2376.21	793.07	2376.20	3	3.98	21.5	5542	35	2	63 - 85	K.GMALNLENENVGIVVFGGDTAIK.E	Oxidation: 2
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	315	860.92	1719.82	860.91	1719.81	2	3.03	18.3	12867	53	1	262 - 276	R.DNGMHALIIYDDLSK.Q	Oxidation: 4
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	251	600.82	1199.63	600.82	1199.62	2	5.26	16.3	14794	76	1	109 - 120	R.VVDAMGVPIDGK.G
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	87	631.32	630.32	631.32	630.32	1	-0.39	11.1	21387	31	2	459 - 463	R.MPLDR.I
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	172	1043.57	1042.57	1043.57	1042.57	1	1.49	13.8	5010	39	2	93 - 103	R.TGSIVDVPAGK.A
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	358	786.88	1571.75	786.88	1571.74	2	5.66	19.6	5779	56	1	20 - 32	R.NFYANFQVDEIGR.V
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	218	438.75	875.49	438.75	875.49	2	-0.44	15.3	93154	43	2	283 - 289	R.QMSLLLR.R	Oxidation: 2
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	354	546.34	1636.00	546.34	1635.99	3	3.21	19.5	27041	63	4	470 - 484	K.AILNSVKPELLQALK.G
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	56	414.88	1241.61	414.88	1241.61	3	0.37	10	41784	45	3	143 - 153	K.SVHEPMQTGLK.A	Oxidation: 6
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	250	480.29	1437.84	480.29	1437.84	3	2.36	16.3	6038	56	1	363 - 376	R.GIRPAINVGLSVSR.V
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	112	409.54	1225.61	409.54	1225.61	3	-1.78	11.9	31472	55	2	143 - 153	K.SVHEPMQTGLK.A
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	300	656.71	1967.10	656.38	1966.11	3	501.83	17.8	7142	27	4	427 - 443	R.LTEVLKQPQYAPLPIEK.Q
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	361	568.95	1703.83	568.95	1703.82	3	4.17	19.7	3539	55	3	262 - 276	R.DNGMHALIIYDDLSK.Q
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	272	513.80	1025.59	513.80	1025.59	2	4.63	17	78540	64	4	154 - 163	K.AVDSLVPIGR.G
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	242	452.26	902.50	451.76	901.51	2	1100.83	16.1	187835	15	1	283 - 289	R.QMSLLLR.R	Acetyl: 1
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	336	769.38	1536.74	769.38	1536.74	2	2.73	19	35635	81	3	295 - 307	R.EAFPGDVFYLHSR.L
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	318	547.80	1093.59	547.80	1093.58	2	1.52	18.4	4537	81	1	492 - 500	R.KMELDAFLK.E
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	215	438.75	875.49	438.75	875.49	2	0.61	15.2	284171	51	2	283 - 289	R.QMSLLLR.R	Oxidation: 2
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	166	522.29	1042.57	522.29	1042.57	2	1.35	13.6	1879	81	3	93 - 103	R.TGSIVDVPAGK.A
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	273	1026.60	1025.59	1026.59	1025.59	1	4.65	17	29080	29	2	154 - 163	K.AVDSLVPIGR.G
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	341	625.83	1249.64	625.82	1249.63	2	6.62	19.2	128422	94	2	7 - 17	R.AAELTNLFESR.I
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	319	574.28	1719.82	574.28	1719.81	3	4.34	18.4	3939	44	2	262 - 276	R.DNGMHALIIYDDLSK.Q	Oxidation: 4
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	311	491.75	981.48	491.75	981.48	2	-1.78	18.2	27362	59	1	493 - 500	K.MELDAFLK.E	Oxidation: 1
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	396	546.67	1636.98	546.34	1635.99	3	603.92	20.9	3099	20	4	470 - 484	K.AILNSVKPELLQALK.G
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	356	546.34	1636.00	546.34	1635.99	3	5.39	19.6	88662	59	4	470 - 484	K.AILNSVKPELLQALK.G
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	6	506.74	1011.47	506.74	1011.47	2	0.15	8.2	132642	62	3	121 - 129	K.GALSDHEQR.R
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	169	1043.58	1042.57	1043.57	1042.57	1	3.24	13.7	2911	39	2	93 - 103	R.TGSIVDVPAGK.A
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	12	457.57	1369.70	457.57	1369.70	3	-1.18	8.6	12029	56	2	142 - 153	R.KSVHEPMQTGLK.A	Oxidation: 7
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	389	569.28	1704.81	568.95	1703.82	3	581.44	20.6	4433	39	3	262 - 276	R.DNGMHALIIYDDLSK.Q
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	364	568.95	1703.82	568.95	1703.82	3	2.86	19.8	22130	43	3	262 - 276	R.DNGMHALIIYDDLSK.Q
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	209	446.75	891.48	446.75	891.48	2	3.15	15	246745	59	2	395 - 401	K.LELAQYR.E
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	142	702.44	701.43	702.44	701.43	1	-0.28	12.9	4496	36	3	427 - 432	R.LTEVLK.Q
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	339	769.38	1536.74	769.38	1536.74	2	2.83	19.1	70043	76	3	295 - 307	R.EAFPGDVFYLHSR.L
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	329	614.65	1840.93	614.65	1840.92	3	3.69	18.8	138586	33	1	18 - 32	R.IRNFYANFQVDEIGR.V
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	29	791.41	790.40	791.41	790.40	1	-0.66	9.2	61230	48	1	388 - 394	K.QVCGSLK.L	Carbamidomethyl: 3
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	163	608.82	1215.62	608.82	1215.62	2	3.06	13.6	46877	72	2	109 - 120	R.VVDAMGVPIDGK.G	Oxidation: 5
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	371	500.35	499.34	500.34	499.34	1	2.54	20.1	17131	28	3	503 - 507	R.ALALI.-
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	35	773.45	772.45	773.45	772.44	1	2.24	9.4	24876	39	2	377 - 384	R.VGSAAQLK.A
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	271	1026.60	1025.59	1026.59	1025.59	1	3.27	16.9	7698	16	2	154 - 163	K.AVDSLVPIGR.G
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	98	442.27	882.53	442.27	882.53	2	-1.37	11.4	68051	38	1	135 - 142	K.APGILERK.S
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	304	656.71	1967.10	656.38	1966.11	3	502.85	18	4571	22	4	427 - 443	R.LTEVLKQPQYAPLPIEK.Q
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	59	414.88	1241.61	414.88	1241.61	3	1.09	10.1	52600	46	3	143 - 153	K.SVHEPMQTGLK.A	Oxidation: 6
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	249	555.80	1109.58	555.80	1109.58	2	1.07	16.3	56936	71	1	492 - 500	R.KMELDAFLK.E	Oxidation: 2
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	350	665.89	1329.76	665.88	1329.75	2	5.22	19.4	290189	110	3	178 - 189	K.TTIAIDTILNQK.Q
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	57	621.81	1241.61	621.81	1241.61	2	0.37	10	18443	54	2	143 - 153	K.SVHEPMQTGLK.A	Oxidation: 6
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	294	665.88	1329.75	665.88	1329.75	2	2.87	17.7	69947	25	3	178 - 189	K.TTIAIDTILNQK.Q
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	335	513.25	1536.74	513.25	1536.74	3	2.72	19	305604	67	3	295 - 307	R.EAFPGDVFYLHSR.L
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	359	546.34	1636.00	546.34	1635.99	3	3.28	19.7	8969	70	4	470 - 484	K.AILNSVKPELLQALK.G
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	275	555.63	1663.88	555.63	1663.87	3	2.42	17.1	30251	47	1	388 - 401	K.QVCGSLKLELAQYR.E	Carbamidomethyl: 3
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	418	793.08	2376.21	793.07	2376.20	3	3.66	21.6	4246	30	2	63 - 85	K.GMALNLENENVGIVVFGGDTAIK.E	Oxidation: 2
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	60	621.81	1241.61	621.81	1241.61	2	1.10	10.1	30910	60	2	143 - 153	K.SVHEPMQTGLK.A	Oxidation: 6
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	374	500.35	499.34	500.34	499.34	1	3.06	20.2	9885	25	3	503 - 507	R.ALALI.-
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	334	513.25	1536.74	513.25	1536.74	3	3.03	18.9	45659	64	3	295 - 307	R.EAFPGDVFYLHSR.L
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	68	452.24	1353.71	452.24	1353.71	3	0.71	10.4	9637	65	2	142 - 153	R.KSVHEPMQTGLK.A
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	167	553.28	2209.08	553.28	2209.08	4	-0.16	13.7	36464	22	3	109 - 129	R.VVDAMGVPIDGKGALSDHEQR.R	Oxidation: 5
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	257	513.80	1025.59	513.80	1025.59	2	-0.39	16.5	17257	39	4	154 - 163	K.AVDSLVPIGR.G
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	137	702.44	701.43	702.44	701.43	1	-0.61	12.7	13068	42	3	427 - 432	R.LTEVLK.Q
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	269	513.80	1025.59	513.80	1025.59	2	3.27	16.9	13771	62	4	154 - 163	K.AVDSLVPIGR.G
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	290	656.38	1966.12	656.38	1966.11	3	4.68	17.6	194686	61	4	427 - 443	R.LTEVLKQPQYAPLPIEK.Q
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	39	773.45	772.45	773.45	772.44	1	1.72	9.5	15101	44	2	377 - 384	R.VGSAAQLK.A
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	135	600.34	1198.67	600.34	1198.67	2	2.00	12.6	3582	40	2	92 - 103	K.RTGSIVDVPAGK.A
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	165	608.82	1215.62	608.82	1215.62	2	3.73	13.6	5270	75	2	109 - 120	R.VVDAMGVPIDGK.G	Oxidation: 5
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	115	409.54	1225.61	409.54	1225.61	3	0.15	12	21953	39	2	143 - 153	K.SVHEPMQTGLK.A
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	379	483.75	965.49	483.75	965.49	2	0.79	20.3	70222	38	1	493 - 500	K.MELDAFLK.E
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	168	522.29	1042.57	522.29	1042.57	2	3.23	13.7	19194	77	3	93 - 103	R.TGSIVDVPAGK.A
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	113	613.81	1225.61	613.81	1225.61	2	-1.78	11.9	23411	55	2	143 - 153	K.SVHEPMQTGLK.A
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	254	642.36	1282.70	642.35	1282.69	2	5.85	16.4	24434	63	3	433 - 443	K.QPQYAPLPIEK.Q
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	258	642.36	1282.70	642.35	1282.69	2	4.44	16.5	16631	42	3	433 - 443	K.QPQYAPLPIEK.Q
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	122	732.37	731.36	732.37	731.36	1	-0.69	12.2	20137	15	1	1 - 6	-.MELSPR.A
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	65	452.24	1353.71	452.24	1353.71	3	0.62	10.3	19087	53	2	142 - 153	R.KSVHEPMQTGLK.A
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	31	707.38	706.38	707.38	706.38	1	0.58	9.2	35531	37	2	277 - 282	K.QAVAYR.Q
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	85	631.32	630.32	631.32	630.32	1	1.21	11	4024	29	2	459 - 463	R.MPLDR.I
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	344	625.83	1249.64	625.82	1249.63	2	4.95	19.2	85542	94	2	7 - 17	R.AAELTNLFESR.I
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	252	642.36	1282.70	642.35	1282.69	2	5.42	16.3	5096	81	3	433 - 443	K.QPQYAPLPIEK.Q
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	13	685.86	1369.70	685.86	1369.70	2	-1.18	8.6	4246	37	1	142 - 153	R.KSVHEPMQTGLK.A	Oxidation: 7
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	116	613.81	1225.61	613.81	1225.61	2	0.16	12	17317	37	2	143 - 153	K.SVHEPMQTGLK.A
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	139	702.44	701.43	702.44	701.43	1	0.10	12.8	49435	42	3	427 - 432	R.LTEVLK.Q
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	138	600.34	1198.67	600.34	1198.67	2	2.25	12.7	26650	25	2	92 - 103	K.RTGSIVDVPAGK.A
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	161	553.28	2209.08	553.28	2209.08	4	0.24	13.5	7357	53	3	109 - 129	R.VVDAMGVPIDGKGALSDHEQR.R	Oxidation: 5
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	162	553.28	2209.08	553.28	2209.08	4	1.59	13.5	433863	59	3	109 - 129	R.VVDAMGVPIDGKGALSDHEQR.R	Oxidation: 5
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	159	755.44	754.43	755.44	754.43	1	1.25	13.4	596982	17	1	135 - 141	K.APGILER.K
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	346	769.38	1536.74	769.38	1536.74	2	2.43	19.3	14321	34	3	295 - 307	R.EAFPGDVFYLHSR.L
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	32	707.39	706.38	707.38	706.38	1	2.93	9.3	18960	41	2	277 - 282	K.QAVAYR.Q
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	227	549.28	2193.09	549.28	2193.08	4	2.48	15.6	15814	81	1	109 - 129	R.VVDAMGVPIDGKGALSDHEQR.R
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	314	574.28	1719.82	574.28	1719.81	3	3.03	18.3	29749	75	2	262 - 276	R.DNGMHALIIYDDLSK.Q	Oxidation: 4
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	14	767.39	766.39	767.39	766.39	1	1.52	8.6	7907	29	1	464 - 469	R.ISQYEK.A
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	1	506.74	1011.47	506.74	1011.47	2	-1.56	8.1	10575	75	3	121 - 129	K.GALSDHEQR.R
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	276	513.80	1025.59	513.80	1025.59	2	1.13	17.1	5234	50	4	154 - 163	K.AVDSLVPIGR.G
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	3	506.74	1011.47	506.74	1011.47	2	1.30	8.1	207592	80	3	121 - 129	K.GALSDHEQR.R
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	210	892.49	891.48	892.49	891.48	1	3.16	15	180104	26	1	395 - 401	K.LELAQYR.E
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	287	656.38	1966.12	656.38	1966.11	3	4.23	17.5	202900	67	4	427 - 443	R.LTEVLKQPQYAPLPIEK.Q
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	355	819.01	1636.00	819.00	1635.99	2	3.21	19.6	22281	59	2	470 - 484	K.AILNSVKPELLQALK.G
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	15	457.58	1369.70	457.57	1369.70	3	0.88	8.7	4197	57	2	142 - 153	R.KSVHEPMQTGLK.A	Oxidation: 7
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	357	819.01	1636.00	819.00	1635.99	2	5.39	19.6	11654	67	2	470 - 484	K.AILNSVKPELLQALK.G
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	338	513.25	1536.74	513.25	1536.74	3	2.82	19.1	263788	72	3	295 - 307	R.EAFPGDVFYLHSR.L
712	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	79	415.20	1242.59	414.88	1241.61	3	788.84	10.8	13176	21	3	143 - 153	K.SVHEPMQTGLK.A	Oxidation: 6
781	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	42	414.87	1241.59	414.88	1241.61	3	-11.88	10.1	108591	34	3	143 - 153	K.SVHEPMQTGLK.A	Oxidation: 6
781	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	142	608.81	1215.60	608.82	1215.62	2	-10.89	13.8	5338	78	3	109 - 120	R.VVDAMGVPIDGK.G	Oxidation: 5
781	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	310	513.25	1536.72	513.25	1536.74	3	-8.52	19.1	21944	68	2	295 - 307	R.EAFPGDVFYLHSR.L
781	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	192	438.75	875.48	438.75	875.49	2	-10.81	15.4	4230	50	2	283 - 289	R.QMSLLLR.R	Oxidation: 2
781	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	45	414.87	1241.60	414.88	1241.61	3	-9.83	10.3	95808	16	3	143 - 153	K.SVHEPMQTGLK.A	Oxidation: 6
781	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	314	513.25	1536.72	513.25	1536.74	3	-8.30	19.2	20266	62	2	295 - 307	R.EAFPGDVFYLHSR.L
781	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	225	555.79	1109.57	555.80	1109.58	2	-7.59	16.4	18576	41	1	492 - 500	R.KMELDAFLK.E	Oxidation: 2
781	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	1	506.74	1011.46	506.74	1011.47	2	-10.27	8.3	4143	52	3	121 - 129	K.GALSDHEQR.R
781	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	247	513.80	1025.58	513.80	1025.59	2	-6.24	17.1	7420	51	2	154 - 163	K.AVDSLVPIGR.G
781	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	334	568.94	1703.81	568.95	1703.82	3	-6.87	19.8	41520	30	1	262 - 276	R.DNGMHALIIYDDLSK.Q
781	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	146	608.81	1215.61	608.82	1215.62	2	-9.56	13.9	3619	95	3	109 - 120	R.VVDAMGVPIDGK.G	Oxidation: 5
781	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	230	642.35	1282.68	642.35	1282.69	2	-7.73	16.5	5989	35	1	433 - 443	K.QPQYAPLPIEK.Q
781	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	321	665.88	1329.74	665.88	1329.75	2	-6.12	19.4	9670	85	1	178 - 189	K.TTIAIDTILNQK.Q
781	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	15	457.57	1369.69	457.57	1369.70	3	-10.53	8.8	3480	44	2	142 - 153	R.KSVHEPMQTGLK.A	Oxidation: 7
781	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	301	614.64	1840.91	614.65	1840.92	3	-5.11	18.8	130471	38	1	18 - 32	R.IRNFYANFQVDEIGR.V
781	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	264	656.37	1966.10	656.38	1966.11	3	-5.88	17.6	3383	47	1	427 - 443	R.LTEVLKQPQYAPLPIEK.Q
781	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	149	522.29	1042.56	522.29	1042.57	2	-9.96	14	18649	83	3	93 - 103	R.TGSIVDVPAGK.A
781	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	227	600.81	1199.61	600.82	1199.62	2	-7.86	16.4	5478	45	1	109 - 120	R.VVDAMGVPIDGK.G
781	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	183	446.74	891.47	446.75	891.48	2	-10.55	15.1	16170	59	1	395 - 401	K.LELAQYR.E
781	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	18	457.57	1369.69	457.57	1369.70	3	-9.72	8.9	3866	19	2	142 - 153	R.KSVHEPMQTGLK.A	Oxidation: 7
781	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	2	506.74	1011.46	506.74	1011.47	2	-9.65	8.3	167753	54	3	121 - 129	K.GALSDHEQR.R
781	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	147	522.28	1042.55	522.29	1042.57	2	-12.74	13.9	11778	78	3	93 - 103	R.TGSIVDVPAGK.A
781	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	315	625.82	1249.62	625.82	1249.63	2	-6.20	19.2	242784	99	1	7 - 17	R.AAELTNLFESR.I
781	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	113	702.43	701.43	702.44	701.43	1	-9.01	12.9	5535	34	1	427 - 432	R.LTEVLK.Q
781	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	4	506.74	1011.46	506.74	1011.47	2	-9.42	8.4	4239	48	3	121 - 129	K.GALSDHEQR.R
781	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	330	546.33	1635.98	546.34	1635.99	3	-7.99	19.7	82526	73	1	470 - 484	K.AILNSVKPELLQALK.G
781	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	249	513.80	1025.58	513.80	1025.59	2	-8.97	17.1	3694	30	2	154 - 163	K.AVDSLVPIGR.G
781	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	11	408.73	815.44	408.73	815.45	2	-15.25	8.6	8571	21	1	86 - 92	K.EGDLVKR.T
781	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	143	608.81	1215.61	608.82	1215.62	2	-9.67	13.8	11803	84	3	109 - 120	R.VVDAMGVPIDGK.G	Oxidation: 5
781	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	197	438.75	875.48	438.75	875.49	2	-10.51	15.5	8245	42	2	283 - 289	R.QMSLLLR.R	Oxidation: 2
781	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	152	522.29	1042.56	522.29	1042.57	2	-9.41	14.1	19695	78	3	93 - 103	R.TGSIVDVPAGK.A
781	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	44	621.80	1241.59	621.81	1241.61	2	-12.80	10.2	9502	15	1	143 - 153	K.SVHEPMQTGLK.A	Oxidation: 6
781	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	43	414.87	1241.59	414.88	1241.61	3	-12.79	10.2	50541	36	3	143 - 153	K.SVHEPMQTGLK.A	Oxidation: 6
878	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	302	513.79	1025.57	513.80	1025.59	2	-12.47	16.6	4389	40	2	154 - 163	K.AVDSLVPIGR.G
878	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	331	656.37	1966.09	656.38	1966.11	3	-11.46	17.2	61337	26	1	427 - 443	R.LTEVLKQPQYAPLPIEK.Q
878	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	217	446.74	891.47	446.75	891.48	2	-12.25	14.7	3793	43	2	395 - 401	K.LELAQYR.E
878	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	26	414.87	1241.60	414.88	1241.61	3	-9.61	9.8	192262	32	3	143 - 153	K.SVHEPMQTGLK.A	Oxidation: 6
878	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	299	513.79	1025.57	513.80	1025.59	2	-13.58	16.5	3725	43	2	154 - 163	K.AVDSLVPIGR.G
878	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	412	665.88	1329.74	665.88	1329.75	2	-10.12	19.1	25651	82	2	178 - 189	K.TTIAIDTILNQK.Q
878	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	158	608.81	1215.61	608.82	1215.62	2	-8.77	13.3	17892	77	3	109 - 120	R.VVDAMGVPIDGK.G	Oxidation: 5
878	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	161	608.81	1215.61	608.82	1215.62	2	-8.42	13.4	324231	66	3	109 - 120	R.VVDAMGVPIDGK.G	Oxidation: 5
878	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	164	522.29	1042.56	522.29	1042.57	2	-9.20	13.5	3801	79	3	93 - 103	R.TGSIVDVPAGK.A
878	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	227	438.75	875.48	438.75	875.49	2	-12.86	14.9	3765	36	1	283 - 289	R.QMSLLLR.R	Oxidation: 2
878	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	29	414.87	1241.59	414.88	1241.61	3	-11.03	9.9	205803	37	3	143 - 153	K.SVHEPMQTGLK.A	Oxidation: 6
878	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	28	621.80	1241.60	621.81	1241.61	2	-9.92	9.9	492163	28	1	143 - 153	K.SVHEPMQTGLK.A	Oxidation: 6
878	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	27	414.87	1241.60	414.88	1241.61	3	-9.92	9.9	107992	36	3	143 - 153	K.SVHEPMQTGLK.A	Oxidation: 6
878	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	2	457.57	1369.69	457.57	1369.70	3	-12.02	8.5	33321	40	3	142 - 153	R.KSVHEPMQTGLK.A	Oxidation: 7
878	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	410	665.87	1329.73	665.88	1329.75	2	-11.87	19.1	49651	69	2	178 - 189	K.TTIAIDTILNQK.Q
878	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	4	457.57	1369.69	457.57	1369.70	3	-8.80	8.6	210826	17	3	142 - 153	R.KSVHEPMQTGLK.A	Oxidation: 7
878	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	406	625.82	1249.62	625.82	1249.63	2	-9.36	19	17814	90	2	7 - 17	R.AAELTNLFESR.I
878	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	167	522.29	1042.56	522.29	1042.57	2	-9.27	13.5	6443	78	3	93 - 103	R.TGSIVDVPAGK.A
878	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	430	546.33	1635.97	546.34	1635.99	3	-10.89	19.5	31665	30	1	470 - 484	K.AILNSVKPELLQALK.G
878	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	409	625.82	1249.62	625.82	1249.63	2	-10.39	19	17793	59	2	7 - 17	R.AAELTNLFESR.I
878	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	169	522.29	1042.56	522.29	1042.57	2	-8.07	13.6	39149	65	3	93 - 103	R.TGSIVDVPAGK.A
878	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	214	446.74	891.47	446.75	891.48	2	-10.84	14.6	4070	39	2	395 - 401	K.LELAQYR.E
878	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	165	608.81	1215.61	608.82	1215.62	2	-8.70	13.5	15700	63	3	109 - 120	R.VVDAMGVPIDGK.G	Oxidation: 5
878	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	1	457.57	1369.69	457.57	1369.70	3	-10.29	8.5	53040	17	3	142 - 153	R.KSVHEPMQTGLK.A	Oxidation: 7
933	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	412	665.88	1329.75	665.88	1329.75	2	0.64	19.3	9537	65	3	178 - 189	K.TTIAIDTILNQK.Q
933	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	422	819.00	1635.99	819.00	1635.99	2	-4.32	19.6	13081	16	1	470 - 484	K.AILNSVKPELLQALK.G
933	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	414	665.88	1329.75	665.88	1329.75	2	0.28	19.3	28738	60	3	178 - 189	K.TTIAIDTILNQK.Q
933	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	225	438.75	875.49	438.75	875.49	2	-2.76	15	11473	42	1	283 - 289	R.QMSLLLR.R	Oxidation: 2
933	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	13	414.88	1241.61	414.88	1241.61	3	2.32	9.9	19020	32	4	143 - 153	K.SVHEPMQTGLK.A	Oxidation: 6
933	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	275	642.35	1282.69	642.35	1282.69	2	2.17	16.1	7410	44	3	433 - 443	K.QPQYAPLPIEK.Q
933	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	298	513.80	1025.59	513.80	1025.59	2	2.36	16.7	29209	44	2	154 - 163	K.AVDSLVPIGR.G
933	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	2	457.58	1369.71	457.57	1369.70	3	5.16	8.7	22352	33	2	142 - 153	R.KSVHEPMQTGLK.A	Oxidation: 7
933	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	421	546.34	1635.99	546.34	1635.99	3	-4.31	19.6	5015	26	2	470 - 484	K.AILNSVKPELLQALK.G
933	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	14	414.88	1241.61	414.88	1241.61	3	1.55	9.9	10505	45	4	143 - 153	K.SVHEPMQTGLK.A	Oxidation: 6
933	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	15	414.88	1241.61	414.88	1241.61	3	0.68	9.9	32896	31	4	143 - 153	K.SVHEPMQTGLK.A	Oxidation: 6
933	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	16	414.88	1241.61	414.88	1241.61	3	1.79	10	14797	41	4	143 - 153	K.SVHEPMQTGLK.A	Oxidation: 6
933	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	276	480.29	1437.85	480.29	1437.84	3	2.67	16.2	5585	43	1	363 - 376	R.GIRPAINVGLSVSR.V
933	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	397	513.25	1536.74	513.25	1536.74	3	3.41	18.9	18440	43	1	295 - 307	R.EAFPGDVFYLHSR.L
933	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	214	446.75	891.48	446.75	891.48	2	0.24	14.8	9205	55	2	395 - 401	K.LELAQYR.E
933	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	270	642.35	1282.69	642.35	1282.69	2	0.13	16	4248	26	3	433 - 443	K.QPQYAPLPIEK.Q
933	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	326	656.38	1966.12	656.38	1966.11	3	0.73	17.3	26941	21	1	427 - 443	R.LTEVLKQPQYAPLPIEK.Q
933	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	1	457.58	1369.71	457.57	1369.70	3	2.39	8.6	89299	19	2	142 - 153	R.KSVHEPMQTGLK.A	Oxidation: 7
933	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	424	546.34	1635.99	546.34	1635.99	3	0.57	19.7	12276	31	2	470 - 484	K.AILNSVKPELLQALK.G
933	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	217	446.75	891.48	446.75	891.48	2	-0.48	14.8	29158	46	2	395 - 401	K.LELAQYR.E
933	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	294	513.80	1025.59	513.80	1025.59	2	1.13	16.6	25050	43	2	154 - 163	K.AVDSLVPIGR.G
933	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	416	665.88	1329.75	665.88	1329.75	2	0.15	19.4	4386	53	3	178 - 189	K.TTIAIDTILNQK.Q
933	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	273	642.35	1282.69	642.35	1282.69	2	2.16	16.1	32533	31	3	433 - 443	K.QPQYAPLPIEK.Q
986	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	292	656.39	1966.14	656.38	1966.11	3	13.47	17.4	5623	29	3	427 - 443	R.LTEVLKQPQYAPLPIEK.Q
986	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	243	555.81	1109.60	555.80	1109.58	2	19.90	16.3	26900	48	1	492 - 500	R.KMELDAFLK.E	Oxidation: 2
986	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	13	414.88	1241.63	414.88	1241.61	3	15.17	10.2	16741	33	4	143 - 153	K.SVHEPMQTGLK.A	Oxidation: 6
986	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	376	665.89	1329.77	665.88	1329.75	2	18.36	19.3	5471	87	1	178 - 189	K.TTIAIDTILNQK.Q
986	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	129	1043.59	1042.58	1043.57	1042.57	1	16.75	13.7	43075	25	2	93 - 103	R.TGSIVDVPAGK.A
986	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	124	608.83	1215.64	608.82	1215.62	2	17.04	13.6	6714	65	3	109 - 120	R.VVDAMGVPIDGK.G	Oxidation: 5
986	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	287	656.39	1966.14	656.38	1966.11	3	15.48	17.3	74787	64	3	427 - 443	R.LTEVLKQPQYAPLPIEK.Q
986	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	266	513.81	1025.60	513.80	1025.59	2	16.68	16.8	5962	33	3	154 - 163	K.AVDSLVPIGR.G
986	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	11	621.82	1241.62	621.81	1241.61	2	14.09	10.1	3476	34	2	143 - 153	K.SVHEPMQTGLK.A	Oxidation: 6
986	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	8	414.88	1241.63	414.88	1241.61	3	14.64	10.1	11973	35	4	143 - 153	K.SVHEPMQTGLK.A	Oxidation: 6
986	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	389	546.35	1636.02	546.34	1635.99	3	16.61	19.6	20936	33	4	470 - 484	K.AILNSVKPELLQALK.G
986	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	1	457.58	1369.72	457.57	1369.70	3	16.15	8.7	25271	31	4	142 - 153	R.KSVHEPMQTGLK.A	Oxidation: 7
986	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	285	656.39	1966.15	656.38	1966.11	3	17.67	17.2	24919	63	3	427 - 443	R.LTEVLKQPQYAPLPIEK.Q
986	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	198	438.76	875.50	438.75	875.49	2	14.12	15.3	24173	35	3	283 - 289	R.QMSLLLR.R	Oxidation: 2
986	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	364	769.39	1536.77	769.38	1536.74	2	19.37	19	11853	70	1	295 - 307	R.EAFPGDVFYLHSR.L
986	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	392	819.02	1636.02	819.00	1635.99	2	14.35	19.7	5335	77	2	470 - 484	K.AILNSVKPELLQALK.G
986	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	263	513.81	1025.61	513.80	1025.59	2	17.75	16.7	31186	47	3	154 - 163	K.AVDSLVPIGR.G
986	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	371	625.83	1249.65	625.82	1249.63	2	19.64	19.2	17232	77	1	7 - 17	R.AAELTNLFESR.I
986	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	443	546.68	1637.01	546.34	1635.99	3	618.89	20.8	26335	17	4	470 - 484	K.AILNSVKPELLQALK.G
986	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	185	892.50	891.50	892.49	891.48	1	16.49	15	30934	25	1	395 - 401	K.LELAQYR.E
986	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	359	513.26	1536.77	513.25	1536.74	3	19.67	18.9	14615	41	3	295 - 307	R.EAFPGDVFYLHSR.L
986	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	2	457.58	1369.72	457.57	1369.70	3	15.26	8.7	11523	29	4	142 - 153	R.KSVHEPMQTGLK.A	Oxidation: 7
986	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	120	608.83	1215.64	608.82	1215.62	2	19.96	13.5	48390	43	3	109 - 120	R.VVDAMGVPIDGK.G	Oxidation: 5
986	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	10	414.88	1241.62	414.88	1241.61	3	14.08	10.1	10100	38	4	143 - 153	K.SVHEPMQTGLK.A	Oxidation: 6
986	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	3	457.58	1369.72	457.57	1369.70	3	14.86	8.7	22146	33	4	142 - 153	R.KSVHEPMQTGLK.A	Oxidation: 7
986	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	7	414.88	1241.63	414.88	1241.61	3	18.21	10	20438	26	4	143 - 153	K.SVHEPMQTGLK.A	Oxidation: 6
986	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	131	1043.59	1042.58	1043.57	1042.57	1	17.34	13.7	6245	36	2	93 - 103	R.TGSIVDVPAGK.A
986	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	261	1026.61	1025.61	1026.59	1025.59	1	17.87	16.7	56102	29	1	154 - 163	K.AVDSLVPIGR.G
986	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	133	522.30	1042.58	522.29	1042.57	2	17.40	13.8	16488	72	3	93 - 103	R.TGSIVDVPAGK.A
986	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	196	438.76	875.50	438.75	875.49	2	13.26	15.2	5562	32	3	283 - 289	R.QMSLLLR.R	Oxidation: 2
986	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	9	621.82	1241.63	621.81	1241.61	2	14.65	10.1	11853	17	2	143 - 153	K.SVHEPMQTGLK.A	Oxidation: 6
986	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	193	438.76	875.50	438.75	875.49	2	12.26	15.1	41033	38	3	283 - 289	R.QMSLLLR.R	Oxidation: 2
986	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	186	446.76	891.50	446.75	891.48	2	16.84	15	30354	49	3	395 - 401	K.LELAQYR.E
986	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	260	513.81	1025.61	513.80	1025.59	2	17.85	16.7	28817	53	3	154 - 163	K.AVDSLVPIGR.G
986	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	122	608.83	1215.64	608.82	1215.62	2	16.59	13.5	5542	58	3	109 - 120	R.VVDAMGVPIDGK.G	Oxidation: 5
986	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	394	546.35	1636.02	546.34	1635.99	3	19.11	19.7	3711	51	4	470 - 484	K.AILNSVKPELLQALK.G
986	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	130	522.30	1042.58	522.29	1042.57	2	17.32	13.7	29255	68	3	93 - 103	R.TGSIVDVPAGK.A
986	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	183	446.76	891.50	446.75	891.48	2	16.46	14.9	18282	55	3	395 - 401	K.LELAQYR.E
986	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	391	546.35	1636.02	546.34	1635.99	3	14.34	19.6	4824	52	4	470 - 484	K.AILNSVKPELLQALK.G
986	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	362	513.26	1536.77	513.25	1536.74	3	19.34	19	20438	59	3	295 - 307	R.EAFPGDVFYLHSR.L
986	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	54	409.55	1225.63	409.54	1225.61	3	17.53	11.9	19836	32	1	143 - 153	K.SVHEPMQTGLK.A
986	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	181	446.75	891.49	446.75	891.48	2	15.19	14.9	11467	43	3	395 - 401	K.LELAQYR.E
986	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	127	522.30	1042.58	522.29	1042.57	2	16.73	13.6	11993	72	3	93 - 103	R.TGSIVDVPAGK.A
986	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	366	513.26	1536.76	513.25	1536.74	3	16.97	19.1	3476	53	3	295 - 307	R.EAFPGDVFYLHSR.L
986	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	4	457.58	1369.72	457.57	1369.70	3	14.41	8.8	14615	34	4	142 - 153	R.KSVHEPMQTGLK.A	Oxidation: 7
986	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	326	491.76	981.50	491.75	981.48	2	16.89	18.2	6418	23	1	493 - 500	K.MELDAFLK.E	Oxidation: 1
986	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	395	819.02	1636.02	819.00	1635.99	2	19.14	19.7	17844	40	2	470 - 484	K.AILNSVKPELLQALK.G
1105	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	268	656.39	1966.14	656.38	1966.11	3	15.57	17.2	27988	65	2	427 - 443	R.LTEVLKQPQYAPLPIEK.Q
1105	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	329	625.83	1249.65	625.82	1249.63	2	15.02	19.1	4833	83	3	7 - 17	R.AAELTNLFESR.I
1105	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	137	1043.59	1042.58	1043.57	1042.57	1	16.45	13.6	6332	29	1	93 - 103	R.TGSIVDVPAGK.A
1105	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	10	621.82	1241.62	621.81	1241.61	2	13.01	10	15518	28	2	143 - 153	K.SVHEPMQTGLK.A	Oxidation: 6
1105	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	335	665.89	1329.77	665.88	1329.75	2	14.90	19.3	12774	85	2	178 - 189	K.TTIAIDTILNQK.Q
1105	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	144	553.29	2209.11	553.28	2209.08	4	15.65	13.8	8167	23	2	109 - 129	R.VVDAMGVPIDGKGALSDHEQR.R	Oxidation: 5
1105	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	225	480.29	1437.86	480.29	1437.84	3	12.95	16	27363	52	1	363 - 376	R.GIRPAINVGLSVSR.V
1105	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	338	665.89	1329.77	665.88	1329.75	2	12.84	19.3	6676	76	2	178 - 189	K.TTIAIDTILNQK.Q
1105	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	3	457.58	1369.72	457.57	1369.70	3	11.28	8.7	28215	45	4	142 - 153	R.KSVHEPMQTGLK.A	Oxidation: 7
1105	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	5	457.58	1369.72	457.57	1369.70	3	10.73	8.8	10866	18	4	142 - 153	R.KSVHEPMQTGLK.A	Oxidation: 7
1105	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	29	442.28	882.54	442.27	882.53	2	9.89	11.1	16627	33	3	135 - 142	K.APGILERK.S
1105	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	314	614.66	1840.95	614.65	1840.92	3	15.19	18.8	22678	48	2	18 - 32	R.IRNFYANFQVDEIGR.V
1105	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	141	553.29	2209.11	553.28	2209.08	4	15.69	13.7	8031	33	2	109 - 129	R.VVDAMGVPIDGKGALSDHEQR.R	Oxidation: 5
1105	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	132	522.30	1042.58	522.29	1042.57	2	14.79	13.5	16645	73	3	93 - 103	R.TGSIVDVPAGK.A
1105	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	11	621.82	1241.62	621.81	1241.61	2	12.74	10	34686	19	2	143 - 153	K.SVHEPMQTGLK.A	Oxidation: 6
1105	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	352	546.34	1636.01	546.34	1635.99	3	12.34	19.7	5086	26	3	470 - 484	K.AILNSVKPELLQALK.G
1105	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	348	819.01	1636.01	819.00	1635.99	2	9.28	19.6	10374	40	1	470 - 484	K.AILNSVKPELLQALK.G
1105	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	192	438.76	875.50	438.75	875.49	2	6.47	15	17497	34	3	283 - 289	R.QMSLLLR.R	Oxidation: 2
1105	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	322	513.26	1536.75	513.25	1536.74	3	10.59	19	11422	50	2	295 - 307	R.EAFPGDVFYLHSR.L
1105	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	332	625.83	1249.65	625.82	1249.63	2	14.78	19.2	9654	70	3	7 - 17	R.AAELTNLFESR.I
1105	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	9	414.88	1241.62	414.88	1241.61	3	12.64	10	43776	32	2	143 - 153	K.SVHEPMQTGLK.A	Oxidation: 6
1105	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	138	522.30	1042.58	522.29	1042.57	2	15.96	13.7	5007	72	3	93 - 103	R.TGSIVDVPAGK.A
1105	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	31	442.28	882.54	442.27	882.53	2	11.06	11.2	12745	55	3	135 - 142	K.APGILERK.S
1105	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	195	438.76	875.50	438.75	875.49	2	10.68	15	534	32	3	283 - 289	R.QMSLLLR.R	Oxidation: 2
1105	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	349	546.34	1636.01	546.34	1635.99	3	11.99	19.7	141387	33	3	470 - 484	K.AILNSVKPELLQALK.G
1105	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	346	546.34	1636.01	546.34	1635.99	3	9.28	19.6	4631	29	3	470 - 484	K.AILNSVKPELLQALK.G
1105	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	197	438.76	875.50	438.75	875.49	2	10.61	15.1	9202	26	3	283 - 289	R.QMSLLLR.R	Oxidation: 2
1105	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	12	414.88	1241.62	414.88	1241.61	3	13.50	10.1	26428	35	2	143 - 153	K.SVHEPMQTGLK.A	Oxidation: 6
1105	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	247	513.81	1025.60	513.80	1025.59	2	13.26	16.6	47548	43	3	154 - 163	K.AVDSLVPIGR.G
1105	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	135	522.30	1042.58	522.29	1042.57	2	16.44	13.6	3986	78	3	93 - 103	R.TGSIVDVPAGK.A
1105	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	253	513.81	1025.60	513.80	1025.59	2	13.30	16.7	18677	45	3	154 - 163	K.AVDSLVPIGR.G
1105	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	271	656.39	1966.14	656.38	1966.11	3	15.37	17.3	10437	62	2	427 - 443	R.LTEVLKQPQYAPLPIEK.Q
1105	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	4	457.58	1369.72	457.57	1369.70	3	13.95	8.8	6522	32	4	142 - 153	R.KSVHEPMQTGLK.A	Oxidation: 7
1105	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	35	442.28	882.54	442.27	882.53	2	13.21	11.2	4708	18	3	135 - 142	K.APGILERK.S
1105	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	316	614.66	1840.95	614.65	1840.92	3	16.67	18.8	6768	42	2	18 - 32	R.IRNFYANFQVDEIGR.V
1105	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	2	457.58	1369.72	457.57	1369.70	3	10.95	8.7	42841	34	4	142 - 153	R.KSVHEPMQTGLK.A	Oxidation: 7
1105	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	250	513.81	1025.60	513.80	1025.59	2	13.43	16.7	15522	43	3	154 - 163	K.AVDSLVPIGR.G
1105	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	320	513.26	1536.76	513.25	1536.74	3	14.57	18.9	37866	73	2	295 - 307	R.EAFPGDVFYLHSR.L
1105	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	328	625.83	1249.65	625.82	1249.63	2	16.06	19.1	5072	76	3	7 - 17	R.AAELTNLFESR.I
1159	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	420	819.01	1636.01	819.00	1635.99	2	11.28	19.6	52463	52	2	470 - 484	K.AILNSVKPELLQALK.G
1159	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	162	1043.59	1042.58	1043.57	1042.57	1	14.38	13.6	5063	29	2	93 - 103	R.TGSIVDVPAGK.A
1159	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	2	457.58	1369.72	457.57	1369.70	3	13.23	8.7	24485	39	4	142 - 153	R.KSVHEPMQTGLK.A	Oxidation: 7
1159	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	385	513.26	1536.76	513.25	1536.74	3	14.32	18.7	26362	33	3	295 - 307	R.EAFPGDVFYLHSR.L
1159	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	16	621.82	1241.62	621.81	1241.61	2	12.08	10	5347	25	3	143 - 153	K.SVHEPMQTGLK.A	Oxidation: 6
1159	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	225	438.76	875.50	438.75	875.49	2	9.25	15	16828	28	2	283 - 289	R.QMSLLLR.R	Oxidation: 2
1159	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	157	522.30	1042.58	522.29	1042.57	2	14.72	13.5	92401	66	3	93 - 103	R.TGSIVDVPAGK.A
1159	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	5	457.58	1369.72	457.57	1369.70	3	10.67	8.7	7191	34	4	142 - 153	R.KSVHEPMQTGLK.A	Oxidation: 7
1159	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	292	1026.61	1025.60	1026.59	1025.59	1	13.20	16.6	8535	28	1	154 - 163	K.AVDSLVPIGR.G
1159	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	152	608.82	1215.63	608.82	1215.62	2	10.83	13.4	57134	56	3	109 - 120	R.VVDAMGVPIDGK.G	Oxidation: 5
1159	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	423	819.01	1636.01	819.00	1635.99	2	10.55	19.7	18595	26	2	470 - 484	K.AILNSVKPELLQALK.G
1159	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	15	621.82	1241.63	621.81	1241.61	2	14.43	9.9	25855	47	3	143 - 153	K.SVHEPMQTGLK.A	Oxidation: 6
1159	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	218	446.75	891.49	446.75	891.48	2	12.61	14.8	22958	54	3	395 - 401	K.LELAQYR.E
1159	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	386	513.26	1536.75	513.25	1536.74	3	11.88	18.7	14906	42	3	295 - 307	R.EAFPGDVFYLHSR.L
1159	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	291	513.81	1025.60	513.80	1025.59	2	13.18	16.6	6689	66	3	154 - 163	K.AVDSLVPIGR.G
1159	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	419	546.34	1636.01	546.34	1635.99	3	11.28	19.6	89491	41	3	470 - 484	K.AILNSVKPELLQALK.G
1159	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	226	438.76	875.50	438.75	875.49	2	8.38	15	793	34	2	283 - 289	R.QMSLLLR.R	Oxidation: 2
1159	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	418	786.89	1571.76	786.88	1571.74	2	14.05	19.5	28069	67	1	20 - 32	R.NFYANFQVDEIGR.V
1159	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	270	642.36	1282.71	642.35	1282.69	2	14.84	16.1	7464	41	3	433 - 443	K.QPQYAPLPIEK.Q
1159	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	212	446.75	891.49	446.75	891.48	2	5.41	14.7	119032	45	3	395 - 401	K.LELAQYR.E
1159	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	401	625.83	1249.65	625.82	1249.63	2	13.95	19.1	5420	90	3	7 - 17	R.AAELTNLFESR.I
1159	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	267	642.36	1282.71	642.35	1282.69	2	11.53	16	24867	33	3	433 - 443	K.QPQYAPLPIEK.Q
1159	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	154	608.82	1215.63	608.82	1215.62	2	14.70	13.4	131060	60	3	109 - 120	R.VVDAMGVPIDGK.G	Oxidation: 5
1159	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	404	665.89	1329.77	665.88	1329.75	2	11.52	19.1	10954	94	3	178 - 189	K.TTIAIDTILNQK.Q
1159	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	274	555.80	1109.60	555.80	1109.58	2	14.54	16.2	5382	39	3	492 - 500	R.KMELDAFLK.E	Oxidation: 2
1159	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	422	546.34	1636.01	546.34	1635.99	3	10.55	19.7	90009	50	3	470 - 484	K.AILNSVKPELLQALK.G
1159	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	269	555.80	1109.60	555.80	1109.58	2	14.36	16.1	16253	49	3	492 - 500	R.KMELDAFLK.E	Oxidation: 2
1159	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	398	625.83	1249.65	625.82	1249.63	2	13.33	19	18423	89	3	7 - 17	R.AAELTNLFESR.I
1159	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	318	656.39	1966.14	656.38	1966.11	3	15.17	17.2	69987	61	2	427 - 443	R.LTEVLKQPQYAPLPIEK.Q
1159	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	416	546.34	1636.01	546.34	1635.99	3	8.13	19.5	121083	32	3	470 - 484	K.AILNSVKPELLQALK.G
1159	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	315	656.39	1966.14	656.38	1966.11	3	15.74	17.1	31716	81	2	427 - 443	R.LTEVLKQPQYAPLPIEK.Q
1159	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	468	1189.12	2376.23	1189.11	2376.20	2	12.97	21.4	26275	51	1	63 - 85	K.GMALNLENENVGIVVFGGDTAIK.E	Oxidation: 2
1159	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	215	446.75	891.49	446.75	891.48	2	12.30	14.8	74077	54	3	395 - 401	K.LELAQYR.E
1159	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	260	600.83	1199.64	600.82	1199.62	2	12.96	15.9	25986	35	1	109 - 120	R.VVDAMGVPIDGK.G
1159	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	18	414.88	1241.63	414.88	1241.61	3	15.77	10	13914	35	1	143 - 153	K.SVHEPMQTGLK.A	Oxidation: 6
1159	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	160	522.30	1042.58	522.29	1042.57	2	14.37	13.5	13220	71	3	93 - 103	R.TGSIVDVPAGK.A
1159	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	287	513.80	1025.60	513.80	1025.59	2	7.94	16.5	22274	53	3	154 - 163	K.AVDSLVPIGR.G
1159	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	158	1043.59	1042.58	1043.57	1042.57	1	14.73	13.5	12915	39	2	93 - 103	R.TGSIVDVPAGK.A
1159	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	388	614.66	1840.95	614.65	1840.92	3	15.11	18.8	17221	29	1	18 - 32	R.IRNFYANFQVDEIGR.V
1159	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	1	457.58	1369.72	457.57	1369.70	3	14.69	8.6	4607	28	4	142 - 153	R.KSVHEPMQTGLK.A	Oxidation: 7
1159	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	394	769.38	1536.75	769.38	1536.74	2	12.00	18.9	74110	58	1	295 - 307	R.EAFPGDVFYLHSR.L
1159	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	407	665.89	1329.77	665.88	1329.75	2	11.49	19.2	23386	95	3	178 - 189	K.TTIAIDTILNQK.Q
1159	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	150	608.82	1215.62	608.82	1215.62	2	3.14	13.3	36610	57	3	109 - 120	R.VVDAMGVPIDGK.G	Oxidation: 5
1159	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	405	625.83	1249.65	625.82	1249.63	2	12.82	19.2	7438	80	3	7 - 17	R.AAELTNLFESR.I
1159	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	155	522.30	1042.58	522.29	1042.57	2	14.72	13.4	19706	68	3	93 - 103	R.TGSIVDVPAGK.A
1159	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	107	702.45	701.44	702.44	701.43	1	7.98	12.3	6889	16	2	427 - 432	R.LTEVLK.Q
1159	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	390	513.26	1536.75	513.25	1536.74	3	12.11	18.8	7804	53	3	295 - 307	R.EAFPGDVFYLHSR.L
1159	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	3	457.58	1369.72	457.57	1369.70	3	11.11	8.7	5186	41	4	142 - 153	R.KSVHEPMQTGLK.A	Oxidation: 7
1159	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	367	547.81	1093.60	547.80	1093.58	2	10.79	18.3	7079	21	1	492 - 500	R.KMELDAFLK.E
1159	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	288	513.81	1025.60	513.80	1025.59	2	12.61	16.5	132562	53	3	154 - 163	K.AVDSLVPIGR.G
1159	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	271	555.80	1109.59	555.80	1109.58	2	12.58	16.2	17754	32	3	492 - 500	R.KMELDAFLK.E	Oxidation: 2
1159	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	272	642.36	1282.71	642.35	1282.69	2	13.08	16.2	6268	32	3	433 - 443	K.QPQYAPLPIEK.Q
1159	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	105	702.45	701.44	702.44	701.43	1	9.85	12.3	8012	32	2	427 - 432	R.LTEVLK.Q
1159	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	411	665.89	1329.77	665.88	1329.75	2	11.97	19.3	8840	72	3	178 - 189	K.TTIAIDTILNQK.Q
1159	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	17	621.82	1241.62	621.81	1241.61	2	11.31	10	12916	24	3	143 - 153	K.SVHEPMQTGLK.A	Oxidation: 6
1218	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	3	685.86	1369.71	685.86	1369.70	2	5.21	8.6	32806	19	1	142 - 153	R.KSVHEPMQTGLK.A	Oxidation: 7
1218	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	21	414.88	1241.61	414.88	1241.61	3	4.18	9.8	47646	37	3	143 - 153	K.SVHEPMQTGLK.A	Oxidation: 6
1218	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	393	513.26	1536.75	513.25	1536.74	3	6.48	18.6	64294	53	3	295 - 307	R.EAFPGDVFYLHSR.L
1218	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	299	513.80	1025.59	513.80	1025.59	2	7.24	16.5	10146	47	3	154 - 163	K.AVDSLVPIGR.G
1218	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	166	522.29	1042.57	522.29	1042.57	2	7.46	13.4	4282	66	3	93 - 103	R.TGSIVDVPAGK.A
1218	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	404	625.83	1249.64	625.82	1249.63	2	8.33	18.9	35072	78	2	7 - 17	R.AAELTNLFESR.I
1218	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	369	547.80	1093.59	547.80	1093.58	2	4.87	18.1	16281	53	1	492 - 500	R.KMELDAFLK.E
1218	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	2	457.58	1369.71	457.57	1369.70	3	5.21	8.5	30623	41	3	142 - 153	R.KSVHEPMQTGLK.A	Oxidation: 7
1218	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	394	614.65	1840.94	614.65	1840.92	3	8.34	18.6	36776	60	2	18 - 32	R.IRNFYANFQVDEIGR.V
1218	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	4	457.58	1369.71	457.57	1369.70	3	3.59	8.6	103868	42	3	142 - 153	R.KSVHEPMQTGLK.A	Oxidation: 7
1218	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	22	621.81	1241.61	621.81	1241.61	2	4.17	9.9	176367	27	2	143 - 153	K.SVHEPMQTGLK.A	Oxidation: 6
1218	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	428	819.01	1636.00	819.00	1635.99	2	6.18	19.5	9961	41	3	470 - 484	K.AILNSVKPELLQALK.G
1218	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	243	549.28	2193.10	549.28	2193.08	4	6.50	15.1	261779	22	1	109 - 129	R.VVDAMGVPIDGKGALSDHEQR.R
1218	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	27	452.24	1353.71	452.24	1353.71	3	3.10	10	45911	40	4	142 - 153	R.KSVHEPMQTGLK.A
1218	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	157	608.82	1215.62	608.82	1215.62	2	5.54	13.2	59623	58	3	109 - 120	R.VVDAMGVPIDGK.G	Oxidation: 5
1218	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	18	414.88	1241.61	414.88	1241.61	3	4.47	9.8	20305	37	3	143 - 153	K.SVHEPMQTGLK.A	Oxidation: 6
1218	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	25	452.24	1353.71	452.24	1353.71	3	3.30	10	353209	48	4	142 - 153	R.KSVHEPMQTGLK.A
1218	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	424	546.34	1636.00	546.34	1635.99	3	6.65	19.5	48136	58	4	470 - 484	K.AILNSVKPELLQALK.G
1218	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	427	546.34	1636.00	546.34	1635.99	3	6.17	19.5	10361	60	4	470 - 484	K.AILNSVKPELLQALK.G
1218	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	297	1026.60	1025.59	1026.59	1025.59	1	6.78	16.5	61990	16	1	154 - 163	K.AVDSLVPIGR.G
1218	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	161	608.82	1215.63	608.82	1215.62	2	9.10	13.3	21578	65	3	109 - 120	R.VVDAMGVPIDGK.G	Oxidation: 5
1218	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	19	621.81	1241.61	621.81	1241.61	2	4.47	9.8	269374	31	2	143 - 153	K.SVHEPMQTGLK.A	Oxidation: 6
1218	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	227	438.75	875.49	438.75	875.49	2	3.82	14.8	3550	33	3	283 - 289	R.QMSLLLR.R	Oxidation: 2
1218	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	465	546.67	1636.98	546.34	1635.99	3	599.71	20.7	105752	17	4	470 - 484	K.AILNSVKPELLQALK.G
1218	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	215	446.75	891.49	446.75	891.48	2	5.76	14.5	28046	46	2	395 - 401	K.LELAQYR.E
1218	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	163	522.29	1042.57	522.29	1042.57	2	8.40	13.4	3603	66	3	93 - 103	R.TGSIVDVPAGK.A
1218	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	293	513.80	1025.59	513.80	1025.59	2	6.54	16.4	50508	53	3	154 - 163	K.AVDSLVPIGR.G
1218	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	390	513.26	1536.75	513.25	1536.74	3	10.09	18.6	57979	53	3	295 - 307	R.EAFPGDVFYLHSR.L
1218	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	296	513.80	1025.59	513.80	1025.59	2	6.78	16.4	30045	43	3	154 - 163	K.AVDSLVPIGR.G
1218	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	264	600.82	1199.63	600.82	1199.62	2	5.11	15.7	46848	58	2	109 - 120	R.VVDAMGVPIDGK.G
1218	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	55	442.27	882.53	442.27	882.53	2	1.43	10.9	32819	24	1	135 - 142	K.APGILERK.S
1218	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	162	1043.58	1042.58	1043.57	1042.57	1	9.36	13.3	5373	36	2	93 - 103	R.TGSIVDVPAGK.A
1218	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	422	546.34	1635.99	546.34	1635.99	3	1.54	19.4	15480	42	4	470 - 484	K.AILNSVKPELLQALK.G
1218	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	389	614.65	1840.93	614.65	1840.92	3	6.89	18.5	123009	45	2	18 - 32	R.IRNFYANFQVDEIGR.V
1218	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	321	656.38	1966.13	656.38	1966.11	3	8.13	17	16790	73	3	427 - 443	R.LTEVLKQPQYAPLPIEK.Q
1218	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	273	555.80	1109.59	555.80	1109.58	2	5.98	15.9	340042	43	2	492 - 500	R.KMELDAFLK.E	Oxidation: 2
1218	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	324	984.07	1966.13	984.06	1966.11	2	8.60	17.1	23186	34	1	427 - 443	R.LTEVLKQPQYAPLPIEK.Q
1218	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	224	438.75	875.49	438.75	875.49	2	2.59	14.7	4545	36	3	283 - 289	R.QMSLLLR.R	Oxidation: 2
1218	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	28	452.25	1353.71	452.24	1353.71	3	4.44	10.1	536365	41	4	142 - 153	R.KSVHEPMQTGLK.A
1218	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	231	438.75	875.49	438.75	875.49	2	2.66	14.9	261390	40	3	283 - 289	R.QMSLLLR.R	Oxidation: 2
1218	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	24	452.24	1353.71	452.24	1353.71	3	1.37	9.9	29914	16	4	142 - 153	R.KSVHEPMQTGLK.A
1218	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	416	665.89	1329.76	665.88	1329.75	2	8.26	19.2	12868	86	2	178 - 189	K.TTIAIDTILNQK.Q
1218	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	323	656.38	1966.13	656.38	1966.11	3	8.61	17	69667	61	3	427 - 443	R.LTEVLKQPQYAPLPIEK.Q
1218	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	219	446.75	891.49	446.75	891.48	2	5.07	14.6	74945	55	2	395 - 401	K.LELAQYR.E
1218	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	268	600.82	1199.63	600.82	1199.62	2	7.11	15.8	11100	59	2	109 - 120	R.VVDAMGVPIDGK.G
1218	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	315	555.63	1663.88	555.63	1663.87	3	5.35	16.9	77225	27	1	388 - 401	K.QVCGSLKLELAQYR.E	Carbamidomethyl: 3
1218	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	423	819.00	1635.99	819.00	1635.99	2	1.54	19.4	141655	82	3	470 - 484	K.AILNSVKPELLQALK.G
1218	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	277	555.80	1109.59	555.80	1109.58	2	6.14	16	21528	51	2	492 - 500	R.KMELDAFLK.E	Oxidation: 2
1218	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	1	457.58	1369.71	457.57	1369.70	3	6.54	8.5	87343	38	3	142 - 153	R.KSVHEPMQTGLK.A	Oxidation: 7
1218	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	328	656.38	1966.13	656.38	1966.11	3	8.27	17.1	23891	58	3	427 - 443	R.LTEVLKQPQYAPLPIEK.Q
1218	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	164	608.82	1215.63	608.82	1215.62	2	7.48	13.4	5855	60	3	109 - 120	R.VVDAMGVPIDGK.G	Oxidation: 5
1218	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	15	414.88	1241.62	414.88	1241.61	3	8.01	9.7	2820	40	3	143 - 153	K.SVHEPMQTGLK.A	Oxidation: 6
1218	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	271	480.29	1437.85	480.29	1437.84	3	7.96	15.9	47840	48	1	363 - 376	R.GIRPAINVGLSVSR.V
1218	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	165	1043.58	1042.57	1043.57	1042.57	1	8.40	13.4	5244	32	2	93 - 103	R.TGSIVDVPAGK.A
1218	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	407	625.83	1249.64	625.82	1249.63	2	7.83	18.9	12131	80	2	7 - 17	R.AAELTNLFESR.I
1218	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	396	513.26	1536.75	513.25	1536.74	3	6.81	18.7	22191	53	3	295 - 307	R.EAFPGDVFYLHSR.L
1218	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	160	522.30	1042.58	522.29	1042.57	2	9.36	13.3	32418	78	3	93 - 103	R.TGSIVDVPAGK.A
1218	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	425	819.01	1636.00	819.00	1635.99	2	6.66	19.5	3671	54	3	470 - 484	K.AILNSVKPELLQALK.G
1218	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	413	665.89	1329.76	665.88	1329.75	2	7.08	19.1	23290	95	2	178 - 189	K.TTIAIDTILNQK.Q
1274	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	49	452.24	1353.71	452.24	1353.71	3	0.42	10	84805	46	3	142 - 153	R.KSVHEPMQTGLK.A
1274	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	308	600.82	1199.62	600.82	1199.62	2	-1.42	15.8	313752	68	2	109 - 120	R.VVDAMGVPIDGK.G
1274	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	253	446.75	891.48	446.75	891.48	2	-2.45	14.6	190632	55	2	395 - 401	K.LELAQYR.E
1274	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	7	457.58	1369.70	457.57	1369.70	3	0.79	8.6	8802	42	3	142 - 153	R.KSVHEPMQTGLK.A	Oxidation: 7
1274	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	441	625.82	1249.63	625.82	1249.63	2	-0.33	18.8	45833	84	3	7 - 17	R.AAELTNLFESR.I
1274	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	4	457.57	1369.70	457.57	1369.70	3	0.44	8.5	56908	40	3	142 - 153	R.KSVHEPMQTGLK.A	Oxidation: 7
1274	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	430	614.65	1840.92	614.65	1840.92	3	0.34	18.5	66480	37	2	18 - 32	R.IRNFYANFQVDEIGR.V
1274	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	407	574.29	1719.84	574.28	1719.81	3	13.03	18	24566	33	1	262 - 276	R.DNGMHALIIYDDLSK.Q	Oxidation: 4
1274	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	334	1026.59	1025.59	1026.59	1025.59	1	-1.40	16.4	127160	22	1	154 - 163	K.AVDSLVPIGR.G
1274	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	444	625.82	1249.63	625.82	1249.63	2	-0.83	18.9	56247	78	3	7 - 17	R.AAELTNLFESR.I
1274	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	461	546.34	1635.99	546.34	1635.99	3	-2.34	19.2	187442	57	3	470 - 484	K.AILNSVKPELLQALK.G
1274	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	192	608.81	1215.61	608.82	1215.62	2	-1.59	13.2	3967	59	3	109 - 120	R.VVDAMGVPIDGK.G	Oxidation: 5
1274	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	104	409.54	1225.61	409.54	1225.61	3	-1.39	11.2	664388	49	1	143 - 153	K.SVHEPMQTGLK.A
1274	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	39	414.88	1241.60	414.88	1241.61	3	-2.21	9.7	35977	42	3	143 - 153	K.SVHEPMQTGLK.A	Oxidation: 6
1274	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	263	438.75	875.48	438.75	875.49	2	-5.82	14.8	51678	37	3	283 - 289	R.QMSLLLR.R	Oxidation: 2
1274	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	425	614.65	1840.92	614.65	1840.92	3	-0.17	18.4	27414	46	2	18 - 32	R.IRNFYANFQVDEIGR.V
1274	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	44	414.88	1241.61	414.88	1241.61	3	0.63	9.8	650606	44	3	143 - 153	K.SVHEPMQTGLK.A	Oxidation: 6
1274	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	203	1043.57	1042.56	1043.57	1042.57	1	-6.09	13.4	23585	39	3	93 - 103	R.TGSIVDVPAGK.A
1274	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	251	446.74	891.47	446.75	891.48	2	-8.25	14.5	92828	55	2	395 - 401	K.LELAQYR.E
1274	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	193	522.29	1042.57	522.29	1042.57	2	-0.68	13.2	5177	78	3	93 - 103	R.TGSIVDVPAGK.A
1274	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	472	786.88	1571.74	786.88	1571.74	2	1.85	19.5	11137	50	1	20 - 32	R.NFYANFQVDEIGR.V
1274	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	357	656.38	1966.11	656.38	1966.11	3	-3.46	16.9	84270	65	3	427 - 443	R.LTEVLKQPQYAPLPIEK.Q
1274	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	465	819.00	1635.99	819.00	1635.99	2	-1.28	19.3	157618	65	3	470 - 484	K.AILNSVKPELLQALK.G
1274	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	451	1330.76	1329.75	1330.76	1329.75	1	-0.43	19	14973	15	2	178 - 189	K.TTIAIDTILNQK.Q
1274	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	427	513.25	1536.74	513.25	1536.74	3	-0.20	18.5	77421	52	3	295 - 307	R.EAFPGDVFYLHSR.L
1274	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	364	656.38	1966.11	656.38	1966.11	3	-0.70	17.1	54065	68	3	427 - 443	R.LTEVLKQPQYAPLPIEK.Q
1274	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	369	430.75	859.49	430.75	859.49	2	-4.93	17.2	19474	36	2	283 - 289	R.QMSLLLR.R
1274	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	373	860.50	859.49	860.50	859.49	1	-5.25	17.3	9184	31	2	283 - 289	R.QMSLLLR.R
1274	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	195	522.29	1042.57	522.29	1042.57	2	0.22	13.3	35780	78	3	93 - 103	R.TGSIVDVPAGK.A
1274	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	257	438.75	875.49	438.75	875.49	2	-4.41	14.6	35941	36	3	283 - 289	R.QMSLLLR.R	Oxidation: 2
1274	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	198	522.29	1042.56	522.29	1042.57	2	-1.08	13.3	65374	77	3	93 - 103	R.TGSIVDVPAGK.A
1274	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	468	546.34	1635.99	546.34	1635.99	3	-3.03	19.4	71062	56	3	470 - 484	K.AILNSVKPELLQALK.G
1274	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	460	731.68	2192.02	731.68	2192.02	3	-1.24	19.2	242825	16	1	195 - 213	R.ATSESETMYCVYVAIGQKR.S	Carbamidomethyl: 10
1274	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	305	600.82	1199.62	600.82	1199.62	2	0.25	15.7	137481	63	2	109 - 120	R.VVDAMGVPIDGK.G
1274	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	51	677.86	1353.71	677.86	1353.71	2	0.43	10	79671	36	2	142 - 153	R.KSVHEPMQTGLK.A
1274	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	454	444.26	1329.75	444.26	1329.75	3	-1.88	19.1	110393	40	1	178 - 189	K.TTIAIDTILNQK.Q
1274	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	211	553.28	2209.07	553.28	2209.08	4	-2.46	13.6	4734	44	2	109 - 129	R.VVDAMGVPIDGKGALSDHEQR.R	Oxidation: 5
1274	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	437	625.82	1249.63	625.82	1249.63	2	-0.33	18.7	33023	90	3	7 - 17	R.AAELTNLFESR.I
1274	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	371	860.50	859.49	860.50	859.49	1	-4.93	17.2	10422	18	2	283 - 289	R.QMSLLLR.R
1274	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	197	1043.57	1042.57	1043.57	1042.57	1	0.22	13.3	273099	58	3	93 - 103	R.TGSIVDVPAGK.A
1274	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	449	665.88	1329.75	665.88	1329.75	2	-0.43	19	4303	87	3	178 - 189	K.TTIAIDTILNQK.Q
1274	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	469	819.00	1635.99	819.00	1635.99	2	-3.03	19.4	49340	48	3	470 - 484	K.AILNSVKPELLQALK.G
1274	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	136	702.44	701.43	702.44	701.43	1	0.57	11.9	114929	30	1	427 - 432	R.LTEVLK.Q
1274	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	1	457.58	1369.71	457.57	1369.70	3	3.26	8.4	91571	35	3	142 - 153	R.KSVHEPMQTGLK.A	Oxidation: 7
1274	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	259	438.75	875.49	438.75	875.49	2	-4.95	14.7	161955	30	3	283 - 289	R.QMSLLLR.R	Oxidation: 2
1274	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	196	608.82	1215.62	608.82	1215.62	2	0.68	13.3	35520	60	3	109 - 120	R.VVDAMGVPIDGK.G	Oxidation: 5
1274	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	330	513.80	1025.59	513.80	1025.59	2	-1.77	16.3	62037	66	3	154 - 163	K.AVDSLVPIGR.G
1274	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	52	452.24	1353.71	452.24	1353.71	3	1.39	10	24566	43	3	142 - 153	R.KSVHEPMQTGLK.A
1274	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	165	755.44	754.43	755.44	754.43	1	-1.75	12.6	20696	29	2	135 - 141	K.APGILER.K
1274	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	41	414.88	1241.61	414.88	1241.61	3	-0.48	9.8	577378	41	3	143 - 153	K.SVHEPMQTGLK.A	Oxidation: 6
1274	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	390	491.75	981.49	491.75	981.48	2	6.27	17.6	63058	17	1	493 - 500	K.MELDAFLK.E	Oxidation: 1
1274	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	429	513.25	1536.73	513.25	1536.74	3	-2.62	18.5	56025	59	3	295 - 307	R.EAFPGDVFYLHSR.L
1274	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	206	553.28	2209.08	553.28	2209.08	4	0.06	13.5	29871	35	2	109 - 129	R.VVDAMGVPIDGKGALSDHEQR.R	Oxidation: 5
1274	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	406	547.80	1093.58	547.80	1093.58	2	-5.29	18	79671	39	2	492 - 500	R.KMELDAFLK.E
1274	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	403	547.80	1093.58	547.80	1093.58	2	-4.33	17.9	64983	30	2	492 - 500	R.KMELDAFLK.E
1274	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	336	513.80	1025.58	513.80	1025.59	2	-1.96	16.4	502459	66	3	154 - 163	K.AVDSLVPIGR.G
1274	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	452	665.88	1329.75	665.88	1329.75	2	-1.89	19	8205	74	3	178 - 189	K.TTIAIDTILNQK.Q
1274	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	42	621.81	1241.61	621.81	1241.61	2	-0.48	9.8	125612	49	2	143 - 153	K.SVHEPMQTGLK.A	Oxidation: 6
1274	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	409	860.91	1719.81	860.91	1719.81	2	-0.44	18.1	264236	22	1	262 - 276	R.DNGMHALIIYDDLSK.Q	Oxidation: 4
1274	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	53	677.86	1353.71	677.86	1353.71	2	1.38	10	983733	32	2	142 - 153	R.KSVHEPMQTGLK.A
1274	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	45	621.81	1241.61	621.81	1241.61	2	0.63	9.8	124535	46	2	143 - 153	K.SVHEPMQTGLK.A	Oxidation: 6
1274	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	48	452.24	1353.70	452.24	1353.71	3	-2.45	9.9	64983	53	3	142 - 153	R.KSVHEPMQTGLK.A
1274	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	169	755.44	754.43	755.44	754.43	1	-1.71	12.7	6373	21	2	135 - 141	K.APGILER.K
1274	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	455	665.88	1329.75	665.88	1329.75	2	-2.77	19.1	14701	69	3	178 - 189	K.TTIAIDTILNQK.Q
1274	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	668	1031.87	3092.58	1031.87	3092.59	3	-1.36	24.4	153004	65	1	33 - 62	R.VVSVGDGIAQVYGLNEIQAGEMVLFANGVK.G	Oxidation: 22
1274	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	199	608.82	1215.62	608.82	1215.62	2	0.00	13.3	19348	58	3	109 - 120	R.VVDAMGVPIDGK.G	Oxidation: 5
1274	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	333	513.80	1025.59	513.80	1025.59	2	-1.40	16.4	320958	66	3	154 - 163	K.AVDSLVPIGR.G
1274	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	372	430.75	859.49	430.75	859.49	2	-5.24	17.2	50935	41	2	283 - 289	R.QMSLLLR.R
1274	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	360	656.38	1966.11	656.38	1966.11	3	-1.11	17	79818	65	3	427 - 443	R.LTEVLKQPQYAPLPIEK.Q
1274	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	432	513.25	1536.73	513.25	1536.74	3	-4.02	18.6	72674	59	3	295 - 307	R.EAFPGDVFYLHSR.L
1274	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	200	1043.57	1042.56	1043.57	1042.57	1	-1.08	13.4	212951	58	3	93 - 103	R.TGSIVDVPAGK.A
1274	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	462	819.00	1635.99	819.00	1635.99	2	-2.33	19.3	633845	59	3	470 - 484	K.AILNSVKPELLQALK.G
1274	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	212	737.37	2209.07	737.37	2209.08	3	-2.45	13.6	3578	29	1	109 - 129	R.VVDAMGVPIDGKGALSDHEQR.R	Oxidation: 5
1274	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	464	546.34	1635.99	546.34	1635.99	3	-1.28	19.3	105084	61	3	470 - 484	K.AILNSVKPELLQALK.G
1274	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	453	1330.76	1329.75	1330.76	1329.75	1	-1.88	19.1	354077	30	2	178 - 189	K.TTIAIDTILNQK.Q
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	408	982.48	981.47	982.49	981.48	1	-11.03	17.6	5900	15	1	493 - 500	K.MELDAFLK.E	Oxidation: 1
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	473	819.00	1635.98	819.00	1635.99	2	-8.17	19.1	165052	75	3	470 - 484	K.AILNSVKPELLQALK.G
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	463	665.88	1329.74	665.88	1329.75	2	-8.98	18.9	26781	83	3	178 - 189	K.TTIAIDTILNQK.Q
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	116	409.54	1225.60	409.54	1225.61	3	-6.74	11.1	48172	44	2	143 - 153	K.SVHEPMQTGLK.A
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	692	774.15	3092.56	774.15	3092.59	4	-7.96	24.4	452432	84	3	33 - 62	R.VVSVGDGIAQVYGLNEIQAGEMVLFANGVK.G	Oxidation: 22
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	387	860.49	859.48	860.50	859.49	1	-11.85	17.2	90274	35	2	283 - 289	R.QMSLLLR.R
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	346	513.80	1025.58	513.80	1025.59	2	-9.61	16.3	30416	66	3	154 - 163	K.AVDSLVPIGR.G
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	713	1026.53	3076.57	1026.54	3076.59	3	-6.48	25	13382	114	3	33 - 62	R.VVSVGDGIAQVYGLNEIQAGEMVLFANGVK.G
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	377	656.37	1966.10	656.38	1966.11	3	-7.48	17	14152	71	3	427 - 443	R.LTEVLKQPQYAPLPIEK.Q
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	689	1031.86	3092.56	1031.87	3092.59	3	-7.88	24.3	203231	160	4	33 - 62	R.VVSVGDGIAQVYGLNEIQAGEMVLFANGVK.G	Oxidation: 22
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	52	452.24	1353.70	452.24	1353.71	3	-7.05	9.7	8818	45	3	142 - 153	R.KSVHEPMQTGLK.A
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	210	1043.56	1042.55	1043.57	1042.57	1	-16.27	13.2	12299	32	3	93 - 103	R.TGSIVDVPAGK.A
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	49	414.87	1241.60	414.88	1241.61	3	-4.43	9.6	3722	38	3	143 - 153	K.SVHEPMQTGLK.A	Oxidation: 6
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	416	547.79	1093.57	547.80	1093.58	2	-10.61	17.8	134890	60	2	492 - 500	R.KMELDAFLK.E
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	488	852.91	1703.80	852.92	1703.82	2	-8.74	19.4	98382	47	1	262 - 276	R.DNGMHALIIYDDLSK.Q
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	55	452.24	1353.70	452.24	1353.71	3	-6.32	9.7	15151	48	3	142 - 153	R.KSVHEPMQTGLK.A
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	423	574.27	1719.80	574.28	1719.81	3	-6.75	18	77452	37	2	262 - 276	R.DNGMHALIIYDDLSK.Q	Oxidation: 4
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	204	1043.56	1042.56	1043.57	1042.57	1	-8.35	13.1	12530	64	3	93 - 103	R.TGSIVDVPAGK.A
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	153	400.56	1198.66	400.56	1198.67	3	-5.94	11.9	88456	28	1	92 - 103	K.RTGSIVDVPAGK.A
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	712	1026.53	3076.57	1026.54	3076.59	3	-8.16	24.9	3766	106	3	33 - 62	R.VVSVGDGIAQVYGLNEIQAGEMVLFANGVK.G
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	205	522.28	1042.55	522.29	1042.57	2	-11.65	13.1	65586	78	3	93 - 103	R.TGSIVDVPAGK.A
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	531	569.27	1704.79	568.95	1703.82	3	569.53	20.4	125011	23	2	262 - 276	R.DNGMHALIIYDDLSK.Q
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	58	452.24	1353.70	452.24	1353.71	3	-6.61	9.8	56236	51	3	142 - 153	R.KSVHEPMQTGLK.A
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	471	546.33	1635.96	546.34	1635.99	3	-17.13	19.1	48172	57	4	470 - 484	K.AILNSVKPELLQALK.G
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	506	483.75	965.48	483.75	965.49	2	-9.05	19.9	68510	46	2	493 - 500	K.MELDAFLK.E
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	264	438.75	875.48	438.75	875.49	2	-10.19	14.4	43862	31	3	283 - 289	R.QMSLLLR.R	Oxidation: 2
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	317	642.35	1282.68	642.35	1282.69	2	-9.55	15.6	27705	51	3	433 - 443	K.QPQYAPLPIEK.Q
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	203	608.81	1215.61	608.82	1215.62	2	-8.59	13.1	21846	73	3	109 - 120	R.VVDAMGVPIDGK.G	Oxidation: 5
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	385	430.75	859.48	430.75	859.49	2	-11.83	17.2	46974	40	2	283 - 289	R.QMSLLLR.R
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	565	1189.10	2376.18	1189.11	2376.20	2	-8.19	21.2	12299	67	1	63 - 85	K.GMALNLENENVGIVVFGGDTAIK.E	Oxidation: 2
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	458	625.82	1249.62	625.82	1249.63	2	-7.14	18.8	266589	90	3	7 - 17	R.AAELTNLFESR.I
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	419	574.27	1719.80	574.28	1719.81	3	-6.77	17.9	95905	53	2	262 - 276	R.DNGMHALIIYDDLSK.Q	Oxidation: 4
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	59	677.86	1353.70	677.86	1353.71	2	-6.61	9.8	10583	28	2	142 - 153	R.KSVHEPMQTGLK.A
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	146	702.44	701.43	702.44	701.43	1	-5.09	11.8	454521	31	2	427 - 432	R.LTEVLK.Q
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	348	1026.58	1025.58	1026.59	1025.59	1	-9.62	16.3	6229	20	3	154 - 163	K.AVDSLVPIGR.G
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	324	555.79	1109.57	555.80	1109.58	2	-9.51	15.8	123131	46	2	492 - 500	R.KMELDAFLK.E	Oxidation: 2
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	345	1026.58	1025.58	1026.59	1025.59	1	-9.21	16.2	8121	23	3	154 - 163	K.AVDSLVPIGR.G
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	382	430.75	859.48	430.75	859.49	2	-12.08	17.1	11330	38	2	283 - 289	R.QMSLLLR.R
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	372	656.37	1966.10	656.38	1966.11	3	-8.70	16.8	9946	59	3	427 - 443	R.LTEVLKQPQYAPLPIEK.Q
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	45	414.87	1241.60	414.88	1241.61	3	-5.51	9.5	9528	38	3	143 - 153	K.SVHEPMQTGLK.A	Oxidation: 6
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	142	702.44	701.43	702.44	701.43	1	-5.21	11.7	329026	28	2	427 - 432	R.LTEVLK.Q
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	615	1181.10	2360.18	1181.11	2360.20	2	-10.65	22.3	44900	54	1	63 - 85	K.GMALNLENENVGIVVFGGDTAIK.E
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	690	774.15	3092.56	774.15	3092.59	4	-7.87	24.3	151715	99	3	33 - 62	R.VVSVGDGIAQVYGLNEIQAGEMVLFANGVK.G	Oxidation: 22
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	445	513.25	1536.72	513.25	1536.74	3	-7.88	18.5	149282	60	3	295 - 307	R.EAFPGDVFYLHSR.L
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	7	685.85	1369.69	685.86	1369.70	2	-7.41	8.4	24662	17	2	142 - 153	R.KSVHEPMQTGLK.A	Oxidation: 7
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	343	513.80	1025.58	513.80	1025.59	2	-9.18	16.2	219696	66	3	154 - 163	K.AVDSLVPIGR.G
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	489	568.94	1703.80	568.95	1703.82	3	-8.74	19.5	68310	41	2	262 - 276	R.DNGMHALIIYDDLSK.Q
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	1	457.57	1369.69	457.57	1369.70	3	-6.27	8.3	4047	34	3	142 - 153	R.KSVHEPMQTGLK.A	Oxidation: 7
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	422	860.91	1719.80	860.91	1719.81	2	-6.76	18	123748	55	1	262 - 276	R.DNGMHALIIYDDLSK.Q	Oxidation: 4
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	261	892.48	891.48	892.49	891.48	1	-6.80	14.3	38626	34	1	395 - 401	K.LELAQYR.E
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	50	621.81	1241.60	621.81	1241.61	2	-4.43	9.6	9126	51	3	143 - 153	K.SVHEPMQTGLK.A	Oxidation: 6
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	363	423.21	1266.61	423.22	1266.63	3	-10.49	16.6	11202	23	2	493 - 502	K.MELDAFLKER.A	Oxidation: 1
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	482	786.87	1571.72	786.88	1571.74	2	-9.28	19.3	669727	71	3	20 - 32	R.NFYANFQVDEIGR.V
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	480	786.87	1571.72	786.88	1571.74	2	-9.05	19.3	95283	70	3	20 - 32	R.NFYANFQVDEIGR.V
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	341	1026.58	1025.58	1026.59	1025.59	1	-9.36	16.2	15429	25	3	154 - 163	K.AVDSLVPIGR.G
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	173	755.43	754.43	755.44	754.43	1	-8.53	12.4	180133	23	3	135 - 141	K.APGILER.K
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	311	600.81	1199.61	600.82	1199.62	2	-9.67	15.5	7896	66	2	109 - 120	R.VVDAMGVPIDGK.G
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	267	438.75	875.48	438.75	875.49	2	-9.28	14.5	47201	35	3	283 - 289	R.QMSLLLR.R	Oxidation: 2
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	46	414.87	1241.60	414.88	1241.61	3	-4.11	9.5	9276	41	3	143 - 153	K.SVHEPMQTGLK.A	Oxidation: 6
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	455	625.82	1249.62	625.82	1249.63	2	-7.72	18.7	579309	90	3	7 - 17	R.AAELTNLFESR.I
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	200	522.29	1042.56	522.29	1042.57	2	-8.81	13	16184	78	3	93 - 103	R.TGSIVDVPAGK.A
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	682	1032.19	3093.54	1031.87	3092.59	3	309.45	24.1	152394	38	4	33 - 62	R.VVSVGDGIAQVYGLNEIQAGEMVLFANGVK.G	Oxidation: 22
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	319	642.35	1282.68	642.35	1282.69	2	-10.49	15.7	64716	59	3	433 - 443	K.QPQYAPLPIEK.Q
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	451	625.82	1249.62	625.82	1249.63	2	-7.48	18.6	59341	84	3	7 - 17	R.AAELTNLFESR.I
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	485	786.87	1571.72	786.88	1571.74	2	-8.63	19.4	655966	68	3	20 - 32	R.NFYANFQVDEIGR.V
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	418	547.79	1093.57	547.80	1093.58	2	-9.88	17.9	8888	52	2	492 - 500	R.KMELDAFLK.E
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	57	677.86	1353.70	677.86	1353.71	2	-6.33	9.7	10791	51	2	142 - 153	R.KSVHEPMQTGLK.A
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	360	423.21	1266.61	423.22	1266.63	3	-11.37	16.6	6492	24	2	493 - 502	K.MELDAFLKER.A	Oxidation: 1
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	179	755.43	754.43	755.44	754.43	1	-8.33	12.5	58953	22	3	135 - 141	K.APGILER.K
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	460	665.88	1329.74	665.88	1329.75	2	-8.06	18.8	159133	89	3	178 - 189	K.TTIAIDTILNQK.Q
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	315	642.35	1282.68	642.35	1282.69	2	-9.33	15.6	6562	52	3	433 - 443	K.QPQYAPLPIEK.Q
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	47	621.81	1241.60	621.81	1241.61	2	-4.11	9.5	4119	53	3	143 - 153	K.SVHEPMQTGLK.A	Oxidation: 6
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	442	513.25	1536.72	513.25	1536.74	3	-8.17	18.4	89285	57	3	295 - 307	R.EAFPGDVFYLHSR.L
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	475	546.33	1635.98	546.34	1635.99	3	-7.39	19.2	39788	62	4	470 - 484	K.AILNSVKPELLQALK.G
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	201	1043.56	1042.56	1043.57	1042.57	1	-8.83	13	8888	71	3	93 - 103	R.TGSIVDVPAGK.A
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	4	685.85	1369.69	685.86	1369.70	2	-6.18	8.3	10082	36	2	142 - 153	R.KSVHEPMQTGLK.A	Oxidation: 7
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	3	457.57	1369.69	457.57	1369.70	3	-6.18	8.3	13382	47	3	142 - 153	R.KSVHEPMQTGLK.A	Oxidation: 7
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	340	513.80	1025.58	513.80	1025.59	2	-9.36	16.1	145835	66	3	154 - 163	K.AVDSLVPIGR.G
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	472	546.33	1635.98	546.34	1635.99	3	-8.16	19.1	25945	58	4	470 - 484	K.AILNSVKPELLQALK.G
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	597	869.94	1737.87	869.95	1737.89	2	-10.53	21.9	286777	72	2	444 - 458	K.QILVIYAAVNGFCDR.M	Carbamidomethyl: 13
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	462	1330.75	1329.74	1330.76	1329.75	1	-8.07	18.9	40289	25	2	178 - 189	K.TTIAIDTILNQK.Q
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	383	860.49	859.48	860.50	859.49	1	-12.09	17.1	344402	31	2	283 - 289	R.QMSLLLR.R
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	504	483.75	965.48	483.75	965.49	2	-11.35	19.8	138438	36	2	493 - 500	K.MELDAFLK.E
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	466	665.88	1329.74	665.88	1329.75	2	-8.00	19	16168	86	3	178 - 189	K.TTIAIDTILNQK.Q
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	202	522.29	1042.56	522.29	1042.57	2	-8.34	13	42242	78	3	93 - 103	R.TGSIVDVPAGK.A
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	600	869.94	1737.87	869.95	1737.89	2	-8.15	21.9	533803	50	2	444 - 458	K.QILVIYAAVNGFCDR.M	Carbamidomethyl: 13
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	269	438.75	875.48	438.75	875.49	2	-9.69	14.5	59762	38	3	283 - 289	R.QMSLLLR.R	Oxidation: 2
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	314	600.81	1199.61	600.82	1199.62	2	-10.05	15.5	8279	71	2	109 - 120	R.VVDAMGVPIDGK.G
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	263	446.74	891.47	446.75	891.48	2	-8.76	14.4	71515	55	2	395 - 401	K.LELAQYR.E
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	476	819.00	1635.98	819.00	1635.99	2	-7.40	19.2	84398	68	3	470 - 484	K.AILNSVKPELLQALK.G
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	374	656.37	1966.10	656.38	1966.11	3	-8.70	16.9	6260	65	3	427 - 443	R.LTEVLKQPQYAPLPIEK.Q
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	199	608.81	1215.61	608.82	1215.62	2	-8.06	13	67563	60	3	109 - 120	R.VVDAMGVPIDGK.G	Oxidation: 5
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	688	774.15	3092.55	774.15	3092.59	4	-10.19	24.3	25962	118	3	33 - 62	R.VVSVGDGIAQVYGLNEIQAGEMVLFANGVK.G	Oxidation: 22
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	320	555.79	1109.57	555.80	1109.58	2	-10.29	15.7	40218	51	2	492 - 500	R.KMELDAFLK.E	Oxidation: 2
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	259	446.74	891.48	446.75	891.48	2	-6.79	14.3	49099	55	2	395 - 401	K.LELAQYR.E
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	406	491.74	981.47	491.75	981.48	2	-11.01	17.6	4605	43	2	493 - 500	K.MELDAFLK.E	Oxidation: 1
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	404	491.74	981.48	491.75	981.48	2	-9.18	17.6	3722	35	2	493 - 500	K.MELDAFLK.E	Oxidation: 1
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	479	819.00	1635.98	819.00	1635.99	2	-8.86	19.2	115275	42	3	470 - 484	K.AILNSVKPELLQALK.G
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	6	457.57	1369.69	457.57	1369.70	3	-7.40	8.4	29835	40	3	142 - 153	R.KSVHEPMQTGLK.A	Oxidation: 7
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	464	1330.75	1329.74	1330.76	1329.75	1	-8.98	18.9	204933	19	2	178 - 189	K.TTIAIDTILNQK.Q
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	440	769.37	1536.72	769.38	1536.74	2	-8.71	18.4	720136	76	1	295 - 307	R.EAFPGDVFYLHSR.L
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	114	409.54	1225.60	409.54	1225.61	3	-7.42	11	9707	50	2	143 - 153	K.SVHEPMQTGLK.A
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	562	1006.85	3017.52	1006.85	3017.54	3	-6.04	21.1	5782	17	1	63 - 91	K.GMALNLENENVGIVVFGGDTAIKEGDLVK.R	Oxidation: 2
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	535	546.66	1636.96	546.34	1635.99	3	592.51	20.5	54899	18	4	470 - 484	K.AILNSVKPELLQALK.G
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	206	608.81	1215.61	608.82	1215.62	2	-7.93	13.1	7940	63	3	109 - 120	R.VVDAMGVPIDGK.G	Oxidation: 5
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	686	1031.86	3092.55	1031.87	3092.59	3	-11.93	24.2	40448	61	4	33 - 62	R.VVSVGDGIAQVYGLNEIQAGEMVLFANGVK.G	Oxidation: 22
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	566	793.07	2376.18	793.07	2376.20	3	-8.20	21.2	43384	78	1	63 - 85	K.GMALNLENENVGIVVFGGDTAIK.E	Oxidation: 2
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	687	1031.86	3092.55	1031.87	3092.59	3	-10.20	24.3	37666	105	4	33 - 62	R.VVSVGDGIAQVYGLNEIQAGEMVLFANGVK.G	Oxidation: 22
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	465	444.25	1329.74	444.26	1329.75	3	-8.97	18.9	35823	56	1	178 - 189	K.TTIAIDTILNQK.Q
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	439	513.25	1536.72	513.25	1536.74	3	-8.71	18.4	37376	61	3	295 - 307	R.EAFPGDVFYLHSR.L
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	704	1026.52	3076.55	1026.54	3076.59	3	-13.26	24.7	35566	23	3	33 - 62	R.VVSVGDGIAQVYGLNEIQAGEMVLFANGVK.G
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	175	755.44	754.43	755.44	754.43	1	-6.96	12.4	129701	25	3	135 - 141	K.APGILER.K
1332	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	53	621.81	1241.60	621.81	1241.61	2	-5.42	9.7	5900	55	3	143 - 153	K.SVHEPMQTGLK.A	Oxidation: 6
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	456	546.34	1635.99	546.34	1635.99	3	-3.03	19.6	18928	57	3	470 - 484	K.AILNSVKPELLQALK.G
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	504	569.27	1704.80	568.95	1703.82	3	574.76	20.7	4052	15	1	262 - 276	R.DNGMHALIIYDDLSK.Q
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	534	793.07	2376.20	793.07	2376.20	3	-1.69	21.4	5053	75	1	63 - 85	K.GMALNLENENVGIVVFGGDTAIK.E	Oxidation: 2
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	184	608.81	1215.61	608.82	1215.62	2	-6.24	13.4	114329	63	3	109 - 120	R.VVDAMGVPIDGK.G	Oxidation: 5
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	432	625.82	1249.63	625.82	1249.63	2	-3.83	19.1	7891	84	3	7 - 17	R.AAELTNLFESR.I
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	457	819.00	1635.99	819.00	1635.99	2	-3.03	19.6	11852	39	3	470 - 484	K.AILNSVKPELLQALK.G
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	258	438.75	875.48	438.75	875.49	2	-7.03	15.1	9713	35	3	283 - 289	R.QMSLLLR.R	Oxidation: 2
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	563	869.95	1737.88	869.95	1737.89	2	-3.94	22.3	9713	44	3	444 - 458	K.QILVIYAAVNGFCDR.M	Carbamidomethyl: 13
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	248	446.75	891.48	446.75	891.48	2	-6.48	14.9	13567	55	3	395 - 401	K.LELAQYR.E
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	361	656.38	1966.11	656.38	1966.11	3	-3.40	17.4	43143	50	3	427 - 443	R.LTEVLKQPQYAPLPIEK.Q
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	386	491.75	981.48	491.75	981.48	2	-5.79	18.1	28776	27	2	493 - 500	K.MELDAFLK.E	Oxidation: 1
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	303	480.29	1437.83	480.29	1437.84	3	-5.76	16.1	49231	57	1	363 - 376	R.GIRPAINVGLSVSR.V
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	302	600.81	1199.61	600.82	1199.62	2	-6.38	16.1	25933	65	2	109 - 120	R.VVDAMGVPIDGK.G
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	621	1031.87	3092.58	1031.87	3092.59	3	-1.39	24.5	20341	114	5	33 - 62	R.VVSVGDGIAQVYGLNEIQAGEMVLFANGVK.G	Oxidation: 22
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	356	656.38	1966.11	656.38	1966.11	3	-3.41	17.3	39156	66	3	427 - 443	R.LTEVLKQPQYAPLPIEK.Q
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	612	1032.20	3093.56	1031.87	3092.59	3	316.36	24.2	14827	33	5	33 - 62	R.VVSVGDGIAQVYGLNEIQAGEMVLFANGVK.G	Oxidation: 22
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	43	621.81	1241.60	621.81	1241.61	2	-3.73	10.1	126057	33	2	143 - 153	K.SVHEPMQTGLK.A	Oxidation: 6
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	436	665.88	1329.74	665.88	1329.75	2	-4.89	19.2	359240	99	3	178 - 189	K.TTIAIDTILNQK.Q
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	555	869.95	1737.88	869.95	1737.89	2	-3.99	22.1	14343	77	3	444 - 458	K.QILVIYAAVNGFCDR.M	Carbamidomethyl: 13
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	332	1026.59	1025.58	1026.59	1025.59	1	-6.02	16.8	37222	27	3	154 - 163	K.AVDSLVPIGR.G
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	172	755.44	754.43	755.44	754.43	1	-4.57	13.1	34504	20	1	135 - 141	K.APGILER.K
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	451	819.00	1635.98	819.00	1635.99	2	-5.30	19.5	57092	43	3	470 - 484	K.AILNSVKPELLQALK.G
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	299	600.81	1199.61	600.82	1199.62	2	-6.79	16	19992	72	2	109 - 120	R.VVDAMGVPIDGK.G
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	620	774.15	3092.58	774.15	3092.59	4	-1.04	24.4	56942	131	2	33 - 62	R.VVSVGDGIAQVYGLNEIQAGEMVLFANGVK.G	Oxidation: 22
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	190	522.29	1042.56	522.29	1042.57	2	-6.02	13.6	4805	78	3	93 - 103	R.TGSIVDVPAGK.A
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	426	769.37	1536.73	769.38	1536.74	2	-3.34	19	7659	48	3	295 - 307	R.EAFPGDVFYLHSR.L
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	340	634.32	1266.62	634.32	1266.63	2	-4.55	16.9	55570	31	1	493 - 502	K.MELDAFLKER.A	Oxidation: 1
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	454	819.00	1635.99	819.00	1635.99	2	-3.75	19.6	27591	73	3	470 - 484	K.AILNSVKPELLQALK.G
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	460	786.87	1571.73	786.88	1571.74	2	-3.36	19.7	25354	62	2	20 - 32	R.NFYANFQVDEIGR.V
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	187	608.81	1215.61	608.82	1215.62	2	-5.57	13.5	4816	67	3	109 - 120	R.VVDAMGVPIDGK.G	Oxidation: 5
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	450	546.34	1635.98	546.34	1635.99	3	-5.30	19.5	34979	43	3	470 - 484	K.AILNSVKPELLQALK.G
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	50	452.24	1353.70	452.24	1353.71	3	-6.48	10.2	4590	45	3	142 - 153	R.KSVHEPMQTGLK.A
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	353	656.38	1966.11	656.38	1966.11	3	-3.95	17.3	14690	61	3	427 - 443	R.LTEVLKQPQYAPLPIEK.Q
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	535	1189.10	2376.19	1189.11	2376.20	2	-4.51	21.5	14515	32	3	63 - 85	K.GMALNLENENVGIVVFGGDTAIK.E	Oxidation: 2
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	113	409.54	1225.61	409.54	1225.61	3	-4.54	11.8	9479	44	2	143 - 153	K.SVHEPMQTGLK.A
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	195	522.29	1042.56	522.29	1042.57	2	-4.01	13.7	21887	78	3	93 - 103	R.TGSIVDVPAGK.A
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	196	1043.57	1042.56	1043.57	1042.57	1	-4.01	13.7	8976	30	2	93 - 103	R.TGSIVDVPAGK.A
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	193	1043.57	1042.56	1043.57	1042.57	1	-4.16	13.6	6287	52	2	93 - 103	R.TGSIVDVPAGK.A
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	439	1330.75	1329.75	1330.76	1329.75	1	-2.75	19.2	164312	39	1	178 - 189	K.TTIAIDTILNQK.Q
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	569	787.74	2360.20	787.74	2360.20	3	-3.07	22.4	4301	20	1	63 - 85	K.GMALNLENENVGIVVFGGDTAIK.E
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	417	513.25	1536.73	513.25	1536.74	3	-1.74	18.8	22448	64	3	295 - 307	R.EAFPGDVFYLHSR.L
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	425	769.37	1536.73	769.38	1536.74	2	-4.21	18.9	12099	53	3	295 - 307	R.EAFPGDVFYLHSR.L
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	324	513.80	1025.58	513.80	1025.59	2	-6.09	16.6	109577	66	3	154 - 163	K.AVDSLVPIGR.G
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	559	869.95	1737.88	869.95	1737.89	2	-4.40	22.2	4061	72	3	444 - 458	K.QILVIYAAVNGFCDR.M	Carbamidomethyl: 13
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	192	522.29	1042.56	522.29	1042.57	2	-4.16	13.6	9843	78	3	93 - 103	R.TGSIVDVPAGK.A
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	458	786.87	1571.73	786.88	1571.74	2	-3.40	19.7	15898	68	2	20 - 32	R.NFYANFQVDEIGR.V
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	399	860.91	1719.81	860.91	1719.81	2	-1.34	18.4	25550	26	1	262 - 276	R.DNGMHALIIYDDLSK.Q	Oxidation: 4
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	453	546.34	1635.99	546.34	1635.99	3	-3.75	19.6	21037	54	3	470 - 484	K.AILNSVKPELLQALK.G
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	503	853.41	1704.80	852.92	1703.82	2	575.11	20.7	9631	15	2	262 - 276	R.DNGMHALIIYDDLSK.Q
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	144	400.56	1198.66	400.56	1198.67	3	-5.04	12.5	50971	43	1	92 - 103	K.RTGSIVDVPAGK.A
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	263	438.75	875.48	438.75	875.49	2	-7.94	15.2	5259	40	3	283 - 289	R.QMSLLLR.R	Oxidation: 2
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	623	774.15	3092.58	774.15	3092.59	4	-1.39	24.5	21296	62	2	33 - 62	R.VVSVGDGIAQVYGLNEIQAGEMVLFANGVK.G	Oxidation: 22
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	42	414.87	1241.60	414.88	1241.61	3	-3.73	10.1	23025	46	3	143 - 153	K.SVHEPMQTGLK.A	Oxidation: 6
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	141	702.44	701.43	702.44	701.43	1	-3.66	12.4	196320	37	2	427 - 432	R.LTEVLK.Q
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	560	580.30	1737.88	580.30	1737.89	3	-4.41	22.2	7556	56	1	444 - 458	K.QILVIYAAVNGFCDR.M	Carbamidomethyl: 13
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	54	452.24	1353.70	452.24	1353.71	3	-4.58	10.3	48254	32	3	142 - 153	R.KSVHEPMQTGLK.A
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	429	625.82	1249.62	625.82	1249.63	2	-4.52	19	6374	89	3	7 - 17	R.AAELTNLFESR.I
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	310	555.79	1109.57	555.80	1109.58	2	-5.86	16.3	19138	54	2	492 - 500	R.KMELDAFLK.E	Oxidation: 2
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	385	491.75	981.48	491.75	981.48	2	-5.16	18	8473	20	2	493 - 500	K.MELDAFLK.E	Oxidation: 1
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	261	438.75	875.48	438.75	875.49	2	-6.34	15.2	6523	34	3	283 - 289	R.QMSLLLR.R	Oxidation: 2
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	619	1031.87	3092.58	1031.87	3092.59	3	-1.04	24.4	7724	116	5	33 - 62	R.VVSVGDGIAQVYGLNEIQAGEMVLFANGVK.G	Oxidation: 22
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	330	513.80	1025.58	513.80	1025.59	2	-6.01	16.7	43688	40	3	154 - 163	K.AVDSLVPIGR.G
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	143	702.44	701.43	702.44	701.43	1	-3.57	12.5	124073	30	2	427 - 432	R.LTEVLK.Q
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	435	625.82	1249.63	625.82	1249.63	2	-3.15	19.2	23754	73	3	7 - 17	R.AAELTNLFESR.I
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	3	457.57	1369.70	457.57	1369.70	3	-4.17	8.7	10180	44	2	142 - 153	R.KSVHEPMQTGLK.A	Oxidation: 7
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	110	409.54	1225.61	409.54	1225.61	3	-2.90	11.8	23566	37	2	143 - 153	K.SVHEPMQTGLK.A
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	255	446.75	891.48	446.75	891.48	2	-6.17	15	7556	55	3	395 - 401	K.LELAQYR.E
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	4	457.57	1369.70	457.57	1369.70	3	-3.78	8.7	25809	44	2	142 - 153	R.KSVHEPMQTGLK.A	Oxidation: 7
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	419	769.37	1536.73	769.38	1536.74	2	-1.74	18.8	50981	54	3	295 - 307	R.EAFPGDVFYLHSR.L
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	308	642.35	1282.69	642.35	1282.69	2	-5.25	16.2	10180	36	2	433 - 443	K.QPQYAPLPIEK.Q
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	618	1031.87	3092.58	1031.87	3092.59	3	-2.13	24.4	8540	77	5	33 - 62	R.VVSVGDGIAQVYGLNEIQAGEMVLFANGVK.G	Oxidation: 22
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	441	665.88	1329.75	665.88	1329.75	2	-3.51	19.3	60276	77	3	178 - 189	K.TTIAIDTILNQK.Q
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	36	414.87	1241.60	414.88	1241.61	3	-4.21	9.9	27892	39	3	143 - 153	K.SVHEPMQTGLK.A	Oxidation: 6
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	251	446.75	891.48	446.75	891.48	2	-4.71	14.9	12095	55	3	395 - 401	K.LELAQYR.E
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	572	1181.11	2360.20	1181.11	2360.20	2	-3.64	22.5	19439	40	3	63 - 85	K.GMALNLENENVGIVVFGGDTAIK.E
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	530	1189.11	2376.20	1189.11	2376.20	2	-0.60	21.3	43895	16	3	63 - 85	K.GMALNLENENVGIVVFGGDTAIK.E	Oxidation: 2
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	401	547.80	1093.58	547.80	1093.58	2	-4.75	18.4	30150	37	1	492 - 500	R.KMELDAFLK.E
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	532	1189.11	2376.20	1189.11	2376.20	2	-1.69	21.4	140422	42	3	63 - 85	K.GMALNLENENVGIVVFGGDTAIK.E	Oxidation: 2
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	189	608.81	1215.61	608.82	1215.62	2	-4.74	13.5	72987	65	3	109 - 120	R.VVDAMGVPIDGK.G	Oxidation: 5
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	398	574.28	1719.82	574.28	1719.81	3	2.91	18.3	25018	40	1	262 - 276	R.DNGMHALIIYDDLSK.Q	Oxidation: 4
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	421	513.25	1536.73	513.25	1536.74	3	-3.98	18.8	86688	58	3	295 - 307	R.EAFPGDVFYLHSR.L
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	464	852.91	1703.81	852.92	1703.82	2	-3.13	19.8	15295	19	2	262 - 276	R.DNGMHALIIYDDLSK.Q
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	327	513.80	1025.58	513.80	1025.59	2	-5.37	16.7	113596	54	3	154 - 163	K.AVDSLVPIGR.G
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	489	1018.97	2035.92	1018.97	2035.92	2	-2.18	20.4	114329	32	1	195 - 212	R.ATSESETMYCVYVAIGQK.R	Carbamidomethyl: 10
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	304	642.35	1282.69	642.35	1282.69	2	-4.48	16.2	12940	40	2	433 - 443	K.QPQYAPLPIEK.Q
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	614	1032.20	3093.57	1031.87	3092.59	3	316.74	24.3	25809	26	5	33 - 62	R.VVSVGDGIAQVYGLNEIQAGEMVLFANGVK.G	Oxidation: 22
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	326	1026.59	1025.58	1026.59	1025.59	1	-6.11	16.6	58530	36	3	154 - 163	K.AVDSLVPIGR.G
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	438	665.88	1329.75	665.88	1329.75	2	-2.74	19.2	83301	94	3	178 - 189	K.TTIAIDTILNQK.Q
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	328	1026.59	1025.58	1026.59	1025.59	1	-5.37	16.7	40789	30	3	154 - 163	K.AVDSLVPIGR.G
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	40	621.81	1241.60	621.81	1241.61	2	-3.50	10	118983	45	2	143 - 153	K.SVHEPMQTGLK.A	Oxidation: 6
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	568	1181.11	2360.20	1181.11	2360.20	2	-3.09	22.4	5259	24	3	63 - 85	K.GMALNLENENVGIVVFGGDTAIK.E
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	39	414.87	1241.60	414.88	1241.61	3	-3.51	10	27256	38	3	143 - 153	K.SVHEPMQTGLK.A	Oxidation: 6
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	307	555.79	1109.57	555.80	1109.58	2	-4.76	16.2	14827	57	2	492 - 500	R.KMELDAFLK.E	Oxidation: 2
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	424	513.25	1536.73	513.25	1536.74	3	-4.21	18.9	52390	62	3	295 - 307	R.EAFPGDVFYLHSR.L
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	565	1181.11	2360.20	1181.11	2360.20	2	-3.35	22.3	10323	40	3	63 - 85	K.GMALNLENENVGIVVFGGDTAIK.E
1386	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	51	452.24	1353.70	452.24	1353.71	3	-3.83	10.3	39156	57	3	142 - 153	R.KSVHEPMQTGLK.A
1443	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	319	656.37	1966.10	656.38	1966.11	3	-8.67	17	9428	74	3	427 - 443	R.LTEVLKQPQYAPLPIEK.Q
1443	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	293	513.80	1025.59	513.80	1025.59	2	-1.22	16.5	4650	66	3	154 - 163	K.AVDSLVPIGR.G
1443	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	270	480.29	1437.84	480.29	1437.84	3	-2.12	15.9	35511	52	2	363 - 376	R.GIRPAINVGLSVSR.V
1443	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	421	819.00	1635.99	819.00	1635.99	2	-0.40	19.4	5166	44	2	470 - 484	K.AILNSVKPELLQALK.G
1443	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	268	642.35	1282.69	642.35	1282.69	2	-1.10	15.9	8205	56	3	433 - 443	K.QPQYAPLPIEK.Q
1443	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	260	452.25	902.50	451.76	901.51	2	1095.41	15.7	8921	17	1	283 - 289	R.QMSLLLR.R	Acetyl: 1
1443	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	351	491.75	981.48	491.75	981.48	2	-4.22	17.8	12186	35	2	493 - 500	K.MELDAFLK.E	Oxidation: 1
1443	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	9	457.57	1369.70	457.57	1369.70	3	-1.77	8.6	17484	31	3	142 - 153	R.KSVHEPMQTGLK.A	Oxidation: 7
1443	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	146	608.81	1215.61	608.82	1215.62	2	-5.25	13.1	45650	50	3	109 - 120	R.VVDAMGVPIDGK.G	Oxidation: 5
1443	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	158	522.29	1042.56	522.29	1042.57	2	-2.38	13.4	22494	65	3	93 - 103	R.TGSIVDVPAGK.A
1443	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	394	769.38	1536.74	769.38	1536.74	2	0.08	18.8	205395	19	1	295 - 307	R.EAFPGDVFYLHSR.L
1443	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	272	555.80	1109.58	555.80	1109.58	2	-1.17	16	8524	60	3	492 - 500	R.KMELDAFLK.E	Oxidation: 2
1443	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	405	665.88	1329.75	665.88	1329.75	2	-2.53	19	52050	88	3	178 - 189	K.TTIAIDTILNQK.Q
1443	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	153	522.29	1042.56	522.29	1042.57	2	-4.64	13.3	5918	58	3	93 - 103	R.TGSIVDVPAGK.A
1443	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	155	522.29	1042.56	522.29	1042.57	2	-2.04	13.3	17057	66	3	93 - 103	R.TGSIVDVPAGK.A
1443	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	385	513.25	1536.73	513.25	1536.74	3	-2.65	18.6	3709	62	3	295 - 307	R.EAFPGDVFYLHSR.L
1443	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	6	457.57	1369.70	457.57	1369.70	3	-1.55	8.5	8375	42	3	142 - 153	R.KSVHEPMQTGLK.A	Oxidation: 7
1443	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	226	438.75	875.49	438.75	875.49	2	-2.49	14.9	7401	34	3	283 - 289	R.QMSLLLR.R	Oxidation: 2
1443	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	426	546.34	1635.99	546.34	1635.99	3	-0.20	19.5	8154	32	4	470 - 484	K.AILNSVKPELLQALK.G
1443	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	389	513.25	1536.73	513.25	1536.74	3	-1.49	18.6	22543	64	3	295 - 307	R.EAFPGDVFYLHSR.L
1443	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	423	819.00	1635.99	819.00	1635.99	2	-0.05	19.5	10202	51	2	470 - 484	K.AILNSVKPELLQALK.G
1443	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	147	608.81	1215.61	608.82	1215.62	2	-3.13	13.1	49184	72	3	109 - 120	R.VVDAMGVPIDGK.G	Oxidation: 5
1443	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	398	625.82	1249.63	625.82	1249.63	2	-3.51	18.8	45627	85	3	7 - 17	R.AAELTNLFESR.I
1443	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	106	702.44	701.43	702.44	701.43	1	-4.69	12.1	17102	31	3	427 - 432	R.LTEVLK.Q
1443	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	399	625.82	1249.63	625.82	1249.63	2	-2.20	18.9	22237	77	3	7 - 17	R.AAELTNLFESR.I
1443	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	402	625.82	1249.63	625.82	1249.63	2	-2.64	19	51240	85	3	7 - 17	R.AAELTNLFESR.I
1443	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	267	600.82	1199.62	600.82	1199.62	2	-2.91	15.9	51391	68	1	109 - 120	R.VVDAMGVPIDGK.G
1443	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	419	546.34	1635.99	546.34	1635.99	3	-0.40	19.4	4261	62	4	470 - 484	K.AILNSVKPELLQALK.G
1443	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	408	665.88	1329.75	665.88	1329.75	2	-1.71	19.1	54805	91	3	178 - 189	K.TTIAIDTILNQK.Q
1443	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	152	406.21	1215.62	406.21	1215.62	3	-1.23	13.2	11801	31	2	109 - 120	R.VVDAMGVPIDGK.G	Oxidation: 5
1443	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	160	1043.57	1042.56	1043.57	1042.57	1	-2.40	13.4	197024	27	1	93 - 103	R.TGSIVDVPAGK.A
1443	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	294	1026.59	1025.59	1026.59	1025.59	1	-1.23	16.5	9124	24	1	154 - 163	K.AVDSLVPIGR.G
1443	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	271	642.35	1282.69	642.35	1282.69	2	-1.21	16	6724	43	3	433 - 443	K.QPQYAPLPIEK.Q
1443	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	470	793.07	2376.20	793.07	2376.20	3	-1.01	21.3	10761	25	1	63 - 85	K.GMALNLENENVGIVVFGGDTAIK.E	Oxidation: 2
1443	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	219	446.75	891.48	446.75	891.48	2	-1.29	14.8	13023	55	3	395 - 401	K.LELAQYR.E
1443	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	228	438.75	875.49	438.75	875.49	2	-2.86	15	16897	25	3	283 - 289	R.QMSLLLR.R	Oxidation: 2
1443	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	422	546.34	1635.99	546.34	1635.99	3	-0.05	19.5	9140	54	4	470 - 484	K.AILNSVKPELLQALK.G
1443	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	459	546.66	1636.97	546.34	1635.99	3	596.14	20.6	92580	20	4	470 - 484	K.AILNSVKPELLQALK.G
1443	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	391	513.25	1536.73	513.25	1536.74	3	-0.90	18.7	229657	64	3	295 - 307	R.EAFPGDVFYLHSR.L
1443	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	354	491.75	981.48	491.75	981.48	2	-4.00	17.9	24655	32	2	493 - 500	K.MELDAFLK.E	Oxidation: 1
1443	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	31	414.88	1241.61	414.88	1241.61	3	1.79	9.7	23281	36	3	143 - 153	K.SVHEPMQTGLK.A	Oxidation: 6
1443	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	149	608.81	1215.62	608.82	1215.62	2	-1.57	13.2	21035	68	3	109 - 120	R.VVDAMGVPIDGK.G	Oxidation: 5
1443	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	290	513.80	1025.58	513.80	1025.59	2	-2.00	16.4	3750	53	3	154 - 163	K.AVDSLVPIGR.G
1443	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	33	414.88	1241.61	414.88	1241.61	3	-1.70	9.8	8093	39	3	143 - 153	K.SVHEPMQTGLK.A	Oxidation: 6
1443	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	276	642.35	1282.69	642.35	1282.69	2	-1.04	16.1	35516	33	3	433 - 443	K.QPQYAPLPIEK.Q
1443	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	274	555.80	1109.58	555.80	1109.58	2	-0.39	16	15381	62	3	492 - 500	R.KMELDAFLK.E	Oxidation: 2
1443	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	34	621.81	1241.61	621.81	1241.61	2	-1.70	9.8	12112	27	2	143 - 153	K.SVHEPMQTGLK.A	Oxidation: 6
1443	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	403	665.88	1329.74	665.88	1329.75	2	-5.31	19	169687	85	3	178 - 189	K.TTIAIDTILNQK.Q
1443	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	325	656.38	1966.11	656.38	1966.11	3	-1.42	17.2	6334	53	3	427 - 443	R.LTEVLKQPQYAPLPIEK.Q
1443	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	320	656.38	1966.11	656.38	1966.11	3	-1.57	17.1	11195	61	3	427 - 443	R.LTEVLKQPQYAPLPIEK.Q
1443	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	214	446.75	891.48	446.75	891.48	2	-4.04	14.6	8696	55	3	395 - 401	K.LELAQYR.E
1443	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	36	414.88	1241.60	414.88	1241.61	3	-2.86	9.8	7983	36	3	143 - 153	K.SVHEPMQTGLK.A	Oxidation: 6
1443	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	216	446.75	891.48	446.75	891.48	2	-1.17	14.7	4660	49	3	395 - 401	K.LELAQYR.E
1443	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	277	555.80	1109.58	555.80	1109.58	2	-1.13	16.1	6664	53	3	492 - 500	R.KMELDAFLK.E	Oxidation: 2
1443	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	110	702.44	701.43	702.44	701.43	1	-1.79	12.3	6483	38	3	427 - 432	R.LTEVLK.Q
1443	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	365	574.28	1719.81	574.28	1719.81	3	-1.48	18.1	8295	42	2	262 - 276	R.DNGMHALIIYDDLSK.Q	Oxidation: 4
1443	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	266	480.29	1437.84	480.29	1437.84	3	-2.54	15.8	3932	59	2	363 - 376	R.GIRPAINVGLSVSR.V
1443	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	289	513.80	1025.58	513.80	1025.59	2	-3.95	16.4	5225	48	3	154 - 163	K.AVDSLVPIGR.G
1443	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	223	438.75	875.49	438.75	875.49	2	-2.26	14.8	5579	24	3	283 - 289	R.QMSLLLR.R	Oxidation: 2
1443	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	367	574.28	1719.81	574.28	1719.81	3	-1.62	18.2	86547	40	2	262 - 276	R.DNGMHALIIYDDLSK.Q	Oxidation: 4
1443	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	84	409.54	1225.61	409.54	1225.61	3	-3.51	11.6	22543	24	1	143 - 153	K.SVHEPMQTGLK.A
1443	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	3	457.57	1369.70	457.57	1369.70	3	-2.27	8.4	3280	50	3	142 - 153	R.KSVHEPMQTGLK.A	Oxidation: 7
1443	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	150	406.21	1215.62	406.21	1215.62	3	-1.57	13.2	9173	24	2	109 - 120	R.VVDAMGVPIDGK.G	Oxidation: 5
1443	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	37	621.81	1241.60	621.81	1241.61	2	-2.86	9.8	13776	38	2	143 - 153	K.SVHEPMQTGLK.A	Oxidation: 6
1443	ATMG01190.1	alpha-1 subunit	complex V	a) oxidative phosphorylation	mitochondria	107	702.44	701.43	702.44	701.43	1	-2.70	12.2	28350	38	3	427 - 432	R.LTEVLK.Q
180	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	159	665.88	1329.74	665.88	1329.75	2	-6.63	19	3616	44	1	448 - 459	K.TTIAIDTILNQK.Q
180	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	157	625.82	1249.62	625.82	1249.63	2	-6.47	18.9	3610	76	1	277 - 287	R.AAELTNLFESR.I
253	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	11	457.57	1369.69	457.57	1369.70	3	-12.10	8.71305	8184	40	1	412 - 423	R.KSVHEPMQTGLK.A	Oxidation: 7
253	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	307	625.82	1249.62	625.82	1249.63	2	-8.16	19.02039167	28977	91	2	277 - 287	R.AAELTNLFESR.I
253	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	189	408.23	814.44	408.23	814.45	2	-14.48	15.1497	5993	27	1	437 - 443	R.ELLIGDR.Q
253	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	240	513.80	1025.58	513.80	1025.59	2	-10.80	16.74816667	19041	39	2	424 - 433	K.AVDSLVPIGR.G
253	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	235	513.79	1025.58	513.80	1025.59	2	-11.38	16.62738333	14827	57	2	424 - 433	K.AVDSLVPIGR.G
253	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	41	414.87	1241.59	414.88	1241.61	3	-13.78	10.04943333	9777	32	2	413 - 423	K.SVHEPMQTGLK.A	Oxidation: 6
253	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	1	506.74	1011.46	506.74	1011.47	2	-12.75	8.335875	5846	58	1	391 - 399	K.GALSDHEQR.R
253	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	314	665.88	1329.74	665.88	1329.75	2	-10.01	19.22179167	9283	83	2	448 - 459	K.TTIAIDTILNQK.Q
253	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	312	625.82	1249.62	625.82	1249.63	2	-9.92	19.14116667	10471	71	2	277 - 287	R.AAELTNLFESR.I
253	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	141	522.28	1042.55	522.29	1042.57	2	-11.51	13.644625	24629	51	1	363 - 373	R.TGSIVDVPAGK.A
253	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	310	665.88	1329.74	665.88	1329.75	2	-11.06	19.11438333	13486	70	2	448 - 459	K.TTIAIDTILNQK.Q
253	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	296	614.64	1840.90	614.65	1840.92	3	-10.82	18.65741667	4309	54	1	288 - 302	R.IRNFYANFQVDEIGR.V
253	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	137	608.81	1215.60	608.82	1215.62	2	-10.74	13.537225	21905	64	1	379 - 390	R.VVDAMGVPIDGK.G	Oxidation: 5
253	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	281	574.27	1719.80	574.28	1719.81	3	-7.73	18.1191	4448	52	1	532 - 546	R.DNGMHALIIYDDLSK.Q	Oxidation: 4
253	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	39	414.87	1241.59	414.88	1241.61	3	-14.02	9.98221667	8345	28	2	413 - 423	K.SVHEPMQTGLK.A	Oxidation: 6
323	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	228	665.89	1329.76	665.88	1329.75	2	6.00	21	5256	28	2	448 - 459	K.TTIAIDTILNQK.Q
323	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	225	665.89	1329.76	665.88	1329.75	2	8.70	20.9	4240	57	2	448 - 459	K.TTIAIDTILNQK.Q
323	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	65	522.29	1042.57	522.29	1042.57	2	4.84	15.3	5545	22	1	363 - 373	R.TGSIVDVPAGK.A
323	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	223	625.83	1249.64	625.82	1249.63	2	10.23	20.8	7981	65	1	277 - 287	R.AAELTNLFESR.I
323	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	244	500.35	499.34	500.34	499.34	1	2.66	21.7	7162	26	1	773 - 777	R.ALALI.-
385	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	296	625.82	1249.62	625.82	1249.63	2	-10.51	20.8	11393	50	1	277 - 287	R.AAELTNLFESR.I
385	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	302	665.87	1329.73	665.88	1329.75	2	-11.62	21	17548	21	1	448 - 459	K.TTIAIDTILNQK.Q
449	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	28	621.80	1241.58	621.81	1241.61	2	-19.10	11.3	23712	25	3	413 - 423	K.SVHEPMQTGLK.A	Oxidation: 6
449	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	27	414.87	1241.58	414.88	1241.61	3	-19.08	11.3	101092	46	3	413 - 423	K.SVHEPMQTGLK.A	Oxidation: 6
449	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	260	574.27	1719.78	574.28	1719.81	3	-17.04	19.9	13871	48	2	532 - 546	R.DNGMHALIIYDDLSK.Q	Oxidation: 4
449	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	79	600.33	1198.65	600.34	1198.67	2	-10.94	13.9	14074	19	1	362 - 373	K.RTGSIVDVPAGK.A
449	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	281	513.24	1536.71	513.25	1536.74	3	-18.98	20.6	46296	46	3	565 - 577	R.EAFPGDVFYLHSR.L
449	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	107	608.80	1215.60	608.82	1215.62	2	-17.85	15	146914	93	3	379 - 390	R.VVDAMGVPIDGK.G	Oxidation: 5
449	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	204	480.28	1437.81	480.29	1437.84	3	-19.49	18	13726	41	2	633 - 646	R.GIRPAINVGLSVSR.V
449	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	290	625.81	1249.61	625.82	1249.63	2	-16.81	20.8	222911	95	3	277 - 287	R.AAELTNLFESR.I
449	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	201	480.28	1437.82	480.29	1437.84	3	-17.88	17.9	23616	58	2	633 - 646	R.GIRPAINVGLSVSR.V
449	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	211	513.79	1025.57	513.80	1025.59	2	-18.56	18.3	140396	54	3	424 - 433	K.AVDSLVPIGR.G
449	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	311	500.34	499.33	500.34	499.34	1	-17.49	21.5	130891	22	2	773 - 777	R.ALALI.-
449	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	111	1043.55	1042.55	1043.57	1042.57	1	-17.55	15.1	18730	22	1	363 - 373	R.TGSIVDVPAGK.A
449	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	113	522.28	1042.55	522.29	1042.57	2	-17.68	15.2	233095	77	3	363 - 373	R.TGSIVDVPAGK.A
449	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	190	600.81	1199.60	600.82	1199.62	2	-18.33	17.6	11952	73	2	379 - 390	R.VVDAMGVPIDGK.G
449	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	214	513.79	1025.57	513.80	1025.59	2	-18.60	18.4	238959	58	3	424 - 433	K.AVDSLVPIGR.G
449	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	24	414.87	1241.58	414.88	1241.61	3	-19.71	11.2	4752	28	3	413 - 423	K.SVHEPMQTGLK.A	Oxidation: 6
449	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	212	1026.58	1025.57	1026.59	1025.59	1	-18.60	18.3	13378	19	1	424 - 433	K.AVDSLVPIGR.G
449	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	193	600.81	1199.60	600.82	1199.62	2	-19.16	17.7	29989	92	2	379 - 390	R.VVDAMGVPIDGK.G
449	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	104	608.80	1215.59	608.82	1215.62	2	-19.87	14.9	7744	84	3	379 - 390	R.VVDAMGVPIDGK.G	Oxidation: 5
449	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	147	446.74	891.46	446.75	891.48	2	-19.51	16.2	20639	53	3	665 - 671	K.LELAQYR.E
449	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	280	769.36	1536.71	769.38	1536.74	2	-18.60	20.5	9328	16	1	565 - 577	R.EAFPGDVFYLHSR.L
449	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	307	500.34	499.33	500.34	499.34	1	-17.45	21.4	171979	28	2	773 - 777	R.ALALI.-
449	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	264	547.79	1093.56	547.78	1093.55	2	15.32	20	38917	24	1	762 - 770	R.KMEPDAFLK.E	Oxidation: 2
449	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	287	625.81	1249.61	625.82	1249.63	2	-15.00	20.7	262124	89	3	277 - 287	R.AAELTNLFESR.I
449	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	26	621.80	1241.58	621.81	1241.61	2	-19.01	11.3	7960	30	3	413 - 423	K.SVHEPMQTGLK.A	Oxidation: 6
449	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	149	446.74	891.46	446.75	891.48	2	-18.54	16.3	204732	59	3	665 - 671	K.LELAQYR.E
449	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	110	522.28	1042.55	522.29	1042.57	2	-17.53	15.1	219708	77	3	363 - 373	R.TGSIVDVPAGK.A
449	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	25	414.87	1241.58	414.88	1241.61	3	-18.99	11.2	35461	42	3	413 - 423	K.SVHEPMQTGLK.A	Oxidation: 6
449	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	155	408.23	814.44	408.23	814.45	2	-19.72	16.5	108845	51	3	437 - 443	R.ELLIGDR.Q
449	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	7	457.57	1369.68	457.57	1369.70	3	-19.16	10	32827	45	1	412 - 423	R.KSVHEPMQTGLK.A	Oxidation: 7
449	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	106	608.80	1215.60	608.82	1215.62	2	-17.75	14.9	44612	82	3	379 - 390	R.VVDAMGVPIDGK.G	Oxidation: 5
449	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	159	408.23	814.44	408.23	814.45	2	-19.84	16.6	57563	55	3	437 - 443	R.ELLIGDR.Q
449	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	306	786.86	1571.71	786.88	1571.74	2	-15.89	21.3	3793	52	1	290 - 302	R.NFYANFQVDEIGR.V
449	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	194	642.34	1282.67	642.35	1282.69	2	-18.92	17.7	24782	48	3	703 - 713	K.QPQYAPLPIEK.Q
449	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	296	665.87	1329.73	665.88	1329.75	2	-17.07	21	120903	80	3	448 - 459	K.TTIAIDTILNQK.Q
449	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	293	665.87	1329.73	665.88	1329.75	2	-17.01	20.9	52150	81	3	448 - 459	K.TTIAIDTILNQK.Q
449	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	295	625.81	1249.61	625.82	1249.63	2	-17.34	21	79489	73	3	277 - 287	R.AAELTNLFESR.I
449	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	217	513.79	1025.57	513.80	1025.59	2	-19.28	18.5	111049	54	3	424 - 433	K.AVDSLVPIGR.G
449	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	31	621.80	1241.58	621.81	1241.61	2	-19.13	11.4	11124	17	3	413 - 423	K.SVHEPMQTGLK.A	Oxidation: 6
449	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	153	408.23	814.44	408.23	814.45	2	-19.13	16.4	52351	55	3	437 - 443	R.ELLIGDR.Q
449	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	284	513.24	1536.71	513.25	1536.74	3	-18.28	20.6	59385	58	3	565 - 577	R.EAFPGDVFYLHSR.L
449	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	278	513.24	1536.71	513.25	1536.74	3	-18.59	20.5	29488	68	3	565 - 577	R.EAFPGDVFYLHSR.L
449	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	265	574.27	1719.79	574.28	1719.81	3	-15.32	20	31834	27	2	532 - 546	R.DNGMHALIIYDDLSK.Q	Oxidation: 4
449	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	299	665.87	1329.73	665.88	1329.75	2	-16.66	21.1	64434	81	3	448 - 459	K.TTIAIDTILNQK.Q
449	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	196	642.34	1282.67	642.35	1282.69	2	-16.56	17.8	94005	64	3	703 - 713	K.QPQYAPLPIEK.Q
449	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	152	446.74	891.46	446.75	891.48	2	-19.48	16.4	121619	56	3	665 - 671	K.LELAQYR.E
449	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	108	522.28	1042.55	522.29	1042.57	2	-19.67	15	12300	77	3	363 - 373	R.TGSIVDVPAGK.A
449	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	199	642.34	1282.67	642.35	1282.69	2	-17.51	17.9	58084	60	3	703 - 713	K.QPQYAPLPIEK.Q
449	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	154	815.45	814.44	815.46	814.45	1	-19.16	16.4	17978	34	1	437 - 443	R.ELLIGDR.Q
574	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	251	642.35	1282.69	642.35	1282.69	2	1.75	17.7	59817	51	1	703 - 713	K.QPQYAPLPIEK.Q
574	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	166	608.82	1215.63	608.82	1215.62	2	7.79	15	111139	77	2	379 - 390	R.VVDAMGVPIDGK.G	Oxidation: 5
574	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	213	438.75	875.49	438.75	875.49	2	1.27	16.5	17651	46	2	553 - 559	R.QMSLLLR.R	Oxidation: 2
574	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	208	446.75	891.49	446.75	891.48	2	4.96	16.3	13522	34	1	665 - 671	K.LELAQYR.E
574	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	270	513.80	1025.59	513.80	1025.59	2	5.14	18.3	24968	46	2	424 - 433	K.AVDSLVPIGR.G
574	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	351	625.83	1249.64	625.82	1249.63	2	8.49	20.8	53968	76	2	277 - 287	R.AAELTNLFESR.I
574	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	1	457.58	1369.70	457.57	1369.70	3	1.36	9.8	47817	32	2	412 - 423	R.KSVHEPMQTGLK.A	Oxidation: 7
574	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	210	408.24	814.46	408.23	814.45	2	4.04	16.4	31699	50	2	437 - 443	R.ELLIGDR.Q
574	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	250	600.82	1199.63	600.82	1199.62	2	5.91	17.6	129437	49	1	379 - 390	R.VVDAMGVPIDGK.G
574	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	170	608.82	1215.63	608.82	1215.62	2	6.64	15.1	108161	55	2	379 - 390	R.VVDAMGVPIDGK.G	Oxidation: 5
574	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	348	625.83	1249.64	625.82	1249.63	2	9.13	20.7	45793	78	2	277 - 287	R.AAELTNLFESR.I
574	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	273	513.80	1025.59	513.80	1025.59	2	3.91	18.4	197981	55	2	424 - 433	K.AVDSLVPIGR.G
574	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	50	414.88	1241.61	414.88	1241.61	3	2.51	11.3	7297	28	2	413 - 423	K.SVHEPMQTGLK.A	Oxidation: 6
574	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	49	414.88	1241.61	414.88	1241.61	3	3.28	11.3	7112	19	2	413 - 423	K.SVHEPMQTGLK.A	Oxidation: 6
574	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	3	457.58	1369.71	457.57	1369.70	3	3.72	9.8	9636	28	2	412 - 423	R.KSVHEPMQTGLK.A	Oxidation: 7
574	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	214	408.24	814.46	408.23	814.45	2	3.36	16.5	19437	51	2	437 - 443	R.ELLIGDR.Q
574	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	212	438.75	875.49	438.75	875.49	2	-0.60	16.4	17878	49	2	553 - 559	R.QMSLLLR.R	Oxidation: 2
650	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	20	608.82	1215.63	608.82	1215.62	2	12.93	15.3	12713	59	2	379 - 390	R.VVDAMGVPIDGK.G	Oxidation: 5
650	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	117	665.89	1329.77	665.88	1329.75	2	11.24	21.2	14743	76	4	448 - 459	K.TTIAIDTILNQK.Q
650	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	90	513.80	1025.59	513.80	1025.59	2	7.52	18.6	10069	45	4	424 - 433	K.AVDSLVPIGR.G
650	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	64	438.75	875.49	438.75	875.49	2	4.37	16.9	6395	50	2	553 - 559	R.QMSLLLR.R	Oxidation: 2
650	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	118	665.89	1329.77	665.88	1329.75	2	12.44	21.3	11216	73	4	448 - 459	K.TTIAIDTILNQK.Q
650	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	79	642.36	1282.71	642.35	1282.69	2	11.89	18.1	7630	31	3	703 - 713	K.QPQYAPLPIEK.Q
650	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	19	608.82	1215.63	608.82	1215.62	2	9.32	15.2	5665	55	2	379 - 390	R.VVDAMGVPIDGK.G	Oxidation: 5
650	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	116	665.89	1329.77	665.88	1329.75	2	12.48	21.2	12701	64	4	448 - 459	K.TTIAIDTILNQK.Q
650	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	88	513.81	1025.60	513.80	1025.59	2	8.41	18.5	14095	54	4	424 - 433	K.AVDSLVPIGR.G
650	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	110	625.83	1249.65	625.82	1249.63	2	12.78	20.9	5333	63	3	277 - 287	R.AAELTNLFESR.I
650	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	63	438.75	875.49	438.75	875.49	2	4.21	16.8	3988	35	2	553 - 559	R.QMSLLLR.R	Oxidation: 2
650	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	56	446.75	891.49	446.75	891.48	2	5.85	16.6	5505	37	2	665 - 671	K.LELAQYR.E
650	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	62	408.24	814.46	408.23	814.45	2	4.97	16.8	4726	38	2	437 - 443	R.ELLIGDR.Q
650	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	114	625.83	1249.65	625.82	1249.63	2	13.10	21.1	13171	67	3	277 - 287	R.AAELTNLFESR.I
650	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	89	513.81	1025.60	513.80	1025.59	2	8.98	18.6	15082	54	4	424 - 433	K.AVDSLVPIGR.G
650	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	115	665.89	1329.77	665.88	1329.75	2	11.31	21.2	6603	85	4	448 - 459	K.TTIAIDTILNQK.Q
650	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	61	408.24	814.46	408.23	814.45	2	5.29	16.8	4719	46	2	437 - 443	R.ELLIGDR.Q
650	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	112	625.83	1249.64	625.82	1249.63	2	11.44	21	19973	91	3	277 - 287	R.AAELTNLFESR.I
650	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	21	522.30	1042.58	522.29	1042.57	2	11.19	15.3	7564	64	2	363 - 373	R.TGSIVDVPAGK.A
650	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	86	513.80	1025.59	513.80	1025.59	2	6.97	18.5	5618	45	4	424 - 433	K.AVDSLVPIGR.G
650	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	23	522.30	1042.58	522.29	1042.57	2	9.97	15.4	10761	59	2	363 - 373	R.TGSIVDVPAGK.A
650	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	59	446.75	891.49	446.75	891.48	2	9.66	16.7	5936	22	2	665 - 671	K.LELAQYR.E
650	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	76	642.36	1282.70	642.35	1282.69	2	9.66	18	3768	58	3	703 - 713	K.QPQYAPLPIEK.Q
650	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	77	642.36	1282.71	642.35	1282.69	2	10.17	18	5819	34	3	703 - 713	K.QPQYAPLPIEK.Q
712	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	347	665.89	1329.76	665.88	1329.75	2	5.32	19.3	423113	106	3	448 - 459	K.TTIAIDTILNQK.Q
712	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	252	642.36	1282.70	642.35	1282.69	2	5.42	16.3	5096	81	3	703 - 713	K.QPQYAPLPIEK.Q
712	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	374	500.35	499.34	500.34	499.34	1	3.06	20.2	9885	25	3	773 - 777	R.ALALI.-
712	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	168	522.29	1042.57	522.29	1042.57	2	3.23	13.7	19194	77	3	363 - 373	R.TGSIVDVPAGK.A
712	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	222	815.46	814.46	815.46	814.45	1	3.05	15.4	8156	38	2	437 - 443	R.ELLIGDR.Q
712	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	227	549.28	2193.09	549.28	2193.08	4	2.48	15.6	15814	81	1	379 - 399	R.VVDAMGVPIDGKGALSDHEQR.R
712	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	209	446.75	891.48	446.75	891.48	2	3.15	15	246745	59	2	665 - 671	K.LELAQYR.E
712	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	165	608.82	1215.62	608.82	1215.62	2	3.73	13.6	5270	75	2	379 - 390	R.VVDAMGVPIDGK.G	Oxidation: 5
712	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	251	600.82	1199.63	600.82	1199.62	2	5.26	16.3	14794	76	1	379 - 390	R.VVDAMGVPIDGK.G
712	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	1	506.74	1011.47	506.74	1011.47	2	-1.56	8.1	10575	75	3	391 - 399	K.GALSDHEQR.R
712	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	79	415.20	1242.59	414.88	1241.61	3	788.84	10.8	13176	21	3	413 - 423	K.SVHEPMQTGLK.A	Oxidation: 6
712	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	162	553.28	2209.08	553.28	2209.08	4	1.59	13.5	433863	59	3	379 - 399	R.VVDAMGVPIDGKGALSDHEQR.R	Oxidation: 5
712	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	3	506.74	1011.47	506.74	1011.47	2	1.30	8.1	207592	80	3	391 - 399	K.GALSDHEQR.R
712	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	389	569.28	1704.81	568.95	1703.82	3	581.44	20.6	4433	39	3	532 - 546	R.DNGMHALIIYDDLSK.Q
712	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	315	860.92	1719.82	860.91	1719.81	2	3.03	18.3	12867	53	1	532 - 546	R.DNGMHALIIYDDLSK.Q	Oxidation: 4
712	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	210	892.49	891.48	892.49	891.48	1	3.16	15	180104	26	1	665 - 671	K.LELAQYR.E
712	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	339	769.38	1536.74	769.38	1536.74	2	2.83	19.1	70043	76	3	565 - 577	R.EAFPGDVFYLHSR.L
712	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	161	553.28	2209.08	553.28	2209.08	4	0.24	13.5	7357	53	3	379 - 399	R.VVDAMGVPIDGKGALSDHEQR.R	Oxidation: 5
712	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	56	414.88	1241.61	414.88	1241.61	3	0.37	10	41784	45	3	413 - 423	K.SVHEPMQTGLK.A	Oxidation: 6
712	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	13	685.86	1369.70	685.86	1369.70	2	-1.18	8.6	4246	37	1	412 - 423	R.KSVHEPMQTGLK.A	Oxidation: 7
712	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	218	438.75	875.49	438.75	875.49	2	-0.44	15.3	93154	43	2	553 - 559	R.QMSLLLR.R	Oxidation: 2
712	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	164	737.37	2209.08	737.37	2209.08	3	1.59	13.6	5537	23	1	379 - 399	R.VVDAMGVPIDGKGALSDHEQR.R	Oxidation: 5
712	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	116	613.81	1225.61	613.81	1225.61	2	0.16	12	17317	37	2	413 - 423	K.SVHEPMQTGLK.A
712	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	220	815.46	814.46	815.46	814.45	1	2.55	15.3	35745	42	2	437 - 443	R.ELLIGDR.Q
712	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	314	574.28	1719.82	574.28	1719.81	3	3.03	18.3	29749	75	2	532 - 546	R.DNGMHALIIYDDLSK.Q	Oxidation: 4
712	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	87	631.32	630.32	631.32	630.32	1	-0.39	11.1	21387	31	2	729 - 733	R.MPLDR.I
712	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	172	1043.57	1042.57	1043.57	1042.57	1	1.49	13.8	5010	39	2	363 - 373	R.TGSIVDVPAGK.A
712	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	169	1043.58	1042.57	1043.57	1042.57	1	3.24	13.7	2911	39	2	363 - 373	R.TGSIVDVPAGK.A
712	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	254	642.36	1282.70	642.35	1282.69	2	5.85	16.4	24434	63	3	703 - 713	K.QPQYAPLPIEK.Q
712	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	377	500.35	499.34	500.34	499.34	1	1.80	20.3	3159	30	3	773 - 777	R.ALALI.-
712	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	12	457.57	1369.70	457.57	1369.70	3	-1.18	8.6	12029	56	2	412 - 423	R.KSVHEPMQTGLK.A	Oxidation: 7
712	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	296	430.75	859.50	430.75	859.49	2	0.38	17.7	93277	53	1	553 - 559	R.QMSLLLR.R
712	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	166	522.29	1042.57	522.29	1042.57	2	1.35	13.6	1879	81	3	363 - 373	R.TGSIVDVPAGK.A
712	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	115	409.54	1225.61	409.54	1225.61	3	0.15	12	21953	39	2	413 - 423	K.SVHEPMQTGLK.A
712	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	167	553.28	2209.08	553.28	2209.08	4	-0.16	13.7	36464	22	3	379 - 399	R.VVDAMGVPIDGKGALSDHEQR.R	Oxidation: 5
712	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	57	621.81	1241.61	621.81	1241.61	2	0.37	10	18443	54	2	413 - 423	K.SVHEPMQTGLK.A	Oxidation: 6
712	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	276	513.80	1025.59	513.80	1025.59	2	1.13	17.1	5234	50	4	424 - 433	K.AVDSLVPIGR.G
712	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	336	769.38	1536.74	769.38	1536.74	2	2.73	19	35635	81	3	565 - 577	R.EAFPGDVFYLHSR.L
712	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	257	513.80	1025.59	513.80	1025.59	2	-0.39	16.5	17257	39	4	424 - 433	K.AVDSLVPIGR.G
712	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	15	457.58	1369.70	457.57	1369.70	3	0.88	8.7	4197	57	2	412 - 423	R.KSVHEPMQTGLK.A	Oxidation: 7
712	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	272	513.80	1025.59	513.80	1025.59	2	4.63	17	78540	64	4	424 - 433	K.AVDSLVPIGR.G
712	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	163	608.82	1215.62	608.82	1215.62	2	3.06	13.6	46877	72	2	379 - 390	R.VVDAMGVPIDGK.G	Oxidation: 5
712	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	221	408.24	814.46	408.23	814.45	2	3.04	15.4	12616	49	2	437 - 443	R.ELLIGDR.Q
712	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	346	769.38	1536.74	769.38	1536.74	2	2.43	19.3	14321	34	3	565 - 577	R.EAFPGDVFYLHSR.L
712	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	59	414.88	1241.61	414.88	1241.61	3	1.09	10.1	52600	46	3	413 - 423	K.SVHEPMQTGLK.A	Oxidation: 6
712	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	68	452.24	1353.71	452.24	1353.71	3	0.71	10.4	9637	65	2	412 - 423	R.KSVHEPMQTGLK.A
712	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	271	1026.60	1025.59	1026.59	1025.59	1	3.27	16.9	7698	16	2	424 - 433	K.AVDSLVPIGR.G
712	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	358	786.88	1571.75	786.88	1571.74	2	5.66	19.6	5779	56	1	290 - 302	R.NFYANFQVDEIGR.V
712	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	371	500.35	499.34	500.34	499.34	1	2.54	20.1	17131	28	3	773 - 777	R.ALALI.-
712	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	258	642.36	1282.70	642.35	1282.69	2	4.44	16.5	16631	42	3	703 - 713	K.QPQYAPLPIEK.Q
712	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	65	452.24	1353.71	452.24	1353.71	3	0.62	10.3	19087	53	2	412 - 423	R.KSVHEPMQTGLK.A
712	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	98	442.27	882.53	442.27	882.53	2	-1.37	11.4	68051	38	1	405 - 412	K.APGILERK.S
712	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	418	793.08	2376.21	793.07	2376.20	3	3.66	21.6	4246	30	2	333 - 355	K.GMALNLENENVGIVVFGGDTAIK.E	Oxidation: 2
712	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	329	614.65	1840.93	614.65	1840.92	3	3.69	18.8	138586	33	1	288 - 302	R.IRNFYANFQVDEIGR.V
712	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	112	409.54	1225.61	409.54	1225.61	3	-1.78	11.9	31472	55	2	413 - 423	K.SVHEPMQTGLK.A
712	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	135	600.34	1198.67	600.34	1198.67	2	2.00	12.6	3582	40	2	362 - 373	K.RTGSIVDVPAGK.A
712	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	31	707.38	706.38	707.38	706.38	1	0.58	9.2	35531	37	2	547 - 552	K.QAVAYR.Q
712	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	171	522.29	1042.57	522.29	1042.57	2	1.49	13.8	51886	81	3	363 - 373	R.TGSIVDVPAGK.A
712	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	14	767.39	766.39	767.39	766.39	1	1.52	8.6	7907	29	1	734 - 739	R.ISQYEK.A
712	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	335	513.25	1536.74	513.25	1536.74	3	2.72	19	305604	67	3	565 - 577	R.EAFPGDVFYLHSR.L
712	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	319	574.28	1719.82	574.28	1719.81	3	4.34	18.4	3939	44	2	532 - 546	R.DNGMHALIIYDDLSK.Q	Oxidation: 4
712	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	273	1026.60	1025.59	1026.59	1025.59	1	4.65	17	29080	29	2	424 - 433	K.AVDSLVPIGR.G
712	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	60	621.81	1241.61	621.81	1241.61	2	1.10	10.1	30910	60	2	413 - 423	K.SVHEPMQTGLK.A	Oxidation: 6
712	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	361	568.95	1703.83	568.95	1703.82	3	4.17	19.7	3539	55	3	532 - 546	R.DNGMHALIIYDDLSK.Q
712	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	338	513.25	1536.74	513.25	1536.74	3	2.82	19.1	263788	72	3	565 - 577	R.EAFPGDVFYLHSR.L
712	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	138	600.34	1198.67	600.34	1198.67	2	2.25	12.7	26650	25	2	362 - 373	K.RTGSIVDVPAGK.A
712	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	85	631.32	630.32	631.32	630.32	1	1.21	11	4024	29	2	729 - 733	R.MPLDR.I
712	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	39	773.45	772.45	773.45	772.44	1	1.72	9.5	15101	44	2	647 - 654	R.VGSAAQLK.A
712	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	344	625.83	1249.64	625.82	1249.63	2	4.95	19.2	85542	94	2	277 - 287	R.AAELTNLFESR.I
712	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	364	568.95	1703.82	568.95	1703.82	3	2.86	19.8	22130	43	3	532 - 546	R.DNGMHALIIYDDLSK.Q
712	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	35	773.45	772.45	773.45	772.44	1	2.24	9.4	24876	39	2	647 - 654	R.VGSAAQLK.A
712	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	341	625.83	1249.64	625.82	1249.63	2	6.62	19.2	128422	94	2	277 - 287	R.AAELTNLFESR.I
712	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	269	513.80	1025.59	513.80	1025.59	2	3.27	16.9	13771	62	4	424 - 433	K.AVDSLVPIGR.G
712	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	250	480.29	1437.84	480.29	1437.84	3	2.36	16.3	6038	56	1	633 - 646	R.GIRPAINVGLSVSR.V
712	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	219	408.24	814.46	408.23	814.45	2	2.55	15.3	120135	49	2	437 - 443	R.ELLIGDR.Q
712	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	215	438.75	875.49	438.75	875.49	2	0.61	15.2	284171	51	2	553 - 559	R.QMSLLLR.R	Oxidation: 2
712	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	294	665.88	1329.75	665.88	1329.75	2	2.87	17.7	69947	25	3	448 - 459	K.TTIAIDTILNQK.Q
712	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	10	408.73	815.45	408.73	815.45	2	-3.90	8.5	20821	50	1	356 - 362	K.EGDLVKR.T
712	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	32	707.39	706.38	707.38	706.38	1	2.93	9.3	18960	41	2	547 - 552	K.QAVAYR.Q
712	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	159	755.44	754.43	755.44	754.43	1	1.25	13.4	596982	17	1	405 - 411	K.APGILER.K
712	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	350	665.89	1329.76	665.88	1329.75	2	5.22	19.4	290189	110	3	448 - 459	K.TTIAIDTILNQK.Q
712	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	113	613.81	1225.61	613.81	1225.61	2	-1.78	11.9	23411	55	2	413 - 423	K.SVHEPMQTGLK.A
712	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	212	446.75	891.48	446.75	891.48	2	0.84	15.1	137287	53	2	665 - 671	K.LELAQYR.E
712	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	416	793.08	2376.21	793.07	2376.20	3	3.98	21.5	5542	35	2	333 - 355	K.GMALNLENENVGIVVFGGDTAIK.E	Oxidation: 2
712	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	6	506.74	1011.47	506.74	1011.47	2	0.15	8.2	132642	62	3	391 - 399	K.GALSDHEQR.R
712	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	334	513.25	1536.74	513.25	1536.74	3	3.03	18.9	45659	64	3	565 - 577	R.EAFPGDVFYLHSR.L
712	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	242	452.26	902.50	451.76	901.51	2	1100.83	16.1	187835	15	1	553 - 559	R.QMSLLLR.R	Acetyl: 1
781	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	197	438.75	875.48	438.75	875.49	2	-10.51	15.5	8245	42	2	553 - 559	R.QMSLLLR.R	Oxidation: 2
781	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	230	642.35	1282.68	642.35	1282.69	2	-7.73	16.5	5989	35	1	703 - 713	K.QPQYAPLPIEK.Q
781	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	249	513.80	1025.58	513.80	1025.59	2	-8.97	17.1	3694	30	2	424 - 433	K.AVDSLVPIGR.G
781	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	43	414.87	1241.59	414.88	1241.61	3	-12.79	10.2	50541	36	3	413 - 423	K.SVHEPMQTGLK.A	Oxidation: 6
781	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	147	522.28	1042.55	522.29	1042.57	2	-12.74	13.9	11778	78	3	363 - 373	R.TGSIVDVPAGK.A
781	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	15	457.57	1369.69	457.57	1369.70	3	-10.53	8.8	3480	44	2	412 - 423	R.KSVHEPMQTGLK.A	Oxidation: 7
781	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	42	414.87	1241.59	414.88	1241.61	3	-11.88	10.1	108591	34	3	413 - 423	K.SVHEPMQTGLK.A	Oxidation: 6
781	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	2	506.74	1011.46	506.74	1011.47	2	-9.65	8.3	167753	54	3	391 - 399	K.GALSDHEQR.R
781	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	11	408.73	815.44	408.73	815.45	2	-15.25	8.6	8571	21	1	356 - 362	K.EGDLVKR.T
781	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	321	665.88	1329.74	665.88	1329.75	2	-6.12	19.4	9670	85	1	448 - 459	K.TTIAIDTILNQK.Q
781	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	183	446.74	891.47	446.75	891.48	2	-10.55	15.1	16170	59	1	665 - 671	K.LELAQYR.E
781	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	1	506.74	1011.46	506.74	1011.47	2	-10.27	8.3	4143	52	3	391 - 399	K.GALSDHEQR.R
781	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	314	513.25	1536.72	513.25	1536.74	3	-8.30	19.2	20266	62	2	565 - 577	R.EAFPGDVFYLHSR.L
781	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	315	625.82	1249.62	625.82	1249.63	2	-6.20	19.2	242784	99	1	277 - 287	R.AAELTNLFESR.I
781	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	45	414.87	1241.60	414.88	1241.61	3	-9.83	10.3	95808	16	3	413 - 423	K.SVHEPMQTGLK.A	Oxidation: 6
781	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	44	621.80	1241.59	621.81	1241.61	2	-12.80	10.2	9502	15	1	413 - 423	K.SVHEPMQTGLK.A	Oxidation: 6
781	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	227	600.81	1199.61	600.82	1199.62	2	-7.86	16.4	5478	45	1	379 - 390	R.VVDAMGVPIDGK.G
781	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	143	608.81	1215.61	608.82	1215.62	2	-9.67	13.8	11803	84	3	379 - 390	R.VVDAMGVPIDGK.G	Oxidation: 5
781	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	334	568.94	1703.81	568.95	1703.82	3	-6.87	19.8	41520	30	1	532 - 546	R.DNGMHALIIYDDLSK.Q
781	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	247	513.80	1025.58	513.80	1025.59	2	-6.24	17.1	7420	51	2	424 - 433	K.AVDSLVPIGR.G
781	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	146	608.81	1215.61	608.82	1215.62	2	-9.56	13.9	3619	95	3	379 - 390	R.VVDAMGVPIDGK.G	Oxidation: 5
781	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	18	457.57	1369.69	457.57	1369.70	3	-9.72	8.9	3866	19	2	412 - 423	R.KSVHEPMQTGLK.A	Oxidation: 7
781	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	152	522.29	1042.56	522.29	1042.57	2	-9.41	14.1	19695	78	3	363 - 373	R.TGSIVDVPAGK.A
781	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	149	522.29	1042.56	522.29	1042.57	2	-9.96	14	18649	83	3	363 - 373	R.TGSIVDVPAGK.A
781	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	310	513.25	1536.72	513.25	1536.74	3	-8.52	19.1	21944	68	2	565 - 577	R.EAFPGDVFYLHSR.L
781	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	142	608.81	1215.60	608.82	1215.62	2	-10.89	13.8	5338	78	3	379 - 390	R.VVDAMGVPIDGK.G	Oxidation: 5
781	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	301	614.64	1840.91	614.65	1840.92	3	-5.11	18.8	130471	38	1	288 - 302	R.IRNFYANFQVDEIGR.V
781	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	4	506.74	1011.46	506.74	1011.47	2	-9.42	8.4	4239	48	3	391 - 399	K.GALSDHEQR.R
781	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	193	408.23	814.45	408.23	814.45	2	-10.93	15.4	4987	53	1	437 - 443	R.ELLIGDR.Q
781	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	192	438.75	875.48	438.75	875.49	2	-10.81	15.4	4230	50	2	553 - 559	R.QMSLLLR.R	Oxidation: 2
841	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	208	513.79	1025.57	513.80	1025.59	2	-12.26	16.7	11063	25	2	424 - 433	K.AVDSLVPIGR.G
841	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	81	608.81	1215.60	608.82	1215.62	2	-12.43	13.6	3629	56	1	379 - 390	R.VVDAMGVPIDGK.G	Oxidation: 5
841	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	287	625.82	1249.62	625.82	1249.63	2	-10.55	19.1	15559	63	1	277 - 287	R.AAELTNLFESR.I
841	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	87	522.28	1042.55	522.29	1042.57	2	-13.47	13.8	6347	40	2	363 - 373	R.TGSIVDVPAGK.A
841	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	210	513.79	1025.57	513.80	1025.59	2	-11.85	16.8	3404	32	2	424 - 433	K.AVDSLVPIGR.G
841	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	84	522.28	1042.55	522.29	1042.57	2	-14.46	13.7	5308	24	2	363 - 373	R.TGSIVDVPAGK.A
841	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	293	665.87	1329.73	665.88	1329.75	2	-11.65	19.3	2242	68	1	448 - 459	K.TTIAIDTILNQK.Q
878	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	410	665.87	1329.73	665.88	1329.75	2	-11.87	19.1	49651	69	2	448 - 459	K.TTIAIDTILNQK.Q
878	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	26	414.87	1241.60	414.88	1241.61	3	-9.61	9.8	192262	32	3	413 - 423	K.SVHEPMQTGLK.A	Oxidation: 6
878	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	167	522.29	1042.56	522.29	1042.57	2	-9.27	13.5	6443	78	3	363 - 373	R.TGSIVDVPAGK.A
878	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	412	665.88	1329.74	665.88	1329.75	2	-10.12	19.1	25651	82	2	448 - 459	K.TTIAIDTILNQK.Q
878	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	299	513.79	1025.57	513.80	1025.59	2	-13.58	16.5	3725	43	2	424 - 433	K.AVDSLVPIGR.G
878	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	217	446.74	891.47	446.75	891.48	2	-12.25	14.7	3793	43	2	665 - 671	K.LELAQYR.E
878	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	214	446.74	891.47	446.75	891.48	2	-10.84	14.6	4070	39	2	665 - 671	K.LELAQYR.E
878	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	4	457.57	1369.69	457.57	1369.70	3	-8.80	8.6	210826	17	3	412 - 423	R.KSVHEPMQTGLK.A	Oxidation: 7
878	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	169	522.29	1042.56	522.29	1042.57	2	-8.07	13.6	39149	65	3	363 - 373	R.TGSIVDVPAGK.A
878	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	165	608.81	1215.61	608.82	1215.62	2	-8.70	13.5	15700	63	3	379 - 390	R.VVDAMGVPIDGK.G	Oxidation: 5
878	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	27	414.87	1241.60	414.88	1241.61	3	-9.92	9.9	107992	36	3	413 - 423	K.SVHEPMQTGLK.A	Oxidation: 6
878	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	229	408.23	814.44	408.23	814.45	2	-15.21	14.9	6802	29	1	437 - 443	R.ELLIGDR.Q
878	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	161	608.81	1215.61	608.82	1215.62	2	-8.42	13.4	324231	66	3	379 - 390	R.VVDAMGVPIDGK.G	Oxidation: 5
878	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	1	457.57	1369.69	457.57	1369.70	3	-10.29	8.5	53040	17	3	412 - 423	R.KSVHEPMQTGLK.A	Oxidation: 7
878	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	29	414.87	1241.59	414.88	1241.61	3	-11.03	9.9	205803	37	3	413 - 423	K.SVHEPMQTGLK.A	Oxidation: 6
878	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	28	621.80	1241.60	621.81	1241.61	2	-9.92	9.9	492163	28	1	413 - 423	K.SVHEPMQTGLK.A	Oxidation: 6
878	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	164	522.29	1042.56	522.29	1042.57	2	-9.20	13.5	3801	79	3	363 - 373	R.TGSIVDVPAGK.A
878	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	406	625.82	1249.62	625.82	1249.63	2	-9.36	19	17814	90	2	277 - 287	R.AAELTNLFESR.I
878	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	158	608.81	1215.61	608.82	1215.62	2	-8.77	13.3	17892	77	3	379 - 390	R.VVDAMGVPIDGK.G	Oxidation: 5
878	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	409	625.82	1249.62	625.82	1249.63	2	-10.39	19	17793	59	2	277 - 287	R.AAELTNLFESR.I
878	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	227	438.75	875.48	438.75	875.49	2	-12.86	14.9	3765	36	1	553 - 559	R.QMSLLLR.R	Oxidation: 2
878	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	302	513.79	1025.57	513.80	1025.59	2	-12.47	16.6	4389	40	2	424 - 433	K.AVDSLVPIGR.G
878	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	2	457.57	1369.69	457.57	1369.70	3	-12.02	8.5	33321	40	3	412 - 423	R.KSVHEPMQTGLK.A	Oxidation: 7
933	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	270	642.35	1282.69	642.35	1282.69	2	0.13	16	4248	26	3	703 - 713	K.QPQYAPLPIEK.Q
933	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	1	457.58	1369.71	457.57	1369.70	3	2.39	8.6	89299	19	2	412 - 423	R.KSVHEPMQTGLK.A	Oxidation: 7
933	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	2	457.58	1369.71	457.57	1369.70	3	5.16	8.7	22352	33	2	412 - 423	R.KSVHEPMQTGLK.A	Oxidation: 7
933	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	16	414.88	1241.61	414.88	1241.61	3	1.79	10	14797	41	4	413 - 423	K.SVHEPMQTGLK.A	Oxidation: 6
933	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	214	446.75	891.48	446.75	891.48	2	0.24	14.8	9205	55	2	665 - 671	K.LELAQYR.E
933	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	416	665.88	1329.75	665.88	1329.75	2	0.15	19.4	4386	53	3	448 - 459	K.TTIAIDTILNQK.Q
933	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	397	513.25	1536.74	513.25	1536.74	3	3.41	18.9	18440	43	1	565 - 577	R.EAFPGDVFYLHSR.L
933	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	13	414.88	1241.61	414.88	1241.61	3	2.32	9.9	19020	32	4	413 - 423	K.SVHEPMQTGLK.A	Oxidation: 6
933	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	15	414.88	1241.61	414.88	1241.61	3	0.68	9.9	32896	31	4	413 - 423	K.SVHEPMQTGLK.A	Oxidation: 6
933	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	14	414.88	1241.61	414.88	1241.61	3	1.55	9.9	10505	45	4	413 - 423	K.SVHEPMQTGLK.A	Oxidation: 6
933	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	276	480.29	1437.85	480.29	1437.84	3	2.67	16.2	5585	43	1	633 - 646	R.GIRPAINVGLSVSR.V
933	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	225	438.75	875.49	438.75	875.49	2	-2.76	15	11473	42	1	553 - 559	R.QMSLLLR.R	Oxidation: 2
933	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	414	665.88	1329.75	665.88	1329.75	2	0.28	19.3	28738	60	3	448 - 459	K.TTIAIDTILNQK.Q
933	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	294	513.80	1025.59	513.80	1025.59	2	1.13	16.6	25050	43	2	424 - 433	K.AVDSLVPIGR.G
933	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	412	665.88	1329.75	665.88	1329.75	2	0.64	19.3	9537	65	3	448 - 459	K.TTIAIDTILNQK.Q
933	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	221	408.23	814.45	408.23	814.45	2	-4.73	14.9	12933	43	2	437 - 443	R.ELLIGDR.Q
933	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	217	446.75	891.48	446.75	891.48	2	-0.48	14.8	29158	46	2	665 - 671	K.LELAQYR.E
933	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	298	513.80	1025.59	513.80	1025.59	2	2.36	16.7	29209	44	2	424 - 433	K.AVDSLVPIGR.G
933	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	273	642.35	1282.69	642.35	1282.69	2	2.16	16.1	32533	31	3	703 - 713	K.QPQYAPLPIEK.Q
933	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	275	642.35	1282.69	642.35	1282.69	2	2.17	16.1	7410	44	3	703 - 713	K.QPQYAPLPIEK.Q
933	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	224	408.23	814.45	408.23	814.45	2	-1.69	15	6786	39	2	437 - 443	R.ELLIGDR.Q
986	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	127	522.30	1042.58	522.29	1042.57	2	16.73	13.6	11993	72	3	363 - 373	R.TGSIVDVPAGK.A
986	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	192	408.24	814.47	408.23	814.45	2	15.65	15.1	4433	44	3	437 - 443	R.ELLIGDR.Q
986	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	11	621.82	1241.62	621.81	1241.61	2	14.09	10.1	3476	34	2	413 - 423	K.SVHEPMQTGLK.A	Oxidation: 6
986	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	362	513.26	1536.77	513.25	1536.74	3	19.34	19	20438	59	3	565 - 577	R.EAFPGDVFYLHSR.L
986	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	194	815.47	814.47	815.46	814.45	1	15.68	15.2	6671	16	1	437 - 443	R.ELLIGDR.Q
986	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	2	457.58	1369.72	457.57	1369.70	3	15.26	8.7	11523	29	4	412 - 423	R.KSVHEPMQTGLK.A	Oxidation: 7
986	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	260	513.81	1025.61	513.80	1025.59	2	17.85	16.7	28817	53	3	424 - 433	K.AVDSLVPIGR.G
986	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	3	457.58	1369.72	457.57	1369.70	3	14.86	8.7	22146	33	4	412 - 423	R.KSVHEPMQTGLK.A	Oxidation: 7
986	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	183	446.76	891.50	446.75	891.48	2	16.46	14.9	18282	55	3	665 - 671	K.LELAQYR.E
986	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	263	513.81	1025.61	513.80	1025.59	2	17.75	16.7	31186	47	3	424 - 433	K.AVDSLVPIGR.G
986	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	193	438.76	875.50	438.75	875.49	2	12.26	15.1	41033	38	3	553 - 559	R.QMSLLLR.R	Oxidation: 2
986	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	4	457.58	1369.72	457.57	1369.70	3	14.41	8.8	14615	34	4	412 - 423	R.KSVHEPMQTGLK.A	Oxidation: 7
986	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	196	438.76	875.50	438.75	875.49	2	13.26	15.2	5562	32	3	553 - 559	R.QMSLLLR.R	Oxidation: 2
986	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	8	414.88	1241.63	414.88	1241.61	3	14.64	10.1	11973	35	4	413 - 423	K.SVHEPMQTGLK.A	Oxidation: 6
986	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	120	608.83	1215.64	608.82	1215.62	2	19.96	13.5	48390	43	3	379 - 390	R.VVDAMGVPIDGK.G	Oxidation: 5
986	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	133	522.30	1042.58	522.29	1042.57	2	17.40	13.8	16488	72	3	363 - 373	R.TGSIVDVPAGK.A
986	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	364	769.39	1536.77	769.38	1536.74	2	19.37	19	11853	70	1	565 - 577	R.EAFPGDVFYLHSR.L
986	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	185	892.50	891.50	892.49	891.48	1	16.49	15	30934	25	1	665 - 671	K.LELAQYR.E
986	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	261	1026.61	1025.61	1026.59	1025.59	1	17.87	16.7	56102	29	1	424 - 433	K.AVDSLVPIGR.G
986	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	198	438.76	875.50	438.75	875.49	2	14.12	15.3	24173	35	3	553 - 559	R.QMSLLLR.R	Oxidation: 2
986	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	7	414.88	1241.63	414.88	1241.61	3	18.21	10	20438	26	4	413 - 423	K.SVHEPMQTGLK.A	Oxidation: 6
986	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	366	513.26	1536.76	513.25	1536.74	3	16.97	19.1	3476	53	3	565 - 577	R.EAFPGDVFYLHSR.L
986	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	195	408.24	814.47	408.23	814.45	2	15.21	15.2	7571	48	3	437 - 443	R.ELLIGDR.Q
986	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	131	1043.59	1042.58	1043.57	1042.57	1	17.34	13.7	6245	36	2	363 - 373	R.TGSIVDVPAGK.A
986	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	359	513.26	1536.77	513.25	1536.74	3	19.67	18.9	14615	41	3	565 - 577	R.EAFPGDVFYLHSR.L
986	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	181	446.75	891.49	446.75	891.48	2	15.19	14.9	11467	43	3	665 - 671	K.LELAQYR.E
986	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	129	1043.59	1042.58	1043.57	1042.57	1	16.75	13.7	43075	25	2	363 - 373	R.TGSIVDVPAGK.A
986	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	54	409.55	1225.63	409.54	1225.61	3	17.53	11.9	19836	32	1	413 - 423	K.SVHEPMQTGLK.A
986	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	10	414.88	1241.62	414.88	1241.61	3	14.08	10.1	10100	38	4	413 - 423	K.SVHEPMQTGLK.A	Oxidation: 6
986	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	371	625.83	1249.65	625.82	1249.63	2	19.64	19.2	17232	77	1	277 - 287	R.AAELTNLFESR.I
986	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	124	608.83	1215.64	608.82	1215.62	2	17.04	13.6	6714	65	3	379 - 390	R.VVDAMGVPIDGK.G	Oxidation: 5
986	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	190	408.24	814.47	408.23	814.45	2	13.99	15.1	5142	43	3	437 - 443	R.ELLIGDR.Q
986	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	130	522.30	1042.58	522.29	1042.57	2	17.32	13.7	29255	68	3	363 - 373	R.TGSIVDVPAGK.A
986	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	376	665.89	1329.77	665.88	1329.75	2	18.36	19.3	5471	87	1	448 - 459	K.TTIAIDTILNQK.Q
986	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	13	414.88	1241.63	414.88	1241.61	3	15.17	10.2	16741	33	4	413 - 423	K.SVHEPMQTGLK.A	Oxidation: 6
986	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	1	457.58	1369.72	457.57	1369.70	3	16.15	8.7	25271	31	4	412 - 423	R.KSVHEPMQTGLK.A	Oxidation: 7
986	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	122	608.83	1215.64	608.82	1215.62	2	16.59	13.5	5542	58	3	379 - 390	R.VVDAMGVPIDGK.G	Oxidation: 5
986	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	186	446.76	891.50	446.75	891.48	2	16.84	15	30354	49	3	665 - 671	K.LELAQYR.E
986	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	9	621.82	1241.63	621.81	1241.61	2	14.65	10.1	11853	17	2	413 - 423	K.SVHEPMQTGLK.A	Oxidation: 6
986	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	266	513.81	1025.60	513.80	1025.59	2	16.68	16.8	5962	33	3	424 - 433	K.AVDSLVPIGR.G
1048	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	72	737.38	2209.11	737.37	2209.08	3	15.72	13.8	3818	26	1	379 - 399	R.VVDAMGVPIDGKGALSDHEQR.R	Oxidation: 5
1048	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	160	513.81	1025.60	513.80	1025.59	2	15.11	16.8	16830	52	3	424 - 433	K.AVDSLVPIGR.G
1048	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	7	414.88	1241.63	414.88	1241.61	3	14.71	10.1	14547	39	2	413 - 423	K.SVHEPMQTGLK.A	Oxidation: 6
1048	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	198	665.89	1329.77	665.88	1329.75	2	13.13	19.3	5377	76	3	448 - 459	K.TTIAIDTILNQK.Q
1048	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	59	608.83	1215.64	608.82	1215.62	2	15.39	13.5	6362	71	2	379 - 390	R.VVDAMGVPIDGK.G	Oxidation: 5
1048	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	62	608.83	1215.64	608.82	1215.62	2	17.91	13.6	13717	58	2	379 - 390	R.VVDAMGVPIDGK.G	Oxidation: 5
1048	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	201	665.89	1329.77	665.88	1329.75	2	14.06	19.4	5251	31	3	448 - 459	K.TTIAIDTILNQK.Q
1048	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	106	794.44	1586.87	794.43	1586.85	2	16.28	14.7	6508	18	2	363 - 378	R.TGSIVDVPAGKAMLGR.V	Oxidation: 13
1048	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	108	794.44	1586.87	794.43	1586.85	2	16.55	14.7	7853	27	2	363 - 378	R.TGSIVDVPAGKAMLGR.V	Oxidation: 13
1048	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	69	1043.59	1042.58	1043.57	1042.57	1	15.95	13.8	4638	18	1	363 - 373	R.TGSIVDVPAGK.A
1048	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	193	625.83	1249.65	625.82	1249.63	2	12.99	19.2	4513	84	4	277 - 287	R.AAELTNLFESR.I
1048	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	70	553.29	2209.12	553.28	2209.08	4	16.14	13.8	3818	72	3	379 - 399	R.VVDAMGVPIDGKGALSDHEQR.R	Oxidation: 5
1048	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	197	625.83	1249.65	625.82	1249.63	2	15.50	19.3	28344	71	4	277 - 287	R.AAELTNLFESR.I
1048	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	195	625.83	1249.65	625.82	1249.63	2	16.03	19.2	28582	64	4	277 - 287	R.AAELTNLFESR.I
1048	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	67	522.30	1042.58	522.29	1042.57	2	15.94	13.7	46158	68	3	363 - 373	R.TGSIVDVPAGK.A
1048	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	126	408.24	814.47	408.23	814.45	2	13.74	15.2	9823	19	2	437 - 443	R.ELLIGDR.Q
1048	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	2	457.58	1369.72	457.57	1369.70	3	15.87	8.8	6043	16	2	412 - 423	R.KSVHEPMQTGLK.A	Oxidation: 7
1048	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	133	549.29	2193.12	549.28	2193.08	4	16.37	15.4	3214	65	1	379 - 399	R.VVDAMGVPIDGKGALSDHEQR.R
1048	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	61	522.30	1042.58	522.29	1042.57	2	16.77	13.6	12107	78	3	363 - 373	R.TGSIVDVPAGK.A
1048	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	64	522.30	1042.58	522.29	1042.57	2	15.58	13.7	39827	78	3	363 - 373	R.TGSIVDVPAGK.A
1048	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	57	410.57	1228.70	410.57	1228.68	3	16.12	13.3	10061	18	2	437 - 447	R.ELLIGDRQTGK.T
1048	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	158	513.81	1025.60	513.80	1025.59	2	13.82	16.7	11052	52	3	424 - 433	K.AVDSLVPIGR.G
1048	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	199	665.89	1329.77	665.88	1329.75	2	11.97	19.4	5622	57	3	448 - 459	K.TTIAIDTILNQK.Q
1048	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	107	529.96	1586.87	529.96	1586.85	3	16.55	14.7	25474	61	3	363 - 378	R.TGSIVDVPAGKAMLGR.V	Oxidation: 13
1048	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	73	553.29	2209.11	553.28	2209.08	4	15.33	13.9	16833	25	3	379 - 399	R.VVDAMGVPIDGKGALSDHEQR.R	Oxidation: 5
1048	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	162	513.81	1025.60	513.80	1025.59	2	13.78	16.8	13894	42	3	424 - 433	K.AVDSLVPIGR.G
1048	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	125	408.24	814.47	408.23	814.45	2	13.57	15.1	5464	20	2	437 - 443	R.ELLIGDR.Q
1048	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	71	553.29	2209.11	553.28	2209.08	4	15.71	13.8	11483	18	3	379 - 399	R.VVDAMGVPIDGKGALSDHEQR.R	Oxidation: 5
1048	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	56	615.35	1228.69	615.35	1228.68	2	14.10	13.2	4625	27	1	437 - 447	R.ELLIGDRQTGK.T
1048	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	3	457.58	1369.72	457.57	1369.70	3	14.95	8.8	7820	21	2	412 - 423	R.KSVHEPMQTGLK.A	Oxidation: 7
1048	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	194	625.83	1249.65	625.82	1249.63	2	16.70	19.2	15736	90	4	277 - 287	R.AAELTNLFESR.I
1048	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	104	529.97	1586.87	529.96	1586.85	3	18.00	14.6	8454	55	3	363 - 378	R.TGSIVDVPAGKAMLGR.V	Oxidation: 13
1048	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	55	410.57	1228.69	410.57	1228.68	3	14.08	13.2	8903	40	2	437 - 447	R.ELLIGDRQTGK.T
1048	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	105	529.96	1586.87	529.96	1586.85	3	16.27	14.7	21442	68	3	363 - 378	R.TGSIVDVPAGKAMLGR.V	Oxidation: 13
1048	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	6	414.88	1241.62	414.88	1241.61	3	13.12	10.1	12048	38	2	413 - 423	K.SVHEPMQTGLK.A	Oxidation: 6
1105	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	338	665.89	1329.77	665.88	1329.75	2	12.84	19.3	6676	76	2	448 - 459	K.TTIAIDTILNQK.Q
1105	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	11	621.82	1241.62	621.81	1241.61	2	12.74	10	34686	19	2	413 - 423	K.SVHEPMQTGLK.A	Oxidation: 6
1105	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	120	615.35	1228.69	615.35	1228.68	2	11.26	13.2	16368	22	3	437 - 447	R.ELLIGDRQTGK.T
1105	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	194	408.24	814.46	408.23	814.45	2	11.78	15	10361	36	3	437 - 443	R.ELLIGDR.Q
1105	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	314	614.66	1840.95	614.65	1840.92	3	15.19	18.8	22678	48	2	288 - 302	R.IRNFYANFQVDEIGR.V
1105	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	137	1043.59	1042.58	1043.57	1042.57	1	16.45	13.6	6332	29	1	363 - 373	R.TGSIVDVPAGK.A
1105	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	117	615.35	1228.69	615.35	1228.68	2	12.56	13.1	8933	26	3	437 - 447	R.ELLIGDRQTGK.T
1105	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	115	410.57	1228.69	410.57	1228.68	3	12.57	13.1	90161	35	3	437 - 447	R.ELLIGDRQTGK.T
1105	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	332	625.83	1249.65	625.82	1249.63	2	14.78	19.2	9654	70	3	277 - 287	R.AAELTNLFESR.I
1105	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	113	410.57	1228.69	410.57	1228.68	3	12.57	13	8445	24	3	437 - 447	R.ELLIGDRQTGK.T
1105	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	2	457.58	1369.72	457.57	1369.70	3	10.95	8.7	42841	34	4	412 - 423	R.KSVHEPMQTGLK.A	Oxidation: 7
1105	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	195	438.76	875.50	438.75	875.49	2	10.68	15	534	32	3	553 - 559	R.QMSLLLR.R	Oxidation: 2
1105	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	253	513.81	1025.60	513.80	1025.59	2	13.30	16.7	18677	45	3	424 - 433	K.AVDSLVPIGR.G
1105	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	329	625.83	1249.65	625.82	1249.63	2	15.02	19.1	4833	83	3	277 - 287	R.AAELTNLFESR.I
1105	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	328	625.83	1249.65	625.82	1249.63	2	16.06	19.1	5072	76	3	277 - 287	R.AAELTNLFESR.I
1105	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	135	522.30	1042.58	522.29	1042.57	2	16.44	13.6	3986	78	3	363 - 373	R.TGSIVDVPAGK.A
1105	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	31	442.28	882.54	442.27	882.53	2	11.06	11.2	12745	55	3	405 - 412	K.APGILERK.S
1105	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	29	442.28	882.54	442.27	882.53	2	9.89	11.1	16627	33	3	405 - 412	K.APGILERK.S
1105	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	197	438.76	875.50	438.75	875.49	2	10.61	15.1	9202	26	3	553 - 559	R.QMSLLLR.R	Oxidation: 2
1105	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	5	457.58	1369.72	457.57	1369.70	3	10.73	8.8	10866	18	4	412 - 423	R.KSVHEPMQTGLK.A	Oxidation: 7
1105	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	119	410.57	1228.69	410.57	1228.68	3	11.25	13.2	28312	19	3	437 - 447	R.ELLIGDRQTGK.T
1105	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	138	522.30	1042.58	522.29	1042.57	2	15.96	13.7	5007	72	3	363 - 373	R.TGSIVDVPAGK.A
1105	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	114	615.35	1228.69	615.35	1228.68	2	12.59	13	6436	25	3	437 - 447	R.ELLIGDRQTGK.T
1105	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	322	513.26	1536.75	513.25	1536.74	3	10.59	19	11422	50	2	565 - 577	R.EAFPGDVFYLHSR.L
1105	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	192	438.76	875.50	438.75	875.49	2	6.47	15	17497	34	3	553 - 559	R.QMSLLLR.R	Oxidation: 2
1105	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	247	513.81	1025.60	513.80	1025.59	2	13.26	16.6	47548	43	3	424 - 433	K.AVDSLVPIGR.G
1105	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	191	408.24	814.46	408.23	814.45	2	10.14	15	23363	25	3	437 - 443	R.ELLIGDR.Q
1105	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	35	442.28	882.54	442.27	882.53	2	13.21	11.2	4708	18	3	405 - 412	K.APGILERK.S
1105	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	10	621.82	1241.62	621.81	1241.61	2	13.01	10	15518	28	2	413 - 423	K.SVHEPMQTGLK.A	Oxidation: 6
1105	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	144	553.29	2209.11	553.28	2209.08	4	15.65	13.8	8167	23	2	379 - 399	R.VVDAMGVPIDGKGALSDHEQR.R	Oxidation: 5
1105	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	132	522.30	1042.58	522.29	1042.57	2	14.79	13.5	16645	73	3	363 - 373	R.TGSIVDVPAGK.A
1105	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	225	480.29	1437.86	480.29	1437.84	3	12.95	16	27363	52	1	633 - 646	R.GIRPAINVGLSVSR.V
1105	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	12	414.88	1241.62	414.88	1241.61	3	13.50	10.1	26428	35	2	413 - 423	K.SVHEPMQTGLK.A	Oxidation: 6
1105	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	4	457.58	1369.72	457.57	1369.70	3	13.95	8.8	6522	32	4	412 - 423	R.KSVHEPMQTGLK.A	Oxidation: 7
1105	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	9	414.88	1241.62	414.88	1241.61	3	12.64	10	43776	32	2	413 - 423	K.SVHEPMQTGLK.A	Oxidation: 6
1105	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	141	553.29	2209.11	553.28	2209.08	4	15.69	13.7	8031	33	2	379 - 399	R.VVDAMGVPIDGKGALSDHEQR.R	Oxidation: 5
1105	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	335	665.89	1329.77	665.88	1329.75	2	14.90	19.3	12774	85	2	448 - 459	K.TTIAIDTILNQK.Q
1105	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	320	513.26	1536.76	513.25	1536.74	3	14.57	18.9	37866	73	2	565 - 577	R.EAFPGDVFYLHSR.L
1105	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	250	513.81	1025.60	513.80	1025.59	2	13.43	16.7	15522	43	3	424 - 433	K.AVDSLVPIGR.G
1105	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	3	457.58	1369.72	457.57	1369.70	3	11.28	8.7	28215	45	4	412 - 423	R.KSVHEPMQTGLK.A	Oxidation: 7
1105	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	199	408.24	814.46	408.23	814.45	2	11.02	15.1	5927	42	3	437 - 443	R.ELLIGDR.Q
1105	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	316	614.66	1840.95	614.65	1840.92	3	16.67	18.8	6768	42	2	288 - 302	R.IRNFYANFQVDEIGR.V
1159	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	221	815.47	814.46	815.46	814.45	1	11.55	14.9	34016	27	1	437 - 443	R.ELLIGDR.Q
1159	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	158	1043.59	1042.58	1043.57	1042.57	1	14.73	13.5	12915	39	2	363 - 373	R.TGSIVDVPAGK.A
1159	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	223	408.24	814.46	408.23	814.45	2	11.95	15	58526	39	3	437 - 443	R.ELLIGDR.Q
1159	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	16	621.82	1241.62	621.81	1241.61	2	12.08	10	5347	25	3	413 - 423	K.SVHEPMQTGLK.A	Oxidation: 6
1159	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	157	522.30	1042.58	522.29	1042.57	2	14.72	13.5	92401	66	3	363 - 373	R.TGSIVDVPAGK.A
1159	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	215	446.75	891.49	446.75	891.48	2	12.30	14.8	74077	54	3	665 - 671	K.LELAQYR.E
1159	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	292	1026.61	1025.60	1026.59	1025.59	1	13.20	16.6	8535	28	1	424 - 433	K.AVDSLVPIGR.G
1159	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	3	457.58	1369.72	457.57	1369.70	3	11.11	8.7	5186	41	4	412 - 423	R.KSVHEPMQTGLK.A	Oxidation: 7
1159	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	404	665.89	1329.77	665.88	1329.75	2	11.52	19.1	10954	94	3	448 - 459	K.TTIAIDTILNQK.Q
1159	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	154	608.82	1215.63	608.82	1215.62	2	14.70	13.4	131060	60	3	379 - 390	R.VVDAMGVPIDGK.G	Oxidation: 5
1159	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	18	414.88	1241.63	414.88	1241.61	3	15.77	10	13914	35	1	413 - 423	K.SVHEPMQTGLK.A	Oxidation: 6
1159	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	272	642.36	1282.71	642.35	1282.69	2	13.08	16.2	6268	32	3	703 - 713	K.QPQYAPLPIEK.Q
1159	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	386	513.26	1536.75	513.25	1536.74	3	11.88	18.7	14906	42	3	565 - 577	R.EAFPGDVFYLHSR.L
1159	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	385	513.26	1536.76	513.25	1536.74	3	14.32	18.7	26362	33	3	565 - 577	R.EAFPGDVFYLHSR.L
1159	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	150	608.82	1215.62	608.82	1215.62	2	3.14	13.3	36610	57	3	379 - 390	R.VVDAMGVPIDGK.G	Oxidation: 5
1159	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	398	625.83	1249.65	625.82	1249.63	2	13.33	19	18423	89	3	277 - 287	R.AAELTNLFESR.I
1159	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	405	625.83	1249.65	625.82	1249.63	2	12.82	19.2	7438	80	3	277 - 287	R.AAELTNLFESR.I
1159	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	288	513.81	1025.60	513.80	1025.59	2	12.61	16.5	132562	53	3	424 - 433	K.AVDSLVPIGR.G
1159	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	394	769.38	1536.75	769.38	1536.74	2	12.00	18.9	74110	58	1	565 - 577	R.EAFPGDVFYLHSR.L
1159	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	418	786.89	1571.76	786.88	1571.74	2	14.05	19.5	28069	67	1	290 - 302	R.NFYANFQVDEIGR.V
1159	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	218	446.75	891.49	446.75	891.48	2	12.61	14.8	22958	54	3	665 - 671	K.LELAQYR.E
1159	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	287	513.80	1025.60	513.80	1025.59	2	7.94	16.5	22274	53	3	424 - 433	K.AVDSLVPIGR.G
1159	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	390	513.26	1536.75	513.25	1536.74	3	12.11	18.8	7804	53	3	565 - 577	R.EAFPGDVFYLHSR.L
1159	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	388	614.66	1840.95	614.65	1840.92	3	15.11	18.8	17221	29	1	288 - 302	R.IRNFYANFQVDEIGR.V
1159	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	227	408.24	814.46	408.23	814.45	2	10.56	15	22347	43	3	437 - 443	R.ELLIGDR.Q
1159	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	2	457.58	1369.72	457.57	1369.70	3	13.23	8.7	24485	39	4	412 - 423	R.KSVHEPMQTGLK.A	Oxidation: 7
1159	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	411	665.89	1329.77	665.88	1329.75	2	11.97	19.3	8840	72	3	448 - 459	K.TTIAIDTILNQK.Q
1159	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	407	665.89	1329.77	665.88	1329.75	2	11.49	19.2	23386	95	3	448 - 459	K.TTIAIDTILNQK.Q
1159	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	226	438.76	875.50	438.75	875.49	2	8.38	15	793	34	2	553 - 559	R.QMSLLLR.R	Oxidation: 2
1159	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	15	621.82	1241.63	621.81	1241.61	2	14.43	9.9	25855	47	3	413 - 423	K.SVHEPMQTGLK.A	Oxidation: 6
1159	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	225	438.76	875.50	438.75	875.49	2	9.25	15	16828	28	2	553 - 559	R.QMSLLLR.R	Oxidation: 2
1159	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	220	408.24	814.46	408.23	814.45	2	11.54	14.9	106974	43	3	437 - 443	R.ELLIGDR.Q
1159	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	401	625.83	1249.65	625.82	1249.63	2	13.95	19.1	5420	90	3	277 - 287	R.AAELTNLFESR.I
1159	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	260	600.83	1199.64	600.82	1199.62	2	12.96	15.9	25986	35	1	379 - 390	R.VVDAMGVPIDGK.G
1159	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	468	1189.12	2376.23	1189.11	2376.20	2	12.97	21.4	26275	51	1	333 - 355	K.GMALNLENENVGIVVFGGDTAIK.E	Oxidation: 2
1159	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	5	457.58	1369.72	457.57	1369.70	3	10.67	8.7	7191	34	4	412 - 423	R.KSVHEPMQTGLK.A	Oxidation: 7
1159	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	270	642.36	1282.71	642.35	1282.69	2	14.84	16.1	7464	41	3	703 - 713	K.QPQYAPLPIEK.Q
1159	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	267	642.36	1282.71	642.35	1282.69	2	11.53	16	24867	33	3	703 - 713	K.QPQYAPLPIEK.Q
1159	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	17	621.82	1241.62	621.81	1241.61	2	11.31	10	12916	24	3	413 - 423	K.SVHEPMQTGLK.A	Oxidation: 6
1159	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	155	522.30	1042.58	522.29	1042.57	2	14.72	13.4	19706	68	3	363 - 373	R.TGSIVDVPAGK.A
1159	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	1	457.58	1369.72	457.57	1369.70	3	14.69	8.6	4607	28	4	412 - 423	R.KSVHEPMQTGLK.A	Oxidation: 7
1159	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	291	513.81	1025.60	513.80	1025.59	2	13.18	16.6	6689	66	3	424 - 433	K.AVDSLVPIGR.G
1159	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	152	608.82	1215.63	608.82	1215.62	2	10.83	13.4	57134	56	3	379 - 390	R.VVDAMGVPIDGK.G	Oxidation: 5
1159	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	212	446.75	891.49	446.75	891.48	2	5.41	14.7	119032	45	3	665 - 671	K.LELAQYR.E
1159	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	160	522.30	1042.58	522.29	1042.57	2	14.37	13.5	13220	71	3	363 - 373	R.TGSIVDVPAGK.A
1159	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	162	1043.59	1042.58	1043.57	1042.57	1	14.38	13.6	5063	29	2	363 - 373	R.TGSIVDVPAGK.A
1218	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	268	600.82	1199.63	600.82	1199.62	2	7.11	15.8	11100	59	2	379 - 390	R.VVDAMGVPIDGK.G
1218	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	157	608.82	1215.62	608.82	1215.62	2	5.54	13.2	59623	58	3	379 - 390	R.VVDAMGVPIDGK.G	Oxidation: 5
1218	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	215	446.75	891.49	446.75	891.48	2	5.76	14.5	28046	46	2	665 - 671	K.LELAQYR.E
1218	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	390	513.26	1536.75	513.25	1536.74	3	10.09	18.6	57979	53	3	565 - 577	R.EAFPGDVFYLHSR.L
1218	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	22	621.81	1241.61	621.81	1241.61	2	4.17	9.9	176367	27	2	413 - 423	K.SVHEPMQTGLK.A	Oxidation: 6
1218	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	160	522.30	1042.58	522.29	1042.57	2	9.36	13.3	32418	78	3	363 - 373	R.TGSIVDVPAGK.A
1218	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	1	457.58	1369.71	457.57	1369.70	3	6.54	8.5	87343	38	3	412 - 423	R.KSVHEPMQTGLK.A	Oxidation: 7
1218	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	163	522.29	1042.57	522.29	1042.57	2	8.40	13.4	3603	66	3	363 - 373	R.TGSIVDVPAGK.A
1218	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	24	452.24	1353.71	452.24	1353.71	3	1.37	9.9	29914	16	4	412 - 423	R.KSVHEPMQTGLK.A
1218	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	404	625.83	1249.64	625.82	1249.63	2	8.33	18.9	35072	78	2	277 - 287	R.AAELTNLFESR.I
1218	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	226	408.24	814.46	408.23	814.45	2	6.05	14.8	7852	39	3	437 - 443	R.ELLIGDR.Q
1218	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	21	414.88	1241.61	414.88	1241.61	3	4.18	9.8	47646	37	3	413 - 423	K.SVHEPMQTGLK.A	Oxidation: 6
1218	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	413	665.89	1329.76	665.88	1329.75	2	7.08	19.1	23290	95	2	448 - 459	K.TTIAIDTILNQK.Q
1218	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	389	614.65	1840.93	614.65	1840.92	3	6.89	18.5	123009	45	2	288 - 302	R.IRNFYANFQVDEIGR.V
1218	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	27	452.24	1353.71	452.24	1353.71	3	3.10	10	45911	40	4	412 - 423	R.KSVHEPMQTGLK.A
1218	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	2	457.58	1369.71	457.57	1369.70	3	5.21	8.5	30623	41	3	412 - 423	R.KSVHEPMQTGLK.A	Oxidation: 7
1218	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	3	685.86	1369.71	685.86	1369.70	2	5.21	8.6	32806	19	1	412 - 423	R.KSVHEPMQTGLK.A	Oxidation: 7
1218	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	416	665.89	1329.76	665.88	1329.75	2	8.26	19.2	12868	86	2	448 - 459	K.TTIAIDTILNQK.Q
1218	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	19	621.81	1241.61	621.81	1241.61	2	4.47	9.8	269374	31	2	413 - 423	K.SVHEPMQTGLK.A	Oxidation: 6
1218	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	243	549.28	2193.10	549.28	2193.08	4	6.50	15.1	261779	22	1	379 - 399	R.VVDAMGVPIDGKGALSDHEQR.R
1218	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	299	513.80	1025.59	513.80	1025.59	2	7.24	16.5	10146	47	3	424 - 433	K.AVDSLVPIGR.G
1218	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	222	408.24	814.46	408.23	814.45	2	1.44	14.7	4573	43	3	437 - 443	R.ELLIGDR.Q
1218	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	164	608.82	1215.63	608.82	1215.62	2	7.48	13.4	5855	60	3	379 - 390	R.VVDAMGVPIDGK.G	Oxidation: 5
1218	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	225	815.47	814.46	815.46	814.45	1	5.17	14.7	8836	31	2	437 - 443	R.ELLIGDR.Q
1218	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	296	513.80	1025.59	513.80	1025.59	2	6.78	16.4	30045	43	3	424 - 433	K.AVDSLVPIGR.G
1218	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	166	522.29	1042.57	522.29	1042.57	2	7.46	13.4	4282	66	3	363 - 373	R.TGSIVDVPAGK.A
1218	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	394	614.65	1840.94	614.65	1840.92	3	8.34	18.6	36776	60	2	288 - 302	R.IRNFYANFQVDEIGR.V
1218	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	165	1043.58	1042.57	1043.57	1042.57	1	8.40	13.4	5244	32	2	363 - 373	R.TGSIVDVPAGK.A
1218	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	219	446.75	891.49	446.75	891.48	2	5.07	14.6	74945	55	2	665 - 671	K.LELAQYR.E
1218	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	393	513.26	1536.75	513.25	1536.74	3	6.48	18.6	64294	53	3	565 - 577	R.EAFPGDVFYLHSR.L
1218	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	55	442.27	882.53	442.27	882.53	2	1.43	10.9	32819	24	1	405 - 412	K.APGILERK.S
1218	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	231	438.75	875.49	438.75	875.49	2	2.66	14.9	261390	40	3	553 - 559	R.QMSLLLR.R	Oxidation: 2
1218	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	25	452.24	1353.71	452.24	1353.71	3	3.30	10	353209	48	4	412 - 423	R.KSVHEPMQTGLK.A
1218	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	227	438.75	875.49	438.75	875.49	2	3.82	14.8	3550	33	3	553 - 559	R.QMSLLLR.R	Oxidation: 2
1218	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	15	414.88	1241.62	414.88	1241.61	3	8.01	9.7	2820	40	3	413 - 423	K.SVHEPMQTGLK.A	Oxidation: 6
1218	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	4	457.58	1369.71	457.57	1369.70	3	3.59	8.6	103868	42	3	412 - 423	R.KSVHEPMQTGLK.A	Oxidation: 7
1218	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	28	452.25	1353.71	452.24	1353.71	3	4.44	10.1	536365	41	4	412 - 423	R.KSVHEPMQTGLK.A
1218	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	264	600.82	1199.63	600.82	1199.62	2	5.11	15.7	46848	58	2	379 - 390	R.VVDAMGVPIDGK.G
1218	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	224	438.75	875.49	438.75	875.49	2	2.59	14.7	4545	36	3	553 - 559	R.QMSLLLR.R	Oxidation: 2
1218	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	228	815.47	814.46	815.46	814.45	1	6.07	14.8	207315	16	2	437 - 443	R.ELLIGDR.Q
1218	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	162	1043.58	1042.58	1043.57	1042.57	1	9.36	13.3	5373	36	2	363 - 373	R.TGSIVDVPAGK.A
1218	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	293	513.80	1025.59	513.80	1025.59	2	6.54	16.4	50508	53	3	424 - 433	K.AVDSLVPIGR.G
1218	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	407	625.83	1249.64	625.82	1249.63	2	7.83	18.9	12131	80	2	277 - 287	R.AAELTNLFESR.I
1218	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	396	513.26	1536.75	513.25	1536.74	3	6.81	18.7	22191	53	3	565 - 577	R.EAFPGDVFYLHSR.L
1218	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	271	480.29	1437.85	480.29	1437.84	3	7.96	15.9	47840	48	1	633 - 646	R.GIRPAINVGLSVSR.V
1218	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	297	1026.60	1025.59	1026.59	1025.59	1	6.78	16.5	61990	16	1	424 - 433	K.AVDSLVPIGR.G
1218	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	18	414.88	1241.61	414.88	1241.61	3	4.47	9.8	20305	37	3	413 - 423	K.SVHEPMQTGLK.A	Oxidation: 6
1218	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	161	608.82	1215.63	608.82	1215.62	2	9.10	13.3	21578	65	3	379 - 390	R.VVDAMGVPIDGK.G	Oxidation: 5
1218	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	223	408.24	814.46	408.23	814.45	2	5.17	14.7	4651	46	3	437 - 443	R.ELLIGDR.Q
1274	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	451	1330.76	1329.75	1330.76	1329.75	1	-0.43	19	14973	15	2	448 - 459	K.TTIAIDTILNQK.Q
1274	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	452	665.88	1329.75	665.88	1329.75	2	-1.89	19	8205	74	3	448 - 459	K.TTIAIDTILNQK.Q
1274	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	45	621.81	1241.61	621.81	1241.61	2	0.63	9.8	124535	46	2	413 - 423	K.SVHEPMQTGLK.A	Oxidation: 6
1274	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	165	755.44	754.43	755.44	754.43	1	-1.75	12.6	20696	29	2	405 - 411	K.APGILER.K
1274	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	334	1026.59	1025.59	1026.59	1025.59	1	-1.40	16.4	127160	22	1	424 - 433	K.AVDSLVPIGR.G
1274	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	258	408.23	814.45	408.23	814.45	2	-3.43	14.7	542711	37	3	437 - 443	R.ELLIGDR.Q
1274	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	444	625.82	1249.63	625.82	1249.63	2	-0.83	18.9	56247	78	3	277 - 287	R.AAELTNLFESR.I
1274	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	449	665.88	1329.75	665.88	1329.75	2	-0.43	19	4303	87	3	448 - 459	K.TTIAIDTILNQK.Q
1274	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	430	614.65	1840.92	614.65	1840.92	3	0.34	18.5	66480	37	2	288 - 302	R.IRNFYANFQVDEIGR.V
1274	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	427	513.25	1536.74	513.25	1536.74	3	-0.20	18.5	77421	52	3	565 - 577	R.EAFPGDVFYLHSR.L
1274	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	432	513.25	1536.73	513.25	1536.74	3	-4.02	18.6	72674	59	3	565 - 577	R.EAFPGDVFYLHSR.L
1274	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	198	522.29	1042.56	522.29	1042.57	2	-1.08	13.3	65374	77	3	363 - 373	R.TGSIVDVPAGK.A
1274	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	7	457.58	1369.70	457.57	1369.70	3	0.79	8.6	8802	42	3	412 - 423	R.KSVHEPMQTGLK.A	Oxidation: 7
1274	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	1	457.58	1369.71	457.57	1369.70	3	3.26	8.4	91571	35	3	412 - 423	R.KSVHEPMQTGLK.A	Oxidation: 7
1274	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	333	513.80	1025.59	513.80	1025.59	2	-1.40	16.4	320958	66	3	424 - 433	K.AVDSLVPIGR.G
1274	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	455	665.88	1329.75	665.88	1329.75	2	-2.77	19.1	14701	69	3	448 - 459	K.TTIAIDTILNQK.Q
1274	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	42	621.81	1241.61	621.81	1241.61	2	-0.48	9.8	125612	49	2	413 - 423	K.SVHEPMQTGLK.A	Oxidation: 6
1274	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	472	786.88	1571.74	786.88	1571.74	2	1.85	19.5	11137	50	1	290 - 302	R.NFYANFQVDEIGR.V
1274	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	260	815.46	814.45	815.46	814.45	1	-3.44	14.7	39413	34	3	437 - 443	R.ELLIGDR.Q
1274	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	453	1330.76	1329.75	1330.76	1329.75	1	-1.88	19.1	354077	30	2	448 - 459	K.TTIAIDTILNQK.Q
1274	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	52	452.24	1353.71	452.24	1353.71	3	1.39	10	24566	43	3	412 - 423	R.KSVHEPMQTGLK.A
1274	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	261	408.23	814.45	408.23	814.45	2	-4.04	14.8	318372	37	3	437 - 443	R.ELLIGDR.Q
1274	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	169	755.44	754.43	755.44	754.43	1	-1.71	12.7	6373	21	2	405 - 411	K.APGILER.K
1274	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	407	574.29	1719.84	574.28	1719.81	3	13.03	18	24566	33	1	532 - 546	R.DNGMHALIIYDDLSK.Q	Oxidation: 4
1274	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	51	677.86	1353.71	677.86	1353.71	2	0.43	10	79671	36	2	412 - 423	R.KSVHEPMQTGLK.A
1274	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	192	608.81	1215.61	608.82	1215.62	2	-1.59	13.2	3967	59	3	379 - 390	R.VVDAMGVPIDGK.G	Oxidation: 5
1274	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	373	860.50	859.49	860.50	859.49	1	-5.25	17.3	9184	31	2	553 - 559	R.QMSLLLR.R
1274	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	668	1031.87	3092.58	1031.87	3092.59	3	-1.36	24.4	153004	65	1	303 - 332	R.VVSVGDGIAQVYGLNEIQAGEMVLFANGVK.G	Oxidation: 22
1274	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	437	625.82	1249.63	625.82	1249.63	2	-0.33	18.7	33023	90	3	277 - 287	R.AAELTNLFESR.I
1274	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	53	677.86	1353.71	677.86	1353.71	2	1.38	10	983733	32	2	412 - 423	R.KSVHEPMQTGLK.A
1274	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	41	414.88	1241.61	414.88	1241.61	3	-0.48	9.8	577378	41	3	413 - 423	K.SVHEPMQTGLK.A	Oxidation: 6
1274	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	212	737.37	2209.07	737.37	2209.08	3	-2.45	13.6	3578	29	1	379 - 399	R.VVDAMGVPIDGKGALSDHEQR.R	Oxidation: 5
1274	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	262	815.46	814.45	815.46	814.45	1	-4.04	14.8	71896	39	3	437 - 443	R.ELLIGDR.Q
1274	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	371	860.50	859.49	860.50	859.49	1	-4.93	17.2	10422	18	2	553 - 559	R.QMSLLLR.R
1274	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	266	815.46	814.45	815.46	814.45	1	-4.46	14.8	194526	43	3	437 - 443	R.ELLIGDR.Q
1274	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	308	600.82	1199.62	600.82	1199.62	2	-1.42	15.8	313752	68	2	379 - 390	R.VVDAMGVPIDGK.G
1274	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	200	1043.57	1042.56	1043.57	1042.57	1	-1.08	13.4	212951	58	3	363 - 373	R.TGSIVDVPAGK.A
1274	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	39	414.88	1241.60	414.88	1241.61	3	-2.21	9.7	35977	42	3	413 - 423	K.SVHEPMQTGLK.A	Oxidation: 6
1274	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	372	430.75	859.49	430.75	859.49	2	-5.24	17.2	50935	41	2	553 - 559	R.QMSLLLR.R
1274	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	104	409.54	1225.61	409.54	1225.61	3	-1.39	11.2	664388	49	1	413 - 423	K.SVHEPMQTGLK.A
1274	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	197	1043.57	1042.57	1043.57	1042.57	1	0.22	13.3	273099	58	3	363 - 373	R.TGSIVDVPAGK.A
1274	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	257	438.75	875.49	438.75	875.49	2	-4.41	14.6	35941	36	3	553 - 559	R.QMSLLLR.R	Oxidation: 2
1274	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	195	522.29	1042.57	522.29	1042.57	2	0.22	13.3	35780	78	3	363 - 373	R.TGSIVDVPAGK.A
1274	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	441	625.82	1249.63	625.82	1249.63	2	-0.33	18.8	45833	84	3	277 - 287	R.AAELTNLFESR.I
1274	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	44	414.88	1241.61	414.88	1241.61	3	0.63	9.8	650606	44	3	413 - 423	K.SVHEPMQTGLK.A	Oxidation: 6
1274	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	251	446.74	891.47	446.75	891.48	2	-8.25	14.5	92828	55	2	665 - 671	K.LELAQYR.E
1274	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	253	446.75	891.48	446.75	891.48	2	-2.45	14.6	190632	55	2	665 - 671	K.LELAQYR.E
1274	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	460	731.68	2192.02	731.68	2192.02	3	-1.24	19.2	242825	16	1	465 - 483	R.ATSESETMYCVYVAIGQKR.S	Carbamidomethyl: 10
1274	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	409	860.91	1719.81	860.91	1719.81	2	-0.44	18.1	264236	22	1	532 - 546	R.DNGMHALIIYDDLSK.Q	Oxidation: 4
1274	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	429	513.25	1536.73	513.25	1536.74	3	-2.62	18.5	56025	59	3	565 - 577	R.EAFPGDVFYLHSR.L
1274	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	454	444.26	1329.75	444.26	1329.75	3	-1.88	19.1	110393	40	1	448 - 459	K.TTIAIDTILNQK.Q
1274	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	330	513.80	1025.59	513.80	1025.59	2	-1.77	16.3	62037	66	3	424 - 433	K.AVDSLVPIGR.G
1274	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	48	452.24	1353.70	452.24	1353.71	3	-2.45	9.9	64983	53	3	412 - 423	R.KSVHEPMQTGLK.A
1274	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	259	438.75	875.49	438.75	875.49	2	-4.95	14.7	161955	30	3	553 - 559	R.QMSLLLR.R	Oxidation: 2
1274	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	263	438.75	875.48	438.75	875.49	2	-5.82	14.8	51678	37	3	553 - 559	R.QMSLLLR.R	Oxidation: 2
1274	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	199	608.82	1215.62	608.82	1215.62	2	0.00	13.3	19348	58	3	379 - 390	R.VVDAMGVPIDGK.G	Oxidation: 5
1274	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	336	513.80	1025.58	513.80	1025.59	2	-1.96	16.4	502459	66	3	424 - 433	K.AVDSLVPIGR.G
1274	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	425	614.65	1840.92	614.65	1840.92	3	-0.17	18.4	27414	46	2	288 - 302	R.IRNFYANFQVDEIGR.V
1274	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	193	522.29	1042.57	522.29	1042.57	2	-0.68	13.2	5177	78	3	363 - 373	R.TGSIVDVPAGK.A
1274	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	211	553.28	2209.07	553.28	2209.08	4	-2.46	13.6	4734	44	2	379 - 399	R.VVDAMGVPIDGKGALSDHEQR.R	Oxidation: 5
1274	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	49	452.24	1353.71	452.24	1353.71	3	0.42	10	84805	46	3	412 - 423	R.KSVHEPMQTGLK.A
1274	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	203	1043.57	1042.56	1043.57	1042.57	1	-6.09	13.4	23585	39	3	363 - 373	R.TGSIVDVPAGK.A
1274	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	369	430.75	859.49	430.75	859.49	2	-4.93	17.2	19474	36	2	553 - 559	R.QMSLLLR.R
1274	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	196	608.82	1215.62	608.82	1215.62	2	0.68	13.3	35520	60	3	379 - 390	R.VVDAMGVPIDGK.G	Oxidation: 5
1274	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	206	553.28	2209.08	553.28	2209.08	4	0.06	13.5	29871	35	2	379 - 399	R.VVDAMGVPIDGKGALSDHEQR.R	Oxidation: 5
1274	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	305	600.82	1199.62	600.82	1199.62	2	0.25	15.7	137481	63	2	379 - 390	R.VVDAMGVPIDGK.G
1274	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	264	408.23	814.45	408.23	814.45	2	-4.46	14.8	286015	40	3	437 - 443	R.ELLIGDR.Q
1274	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	4	457.57	1369.70	457.57	1369.70	3	0.44	8.5	56908	40	3	412 - 423	R.KSVHEPMQTGLK.A	Oxidation: 7
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	267	438.75	875.48	438.75	875.49	2	-9.28	14.5	47201	35	3	553 - 559	R.QMSLLLR.R	Oxidation: 2
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	319	642.35	1282.68	642.35	1282.69	2	-10.49	15.7	64716	59	3	703 - 713	K.QPQYAPLPIEK.Q
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	49	414.87	1241.60	414.88	1241.61	3	-4.43	9.6	3722	38	3	413 - 423	K.SVHEPMQTGLK.A	Oxidation: 6
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	268	408.23	814.45	408.23	814.45	2	-8.28	14.5	189587	39	3	437 - 443	R.ELLIGDR.Q
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	264	438.75	875.48	438.75	875.49	2	-10.19	14.4	43862	31	3	553 - 559	R.QMSLLLR.R	Oxidation: 2
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	566	793.07	2376.18	793.07	2376.20	3	-8.20	21.2	43384	78	1	333 - 355	K.GMALNLENENVGIVVFGGDTAIK.E	Oxidation: 2
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	690	774.15	3092.56	774.15	3092.59	4	-7.87	24.3	151715	99	3	303 - 332	R.VVSVGDGIAQVYGLNEIQAGEMVLFANGVK.G	Oxidation: 22
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	263	446.74	891.47	446.75	891.48	2	-8.76	14.4	71515	55	2	665 - 671	K.LELAQYR.E
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	600	869.94	1737.87	869.95	1737.89	2	-8.15	21.9	533803	50	2	714 - 728	K.QILVIYAAVNGFCDR.M	Carbamidomethyl: 13
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	466	665.88	1329.74	665.88	1329.75	2	-8.00	19	16168	86	3	448 - 459	K.TTIAIDTILNQK.Q
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	343	513.80	1025.58	513.80	1025.59	2	-9.18	16.2	219696	66	3	424 - 433	K.AVDSLVPIGR.G
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	383	860.49	859.48	860.50	859.49	1	-12.09	17.1	344402	31	2	553 - 559	R.QMSLLLR.R
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	480	786.87	1571.72	786.88	1571.74	2	-9.05	19.3	95283	70	3	290 - 302	R.NFYANFQVDEIGR.V
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	259	446.74	891.48	446.75	891.48	2	-6.79	14.3	49099	55	2	665 - 671	K.LELAQYR.E
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	615	1181.10	2360.18	1181.11	2360.20	2	-10.65	22.3	44900	54	1	333 - 355	K.GMALNLENENVGIVVFGGDTAIK.E
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	439	513.25	1536.72	513.25	1536.74	3	-8.71	18.4	37376	61	3	565 - 577	R.EAFPGDVFYLHSR.L
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	1	457.57	1369.69	457.57	1369.70	3	-6.27	8.3	4047	34	3	412 - 423	R.KSVHEPMQTGLK.A	Oxidation: 7
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	53	621.81	1241.60	621.81	1241.61	2	-5.42	9.7	5900	55	3	413 - 423	K.SVHEPMQTGLK.A	Oxidation: 6
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	686	1031.86	3092.55	1031.87	3092.59	3	-11.93	24.2	40448	61	4	303 - 332	R.VVSVGDGIAQVYGLNEIQAGEMVLFANGVK.G	Oxidation: 22
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	464	1330.75	1329.74	1330.76	1329.75	1	-8.98	18.9	204933	19	2	448 - 459	K.TTIAIDTILNQK.Q
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	463	665.88	1329.74	665.88	1329.75	2	-8.98	18.9	26781	83	3	448 - 459	K.TTIAIDTILNQK.Q
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	385	430.75	859.48	430.75	859.49	2	-11.83	17.2	46974	40	2	553 - 559	R.QMSLLLR.R
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	341	1026.58	1025.58	1026.59	1025.59	1	-9.36	16.2	15429	25	3	424 - 433	K.AVDSLVPIGR.G
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	704	1026.52	3076.55	1026.54	3076.59	3	-13.26	24.7	35566	23	3	303 - 332	R.VVSVGDGIAQVYGLNEIQAGEMVLFANGVK.G
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	482	786.87	1571.72	786.88	1571.74	2	-9.28	19.3	669727	71	3	290 - 302	R.NFYANFQVDEIGR.V
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	55	452.24	1353.70	452.24	1353.71	3	-6.32	9.7	15151	48	3	412 - 423	R.KSVHEPMQTGLK.A
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	205	522.28	1042.55	522.29	1042.57	2	-11.65	13.1	65586	78	3	363 - 373	R.TGSIVDVPAGK.A
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	346	513.80	1025.58	513.80	1025.59	2	-9.61	16.3	30416	66	3	424 - 433	K.AVDSLVPIGR.G
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	206	608.81	1215.61	608.82	1215.62	2	-7.93	13.1	7940	63	3	379 - 390	R.VVDAMGVPIDGK.G	Oxidation: 5
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	201	1043.56	1042.56	1043.57	1042.57	1	-8.83	13	8888	71	3	363 - 373	R.TGSIVDVPAGK.A
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	57	677.86	1353.70	677.86	1353.71	2	-6.33	9.7	10791	51	2	412 - 423	R.KSVHEPMQTGLK.A
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	52	452.24	1353.70	452.24	1353.71	3	-7.05	9.7	8818	45	3	412 - 423	R.KSVHEPMQTGLK.A
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	687	1031.86	3092.55	1031.87	3092.59	3	-10.20	24.3	37666	105	4	303 - 332	R.VVSVGDGIAQVYGLNEIQAGEMVLFANGVK.G	Oxidation: 22
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	597	869.94	1737.87	869.95	1737.89	2	-10.53	21.9	286777	72	2	714 - 728	K.QILVIYAAVNGFCDR.M	Carbamidomethyl: 13
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	272	815.45	814.45	815.46	814.45	1	-8.86	14.6	9186	17	2	437 - 443	R.ELLIGDR.Q
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	688	774.15	3092.55	774.15	3092.59	4	-10.19	24.3	25962	118	3	303 - 332	R.VVSVGDGIAQVYGLNEIQAGEMVLFANGVK.G	Oxidation: 22
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	345	1026.58	1025.58	1026.59	1025.59	1	-9.21	16.2	8121	23	3	424 - 433	K.AVDSLVPIGR.G
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	175	755.44	754.43	755.44	754.43	1	-6.96	12.4	129701	25	3	405 - 411	K.APGILER.K
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	340	513.80	1025.58	513.80	1025.59	2	-9.36	16.1	145835	66	3	424 - 433	K.AVDSLVPIGR.G
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	204	1043.56	1042.56	1043.57	1042.57	1	-8.35	13.1	12530	64	3	363 - 373	R.TGSIVDVPAGK.A
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	50	621.81	1241.60	621.81	1241.61	2	-4.43	9.6	9126	51	3	413 - 423	K.SVHEPMQTGLK.A	Oxidation: 6
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	266	408.23	814.45	408.23	814.45	2	-8.48	14.5	61963	37	3	437 - 443	R.ELLIGDR.Q
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	460	665.88	1329.74	665.88	1329.75	2	-8.06	18.8	159133	89	3	448 - 459	K.TTIAIDTILNQK.Q
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	203	608.81	1215.61	608.82	1215.62	2	-8.59	13.1	21846	73	3	379 - 390	R.VVDAMGVPIDGK.G	Oxidation: 5
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	3	457.57	1369.69	457.57	1369.70	3	-6.18	8.3	13382	47	3	412 - 423	R.KSVHEPMQTGLK.A	Oxidation: 7
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	45	414.87	1241.60	414.88	1241.61	3	-5.51	9.5	9528	38	3	413 - 423	K.SVHEPMQTGLK.A	Oxidation: 6
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	210	1043.56	1042.55	1043.57	1042.57	1	-16.27	13.2	12299	32	3	363 - 373	R.TGSIVDVPAGK.A
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	315	642.35	1282.68	642.35	1282.69	2	-9.33	15.6	6562	52	3	703 - 713	K.QPQYAPLPIEK.Q
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	59	677.86	1353.70	677.86	1353.71	2	-6.61	9.8	10583	28	2	412 - 423	R.KSVHEPMQTGLK.A
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	382	430.75	859.48	430.75	859.49	2	-12.08	17.1	11330	38	2	553 - 559	R.QMSLLLR.R
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	445	513.25	1536.72	513.25	1536.74	3	-7.88	18.5	149282	60	3	565 - 577	R.EAFPGDVFYLHSR.L
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	489	568.94	1703.80	568.95	1703.82	3	-8.74	19.5	68310	41	2	532 - 546	R.DNGMHALIIYDDLSK.Q
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	713	1026.53	3076.57	1026.54	3076.59	3	-6.48	25	13382	114	3	303 - 332	R.VVSVGDGIAQVYGLNEIQAGEMVLFANGVK.G
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	261	892.48	891.48	892.49	891.48	1	-6.80	14.3	38626	34	1	665 - 671	K.LELAQYR.E
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	269	438.75	875.48	438.75	875.49	2	-9.69	14.5	59762	38	3	553 - 559	R.QMSLLLR.R	Oxidation: 2
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	271	408.23	814.45	408.23	814.45	2	-8.84	14.6	42097	42	3	437 - 443	R.ELLIGDR.Q
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	387	860.49	859.48	860.50	859.49	1	-11.85	17.2	90274	35	2	553 - 559	R.QMSLLLR.R
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	46	414.87	1241.60	414.88	1241.61	3	-4.11	9.5	9276	41	3	413 - 423	K.SVHEPMQTGLK.A	Oxidation: 6
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	6	457.57	1369.69	457.57	1369.70	3	-7.40	8.4	29835	40	3	412 - 423	R.KSVHEPMQTGLK.A	Oxidation: 7
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	488	852.91	1703.80	852.92	1703.82	2	-8.74	19.4	98382	47	1	532 - 546	R.DNGMHALIIYDDLSK.Q
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	311	600.81	1199.61	600.82	1199.62	2	-9.67	15.5	7896	66	2	379 - 390	R.VVDAMGVPIDGK.G
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	202	522.29	1042.56	522.29	1042.57	2	-8.34	13	42242	78	3	363 - 373	R.TGSIVDVPAGK.A
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	458	625.82	1249.62	625.82	1249.63	2	-7.14	18.8	266589	90	3	277 - 287	R.AAELTNLFESR.I
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	423	574.27	1719.80	574.28	1719.81	3	-6.75	18	77452	37	2	532 - 546	R.DNGMHALIIYDDLSK.Q	Oxidation: 4
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	462	1330.75	1329.74	1330.76	1329.75	1	-8.07	18.9	40289	25	2	448 - 459	K.TTIAIDTILNQK.Q
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	422	860.91	1719.80	860.91	1719.81	2	-6.76	18	123748	55	1	532 - 546	R.DNGMHALIIYDDLSK.Q	Oxidation: 4
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	451	625.82	1249.62	625.82	1249.63	2	-7.48	18.6	59341	84	3	277 - 287	R.AAELTNLFESR.I
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	200	522.29	1042.56	522.29	1042.57	2	-8.81	13	16184	78	3	363 - 373	R.TGSIVDVPAGK.A
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	173	755.43	754.43	755.44	754.43	1	-8.53	12.4	180133	23	3	405 - 411	K.APGILER.K
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	562	1006.85	3017.52	1006.85	3017.54	3	-6.04	21.1	5782	17	1	333 - 361	K.GMALNLENENVGIVVFGGDTAIKEGDLVK.R	Oxidation: 2
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	465	444.25	1329.74	444.26	1329.75	3	-8.97	18.9	35823	56	1	448 - 459	K.TTIAIDTILNQK.Q
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	179	755.43	754.43	755.44	754.43	1	-8.33	12.5	58953	22	3	405 - 411	K.APGILER.K
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	7	685.85	1369.69	685.86	1369.70	2	-7.41	8.4	24662	17	2	412 - 423	R.KSVHEPMQTGLK.A	Oxidation: 7
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	565	1189.10	2376.18	1189.11	2376.20	2	-8.19	21.2	12299	67	1	333 - 355	K.GMALNLENENVGIVVFGGDTAIK.E	Oxidation: 2
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	485	786.87	1571.72	786.88	1571.74	2	-8.63	19.4	655966	68	3	290 - 302	R.NFYANFQVDEIGR.V
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	153	400.56	1198.66	400.56	1198.67	3	-5.94	11.9	88456	28	1	362 - 373	K.RTGSIVDVPAGK.A
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	419	574.27	1719.80	574.28	1719.81	3	-6.77	17.9	95905	53	2	532 - 546	R.DNGMHALIIYDDLSK.Q	Oxidation: 4
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	116	409.54	1225.60	409.54	1225.61	3	-6.74	11.1	48172	44	2	413 - 423	K.SVHEPMQTGLK.A
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	348	1026.58	1025.58	1026.59	1025.59	1	-9.62	16.3	6229	20	3	424 - 433	K.AVDSLVPIGR.G
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	47	621.81	1241.60	621.81	1241.61	2	-4.11	9.5	4119	53	3	413 - 423	K.SVHEPMQTGLK.A	Oxidation: 6
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	442	513.25	1536.72	513.25	1536.74	3	-8.17	18.4	89285	57	3	565 - 577	R.EAFPGDVFYLHSR.L
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	689	1031.86	3092.56	1031.87	3092.59	3	-7.88	24.3	203231	160	4	303 - 332	R.VVSVGDGIAQVYGLNEIQAGEMVLFANGVK.G	Oxidation: 22
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	199	608.81	1215.61	608.82	1215.62	2	-8.06	13	67563	60	3	379 - 390	R.VVDAMGVPIDGK.G	Oxidation: 5
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	692	774.15	3092.56	774.15	3092.59	4	-7.96	24.4	452432	84	3	303 - 332	R.VVSVGDGIAQVYGLNEIQAGEMVLFANGVK.G	Oxidation: 22
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	58	452.24	1353.70	452.24	1353.71	3	-6.61	9.8	56236	51	3	412 - 423	R.KSVHEPMQTGLK.A
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	317	642.35	1282.68	642.35	1282.69	2	-9.55	15.6	27705	51	3	703 - 713	K.QPQYAPLPIEK.Q
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	712	1026.53	3076.57	1026.54	3076.59	3	-8.16	24.9	3766	106	3	303 - 332	R.VVSVGDGIAQVYGLNEIQAGEMVLFANGVK.G
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	314	600.81	1199.61	600.82	1199.62	2	-10.05	15.5	8279	71	2	379 - 390	R.VVDAMGVPIDGK.G
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	114	409.54	1225.60	409.54	1225.61	3	-7.42	11	9707	50	2	413 - 423	K.SVHEPMQTGLK.A
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	4	685.85	1369.69	685.86	1369.70	2	-6.18	8.3	10082	36	2	412 - 423	R.KSVHEPMQTGLK.A	Oxidation: 7
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	531	569.27	1704.79	568.95	1703.82	3	569.53	20.4	125011	23	2	532 - 546	R.DNGMHALIIYDDLSK.Q
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	270	815.46	814.45	815.46	814.45	1	-8.28	14.5	26801	39	2	437 - 443	R.ELLIGDR.Q
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	682	1032.19	3093.54	1031.87	3092.59	3	309.45	24.1	152394	38	4	303 - 332	R.VVSVGDGIAQVYGLNEIQAGEMVLFANGVK.G	Oxidation: 22
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	455	625.82	1249.62	625.82	1249.63	2	-7.72	18.7	579309	90	3	277 - 287	R.AAELTNLFESR.I
1332	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	440	769.37	1536.72	769.38	1536.74	2	-8.71	18.4	720136	76	1	565 - 577	R.EAFPGDVFYLHSR.L
1386	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	421	513.25	1536.73	513.25	1536.74	3	-3.98	18.8	86688	58	3	565 - 577	R.EAFPGDVFYLHSR.L
1386	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	327	513.80	1025.58	513.80	1025.59	2	-5.37	16.7	113596	54	3	424 - 433	K.AVDSLVPIGR.G
1386	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	618	1031.87	3092.58	1031.87	3092.59	3	-2.13	24.4	8540	77	5	303 - 332	R.VVSVGDGIAQVYGLNEIQAGEMVLFANGVK.G	Oxidation: 22
1386	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	43	621.81	1241.60	621.81	1241.61	2	-3.73	10.1	126057	33	2	413 - 423	K.SVHEPMQTGLK.A	Oxidation: 6
1386	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	259	815.46	814.45	815.46	814.45	1	-5.83	15.1	7079	43	1	437 - 443	R.ELLIGDR.Q
1386	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	332	1026.59	1025.58	1026.59	1025.59	1	-6.02	16.8	37222	27	3	424 - 433	K.AVDSLVPIGR.G
1386	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	256	408.23	814.45	408.23	814.45	2	-6.25	15	6348	37	3	437 - 443	R.ELLIGDR.Q
1386	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	419	769.37	1536.73	769.38	1536.74	2	-1.74	18.8	50981	54	3	565 - 577	R.EAFPGDVFYLHSR.L
1386	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	4	457.57	1369.70	457.57	1369.70	3	-3.78	8.7	25809	44	2	412 - 423	R.KSVHEPMQTGLK.A	Oxidation: 7
1386	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	42	414.87	1241.60	414.88	1241.61	3	-3.73	10.1	23025	46	3	413 - 423	K.SVHEPMQTGLK.A	Oxidation: 6
1386	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	436	665.88	1329.74	665.88	1329.75	2	-4.89	19.2	359240	99	3	448 - 459	K.TTIAIDTILNQK.Q
1386	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	258	438.75	875.48	438.75	875.49	2	-7.03	15.1	9713	35	3	553 - 559	R.QMSLLLR.R	Oxidation: 2
1386	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	435	625.82	1249.63	625.82	1249.63	2	-3.15	19.2	23754	73	3	277 - 287	R.AAELTNLFESR.I
1386	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	196	1043.57	1042.56	1043.57	1042.57	1	-4.01	13.7	8976	30	2	363 - 373	R.TGSIVDVPAGK.A
1386	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	458	786.87	1571.73	786.88	1571.74	2	-3.40	19.7	15898	68	2	290 - 302	R.NFYANFQVDEIGR.V
1386	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	326	1026.59	1025.58	1026.59	1025.59	1	-6.11	16.6	58530	36	3	424 - 433	K.AVDSLVPIGR.G
1386	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	532	1189.11	2376.20	1189.11	2376.20	2	-1.69	21.4	140422	42	3	333 - 355	K.GMALNLENENVGIVVFGGDTAIK.E	Oxidation: 2
1386	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	572	1181.11	2360.20	1181.11	2360.20	2	-3.64	22.5	19439	40	3	333 - 355	K.GMALNLENENVGIVVFGGDTAIK.E
1386	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	530	1189.11	2376.20	1189.11	2376.20	2	-0.60	21.3	43895	16	3	333 - 355	K.GMALNLENENVGIVVFGGDTAIK.E	Oxidation: 2
1386	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	324	513.80	1025.58	513.80	1025.59	2	-6.09	16.6	109577	66	3	424 - 433	K.AVDSLVPIGR.G
1386	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	193	1043.57	1042.56	1043.57	1042.57	1	-4.16	13.6	6287	52	2	363 - 373	R.TGSIVDVPAGK.A
1386	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	438	665.88	1329.75	665.88	1329.75	2	-2.74	19.2	83301	94	3	448 - 459	K.TTIAIDTILNQK.Q
1386	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	184	608.81	1215.61	608.82	1215.62	2	-6.24	13.4	114329	63	3	379 - 390	R.VVDAMGVPIDGK.G	Oxidation: 5
1386	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	113	409.54	1225.61	409.54	1225.61	3	-4.54	11.8	9479	44	2	413 - 423	K.SVHEPMQTGLK.A
1386	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	189	608.81	1215.61	608.82	1215.62	2	-4.74	13.5	72987	65	3	379 - 390	R.VVDAMGVPIDGK.G	Oxidation: 5
1386	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	248	446.75	891.48	446.75	891.48	2	-6.48	14.9	13567	55	3	665 - 671	K.LELAQYR.E
1386	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	187	608.81	1215.61	608.82	1215.62	2	-5.57	13.5	4816	67	3	379 - 390	R.VVDAMGVPIDGK.G	Oxidation: 5
1386	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	36	414.87	1241.60	414.88	1241.61	3	-4.21	9.9	27892	39	3	413 - 423	K.SVHEPMQTGLK.A	Oxidation: 6
1386	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	424	513.25	1536.73	513.25	1536.74	3	-4.21	18.9	52390	62	3	565 - 577	R.EAFPGDVFYLHSR.L
1386	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	569	787.74	2360.20	787.74	2360.20	3	-3.07	22.4	4301	20	1	333 - 355	K.GMALNLENENVGIVVFGGDTAIK.E
1386	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	263	438.75	875.48	438.75	875.49	2	-7.94	15.2	5259	40	3	553 - 559	R.QMSLLLR.R	Oxidation: 2
1386	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	429	625.82	1249.62	625.82	1249.63	2	-4.52	19	6374	89	3	277 - 287	R.AAELTNLFESR.I
1386	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	261	438.75	875.48	438.75	875.49	2	-6.34	15.2	6523	34	3	553 - 559	R.QMSLLLR.R	Oxidation: 2
1386	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	251	446.75	891.48	446.75	891.48	2	-4.71	14.9	12095	55	3	665 - 671	K.LELAQYR.E
1386	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	426	769.37	1536.73	769.38	1536.74	2	-3.34	19	7659	48	3	565 - 577	R.EAFPGDVFYLHSR.L
1386	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	304	642.35	1282.69	642.35	1282.69	2	-4.48	16.2	12940	40	2	703 - 713	K.QPQYAPLPIEK.Q
1386	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	432	625.82	1249.63	625.82	1249.63	2	-3.83	19.1	7891	84	3	277 - 287	R.AAELTNLFESR.I
1386	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	40	621.81	1241.60	621.81	1241.61	2	-3.50	10	118983	45	2	413 - 423	K.SVHEPMQTGLK.A	Oxidation: 6
1386	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	172	755.44	754.43	755.44	754.43	1	-4.57	13.1	34504	20	1	405 - 411	K.APGILER.K
1386	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	195	522.29	1042.56	522.29	1042.57	2	-4.01	13.7	21887	78	3	363 - 373	R.TGSIVDVPAGK.A
1386	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	503	853.41	1704.80	852.92	1703.82	2	575.11	20.7	9631	15	2	532 - 546	R.DNGMHALIIYDDLSK.Q
1386	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	623	774.15	3092.58	774.15	3092.59	4	-1.39	24.5	21296	62	2	303 - 332	R.VVSVGDGIAQVYGLNEIQAGEMVLFANGVK.G	Oxidation: 22
1386	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	308	642.35	1282.69	642.35	1282.69	2	-5.25	16.2	10180	36	2	703 - 713	K.QPQYAPLPIEK.Q
1386	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	535	1189.10	2376.19	1189.11	2376.20	2	-4.51	21.5	14515	32	3	333 - 355	K.GMALNLENENVGIVVFGGDTAIK.E	Oxidation: 2
1386	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	621	1031.87	3092.58	1031.87	3092.59	3	-1.39	24.5	20341	114	5	303 - 332	R.VVSVGDGIAQVYGLNEIQAGEMVLFANGVK.G	Oxidation: 22
1386	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	399	860.91	1719.81	860.91	1719.81	2	-1.34	18.4	25550	26	1	532 - 546	R.DNGMHALIIYDDLSK.Q	Oxidation: 4
1386	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	619	1031.87	3092.58	1031.87	3092.59	3	-1.04	24.4	7724	116	5	303 - 332	R.VVSVGDGIAQVYGLNEIQAGEMVLFANGVK.G	Oxidation: 22
1386	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	563	869.95	1737.88	869.95	1737.89	2	-3.94	22.3	9713	44	3	714 - 728	K.QILVIYAAVNGFCDR.M	Carbamidomethyl: 13
1386	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	192	522.29	1042.56	522.29	1042.57	2	-4.16	13.6	9843	78	3	363 - 373	R.TGSIVDVPAGK.A
1386	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	144	400.56	1198.66	400.56	1198.67	3	-5.04	12.5	50971	43	1	362 - 373	K.RTGSIVDVPAGK.A
1386	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	559	869.95	1737.88	869.95	1737.89	2	-4.40	22.2	4061	72	3	714 - 728	K.QILVIYAAVNGFCDR.M	Carbamidomethyl: 13
1386	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	330	513.80	1025.58	513.80	1025.59	2	-6.01	16.7	43688	40	3	424 - 433	K.AVDSLVPIGR.G
1386	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	620	774.15	3092.58	774.15	3092.59	4	-1.04	24.4	56942	131	2	303 - 332	R.VVSVGDGIAQVYGLNEIQAGEMVLFANGVK.G	Oxidation: 22
1386	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	110	409.54	1225.61	409.54	1225.61	3	-2.90	11.8	23566	37	2	413 - 423	K.SVHEPMQTGLK.A
1386	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	302	600.81	1199.61	600.82	1199.62	2	-6.38	16.1	25933	65	2	379 - 390	R.VVDAMGVPIDGK.G
1386	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	417	513.25	1536.73	513.25	1536.74	3	-1.74	18.8	22448	64	3	565 - 577	R.EAFPGDVFYLHSR.L
1386	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	612	1032.20	3093.56	1031.87	3092.59	3	316.36	24.2	14827	33	5	303 - 332	R.VVSVGDGIAQVYGLNEIQAGEMVLFANGVK.G	Oxidation: 22
1386	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	54	452.24	1353.70	452.24	1353.71	3	-4.58	10.3	48254	32	3	412 - 423	R.KSVHEPMQTGLK.A
1386	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	560	580.30	1737.88	580.30	1737.89	3	-4.41	22.2	7556	56	1	714 - 728	K.QILVIYAAVNGFCDR.M	Carbamidomethyl: 13
1386	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	464	852.91	1703.81	852.92	1703.82	2	-3.13	19.8	15295	19	2	532 - 546	R.DNGMHALIIYDDLSK.Q
1386	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	190	522.29	1042.56	522.29	1042.57	2	-6.02	13.6	4805	78	3	363 - 373	R.TGSIVDVPAGK.A
1386	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	398	574.28	1719.82	574.28	1719.81	3	2.91	18.3	25018	40	1	532 - 546	R.DNGMHALIIYDDLSK.Q	Oxidation: 4
1386	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	614	1032.20	3093.57	1031.87	3092.59	3	316.74	24.3	25809	26	5	303 - 332	R.VVSVGDGIAQVYGLNEIQAGEMVLFANGVK.G	Oxidation: 22
1386	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	489	1018.97	2035.92	1018.97	2035.92	2	-2.18	20.4	114329	32	1	465 - 482	R.ATSESETMYCVYVAIGQK.R	Carbamidomethyl: 10
1386	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	260	408.23	814.45	408.23	814.45	2	-5.07	15.1	10323	40	3	437 - 443	R.ELLIGDR.Q
1386	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	255	446.75	891.48	446.75	891.48	2	-6.17	15	7556	55	3	665 - 671	K.LELAQYR.E
1386	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	460	786.87	1571.73	786.88	1571.74	2	-3.36	19.7	25354	62	2	290 - 302	R.NFYANFQVDEIGR.V
1386	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	555	869.95	1737.88	869.95	1737.89	2	-3.99	22.1	14343	77	3	714 - 728	K.QILVIYAAVNGFCDR.M	Carbamidomethyl: 13
1386	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	441	665.88	1329.75	665.88	1329.75	2	-3.51	19.3	60276	77	3	448 - 459	K.TTIAIDTILNQK.Q
1386	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	257	408.23	814.45	408.23	814.45	2	-5.83	15.1	10674	40	3	437 - 443	R.ELLIGDR.Q
1386	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	534	793.07	2376.20	793.07	2376.20	3	-1.69	21.4	5053	75	1	333 - 355	K.GMALNLENENVGIVVFGGDTAIK.E	Oxidation: 2
1386	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	39	414.87	1241.60	414.88	1241.61	3	-3.51	10	27256	38	3	413 - 423	K.SVHEPMQTGLK.A	Oxidation: 6
1386	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	504	569.27	1704.80	568.95	1703.82	3	574.76	20.7	4052	15	1	532 - 546	R.DNGMHALIIYDDLSK.Q
1386	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	425	769.37	1536.73	769.38	1536.74	2	-4.21	18.9	12099	53	3	565 - 577	R.EAFPGDVFYLHSR.L
1386	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	565	1181.11	2360.20	1181.11	2360.20	2	-3.35	22.3	10323	40	3	333 - 355	K.GMALNLENENVGIVVFGGDTAIK.E
1386	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	3	457.57	1369.70	457.57	1369.70	3	-4.17	8.7	10180	44	2	412 - 423	R.KSVHEPMQTGLK.A	Oxidation: 7
1386	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	439	1330.75	1329.75	1330.76	1329.75	1	-2.75	19.2	164312	39	1	448 - 459	K.TTIAIDTILNQK.Q
1386	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	303	480.29	1437.83	480.29	1437.84	3	-5.76	16.1	49231	57	1	633 - 646	R.GIRPAINVGLSVSR.V
1386	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	299	600.81	1199.61	600.82	1199.62	2	-6.79	16	19992	72	2	379 - 390	R.VVDAMGVPIDGK.G
1386	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	51	452.24	1353.70	452.24	1353.71	3	-3.83	10.3	39156	57	3	412 - 423	R.KSVHEPMQTGLK.A
1386	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	328	1026.59	1025.58	1026.59	1025.59	1	-5.37	16.7	40789	30	3	424 - 433	K.AVDSLVPIGR.G
1386	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	50	452.24	1353.70	452.24	1353.71	3	-6.48	10.2	4590	45	3	412 - 423	R.KSVHEPMQTGLK.A
1386	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	568	1181.11	2360.20	1181.11	2360.20	2	-3.09	22.4	5259	24	3	333 - 355	K.GMALNLENENVGIVVFGGDTAIK.E
1443	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	293	513.80	1025.59	513.80	1025.59	2	-1.22	16.5	4650	66	3	424 - 433	K.AVDSLVPIGR.G
1443	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	391	513.25	1536.73	513.25	1536.74	3	-0.90	18.7	229657	64	3	565 - 577	R.EAFPGDVFYLHSR.L
1443	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	405	665.88	1329.75	665.88	1329.75	2	-2.53	19	52050	88	3	448 - 459	K.TTIAIDTILNQK.Q
1443	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	146	608.81	1215.61	608.82	1215.62	2	-5.25	13.1	45650	50	3	379 - 390	R.VVDAMGVPIDGK.G	Oxidation: 5
1443	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	290	513.80	1025.58	513.80	1025.59	2	-2.00	16.4	3750	53	3	424 - 433	K.AVDSLVPIGR.G
1443	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	36	414.88	1241.60	414.88	1241.61	3	-2.86	9.8	7983	36	3	413 - 423	K.SVHEPMQTGLK.A	Oxidation: 6
1443	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	385	513.25	1536.73	513.25	1536.74	3	-2.65	18.6	3709	62	3	565 - 577	R.EAFPGDVFYLHSR.L
1443	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	367	574.28	1719.81	574.28	1719.81	3	-1.62	18.2	86547	40	2	532 - 546	R.DNGMHALIIYDDLSK.Q	Oxidation: 4
1443	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	214	446.75	891.48	446.75	891.48	2	-4.04	14.6	8696	55	3	665 - 671	K.LELAQYR.E
1443	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	408	665.88	1329.75	665.88	1329.75	2	-1.71	19.1	54805	91	3	448 - 459	K.TTIAIDTILNQK.Q
1443	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	268	642.35	1282.69	642.35	1282.69	2	-1.10	15.9	8205	56	3	703 - 713	K.QPQYAPLPIEK.Q
1443	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	224	815.46	814.45	815.46	814.45	1	-0.88	14.8	6837	29	2	437 - 443	R.ELLIGDR.Q
1443	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	229	408.23	814.45	408.23	814.45	2	-2.08	15	7341	43	3	437 - 443	R.ELLIGDR.Q
1443	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	365	574.28	1719.81	574.28	1719.81	3	-1.48	18.1	8295	42	2	532 - 546	R.DNGMHALIIYDDLSK.Q	Oxidation: 4
1443	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	9	457.57	1369.70	457.57	1369.70	3	-1.77	8.6	17484	31	3	412 - 423	R.KSVHEPMQTGLK.A	Oxidation: 7
1443	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	152	406.21	1215.62	406.21	1215.62	3	-1.23	13.2	11801	31	2	379 - 390	R.VVDAMGVPIDGK.G	Oxidation: 5
1443	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	33	414.88	1241.61	414.88	1241.61	3	-1.70	9.8	8093	39	3	413 - 423	K.SVHEPMQTGLK.A	Oxidation: 6
1443	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	6	457.57	1369.70	457.57	1369.70	3	-1.55	8.5	8375	42	3	412 - 423	R.KSVHEPMQTGLK.A	Oxidation: 7
1443	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	37	621.81	1241.60	621.81	1241.61	2	-2.86	9.8	13776	38	2	413 - 423	K.SVHEPMQTGLK.A	Oxidation: 6
1443	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	34	621.81	1241.61	621.81	1241.61	2	-1.70	9.8	12112	27	2	413 - 423	K.SVHEPMQTGLK.A	Oxidation: 6
1443	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	84	409.54	1225.61	409.54	1225.61	3	-3.51	11.6	22543	24	1	413 - 423	K.SVHEPMQTGLK.A
1443	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	153	522.29	1042.56	522.29	1042.57	2	-4.64	13.3	5918	58	3	363 - 373	R.TGSIVDVPAGK.A
1443	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	160	1043.57	1042.56	1043.57	1042.57	1	-2.40	13.4	197024	27	1	363 - 373	R.TGSIVDVPAGK.A
1443	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	402	625.82	1249.63	625.82	1249.63	2	-2.64	19	51240	85	3	277 - 287	R.AAELTNLFESR.I
1443	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	260	452.25	902.50	451.76	901.51	2	1095.41	15.7	8921	17	1	553 - 559	R.QMSLLLR.R	Acetyl: 1
1443	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	149	608.81	1215.62	608.82	1215.62	2	-1.57	13.2	21035	68	3	379 - 390	R.VVDAMGVPIDGK.G	Oxidation: 5
1443	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	222	408.23	814.45	408.23	814.45	2	-0.88	14.8	7960	43	3	437 - 443	R.ELLIGDR.Q
1443	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	226	438.75	875.49	438.75	875.49	2	-2.49	14.9	7401	34	3	553 - 559	R.QMSLLLR.R	Oxidation: 2
1443	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	398	625.82	1249.63	625.82	1249.63	2	-3.51	18.8	45627	85	3	277 - 287	R.AAELTNLFESR.I
1443	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	270	480.29	1437.84	480.29	1437.84	3	-2.12	15.9	35511	52	2	633 - 646	R.GIRPAINVGLSVSR.V
1443	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	228	438.75	875.49	438.75	875.49	2	-2.86	15	16897	25	3	553 - 559	R.QMSLLLR.R	Oxidation: 2
1443	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	225	408.23	814.45	408.23	814.45	2	-1.08	14.9	4570	43	3	437 - 443	R.ELLIGDR.Q
1443	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	403	665.88	1329.74	665.88	1329.75	2	-5.31	19	169687	85	3	448 - 459	K.TTIAIDTILNQK.Q
1443	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	266	480.29	1437.84	480.29	1437.84	3	-2.54	15.8	3932	59	2	633 - 646	R.GIRPAINVGLSVSR.V
1443	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	3	457.57	1369.70	457.57	1369.70	3	-2.27	8.4	3280	50	3	412 - 423	R.KSVHEPMQTGLK.A	Oxidation: 7
1443	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	219	446.75	891.48	446.75	891.48	2	-1.29	14.8	13023	55	3	665 - 671	K.LELAQYR.E
1443	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	227	815.46	814.45	815.46	814.45	1	-1.07	14.9	8240	23	2	437 - 443	R.ELLIGDR.Q
1443	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	289	513.80	1025.58	513.80	1025.59	2	-3.95	16.4	5225	48	3	424 - 433	K.AVDSLVPIGR.G
1443	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	158	522.29	1042.56	522.29	1042.57	2	-2.38	13.4	22494	65	3	363 - 373	R.TGSIVDVPAGK.A
1443	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	155	522.29	1042.56	522.29	1042.57	2	-2.04	13.3	17057	66	3	363 - 373	R.TGSIVDVPAGK.A
1443	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	31	414.88	1241.61	414.88	1241.61	3	1.79	9.7	23281	36	3	413 - 423	K.SVHEPMQTGLK.A	Oxidation: 6
1443	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	150	406.21	1215.62	406.21	1215.62	3	-1.57	13.2	9173	24	2	379 - 390	R.VVDAMGVPIDGK.G	Oxidation: 5
1443	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	394	769.38	1536.74	769.38	1536.74	2	0.08	18.8	205395	19	1	565 - 577	R.EAFPGDVFYLHSR.L
1443	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	470	793.07	2376.20	793.07	2376.20	3	-1.01	21.3	10761	25	1	333 - 355	K.GMALNLENENVGIVVFGGDTAIK.E	Oxidation: 2
1443	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	271	642.35	1282.69	642.35	1282.69	2	-1.21	16	6724	43	3	703 - 713	K.QPQYAPLPIEK.Q
1443	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	223	438.75	875.49	438.75	875.49	2	-2.26	14.8	5579	24	3	553 - 559	R.QMSLLLR.R	Oxidation: 2
1443	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	294	1026.59	1025.59	1026.59	1025.59	1	-1.23	16.5	9124	24	1	424 - 433	K.AVDSLVPIGR.G
1443	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	216	446.75	891.48	446.75	891.48	2	-1.17	14.7	4660	49	3	665 - 671	K.LELAQYR.E
1443	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	267	600.82	1199.62	600.82	1199.62	2	-2.91	15.9	51391	68	1	379 - 390	R.VVDAMGVPIDGK.G
1443	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	147	608.81	1215.61	608.82	1215.62	2	-3.13	13.1	49184	72	3	379 - 390	R.VVDAMGVPIDGK.G	Oxidation: 5
1443	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	276	642.35	1282.69	642.35	1282.69	2	-1.04	16.1	35516	33	3	703 - 713	K.QPQYAPLPIEK.Q
1443	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	399	625.82	1249.63	625.82	1249.63	2	-2.20	18.9	22237	77	3	277 - 287	R.AAELTNLFESR.I
1443	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	389	513.25	1536.73	513.25	1536.74	3	-1.49	18.6	22543	64	3	565 - 577	R.EAFPGDVFYLHSR.L
1501	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	209	438.74	875.47	438.75	875.49	2	-17.37	15.5	14057	19	1	553 - 559	R.QMSLLLR.R	Oxidation: 2
1501	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	205	408.23	814.44	408.23	814.45	2	-14.80	15.5	13569	20	1	437 - 443	R.ELLIGDR.Q
1501	AT2G07698.1	alpha-2 subunit	complex V	a) oxidative phosphorylation	mitochondria	133	608.81	1215.60	608.82	1215.62	2	-12.92	13.9	3794	37	1	379 - 390	R.VVDAMGVPIDGK.G	Oxidation: 5
1167	AT4G01100.1	ANT1 (adenine nucleotide transporter 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	107	407.25	812.48	407.25	812.48	2	9.14	13.2	11104	34	2	318 - 325	K.GLVPNSVK.V
1167	AT4G01100.1	ANT1 (adenine nucleotide transporter 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	112	459.92	1376.74	459.91	1376.72	3	11.04	13.4	5172	15	2	306 - 317	K.TVRHEGFGALYK.G
1167	AT4G01100.1	ANT1 (adenine nucleotide transporter 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	239	713.90	1425.78	713.89	1425.76	2	14.69	17	12768	55	3	132 - 144	R.TGNENAQLTPLLR.L
1167	AT4G01100.1	ANT1 (adenine nucleotide transporter 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	99	538.28	1074.54	538.27	1074.53	2	12.37	13	25791	66	3	279 - 289	K.DASAIVTGEGR.S
1167	AT4G01100.1	ANT1 (adenine nucleotide transporter 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	260	561.35	1120.68	561.34	1120.67	2	5.87	17.8	9353	46	3	182 - 192	R.GIAHALATVLR.E
1167	AT4G01100.1	ANT1 (adenine nucleotide transporter 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	321	587.65	1759.91	587.64	1759.90	3	10.99	22	4062	49	2	9 - 25	R.TESAAVSTIVNLAEEAR.E
1167	AT4G01100.1	ANT1 (adenine nucleotide transporter 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	95	538.28	1074.54	538.27	1074.53	2	10.75	12.9	6835	60	3	279 - 289	K.DASAIVTGEGR.S
1167	AT4G01100.1	ANT1 (adenine nucleotide transporter 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	258	561.35	1120.68	561.34	1120.67	2	9.59	17.7	11435	56	3	182 - 192	R.GIAHALATVLR.E
1167	AT4G01100.1	ANT1 (adenine nucleotide transporter 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	238	713.89	1425.77	713.89	1425.76	2	10.36	17	5164	71	3	132 - 144	R.TGNENAQLTPLLR.L
1167	AT4G01100.1	ANT1 (adenine nucleotide transporter 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	199	597.97	1790.88	597.96	1790.85	3	14.86	15.8	5686	45	1	290 - 305	R.STASLEYTGMVDAFRK.T	Oxidation: 10
1167	AT4G01100.1	ANT1 (adenine nucleotide transporter 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	108	407.25	812.48	407.25	812.48	2	5.06	13.2	13433	30	2	318 - 325	K.GLVPNSVK.V
1167	AT4G01100.1	ANT1 (adenine nucleotide transporter 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	322	880.96	1759.91	880.95	1759.90	2	9.61	22	8610	63	2	9 - 25	R.TESAAVSTIVNLAEEAR.E
1167	AT4G01100.1	ANT1 (adenine nucleotide transporter 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	179	472.95	1415.83	472.95	1415.82	3	6.88	15	9477	18	2	64 - 75	K.ILLQVQNPHNIK.Y
1167	AT4G01100.1	ANT1 (adenine nucleotide transporter 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	168	770.90	1539.79	770.89	1539.77	2	13.21	14.8	8568	71	1	169 - 181	R.LTVQTANSPYQYR.G
1167	AT4G01100.1	ANT1 (adenine nucleotide transporter 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	320	880.96	1759.91	880.95	1759.90	2	10.99	22	6286	70	2	9 - 25	R.TESAAVSTIVNLAEEAR.E
1167	AT4G01100.1	ANT1 (adenine nucleotide transporter 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	170	514.27	1539.79	514.26	1539.77	3	13.21	14.8	3662	30	1	169 - 181	R.LTVQTANSPYQYR.G
1167	AT4G01100.1	ANT1 (adenine nucleotide transporter 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	110	459.92	1376.74	459.91	1376.72	3	10.87	13.3	4050	25	2	306 - 317	K.TVRHEGFGALYK.G
1167	AT4G01100.1	ANT1 (adenine nucleotide transporter 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	244	713.89	1425.77	713.89	1425.76	2	10.56	17.1	9224	74	3	132 - 144	R.TGNENAQLTPLLR.L
1167	AT4G01100.1	ANT1 (adenine nucleotide transporter 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	67	428.75	855.49	428.75	855.48	2	8.13	12.2	50382	66	3	54 - 61	R.TAVAPLER.M
1167	AT4G01100.1	ANT1 (adenine nucleotide transporter 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	210	589.33	1176.64	589.32	1176.63	2	10.63	16.2	5471	55	3	41 - 53	K.SLFAGGVAGGVSR.T
1167	AT4G01100.1	ANT1 (adenine nucleotide transporter 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	277	423.25	1688.95	423.24	1688.93	4	12.25	18.5	4782	20	1	182 - 197	R.GIAHALATVLREEGPR.A
1167	AT4G01100.1	ANT1 (adenine nucleotide transporter 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	9	414.26	826.50	414.25	826.49	2	6.44	10.2	16678	35	1	106 - 113	R.IVPNSAVK.F
1167	AT4G01100.1	ANT1 (adenine nucleotide transporter 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	70	476.76	951.51	476.76	951.50	2	7.07	12.3	24377	47	2	76 - 84	K.YSGTVQGLK.H
1167	AT4G01100.1	ANT1 (adenine nucleotide transporter 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	212	589.33	1176.64	589.32	1176.63	2	11.88	16.3	16365	65	3	41 - 53	K.SLFAGGVAGGVSR.T
1167	AT4G01100.1	ANT1 (adenine nucleotide transporter 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	65	428.75	855.49	428.75	855.48	2	7.34	12.2	21421	61	3	54 - 61	R.TAVAPLER.M
1167	AT4G01100.1	ANT1 (adenine nucleotide transporter 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	214	589.33	1176.64	589.32	1176.63	2	11.92	16.3	20471	72	3	41 - 53	K.SLFAGGVAGGVSR.T
1167	AT4G01100.1	ANT1 (adenine nucleotide transporter 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	96	538.28	1074.54	538.27	1074.53	2	10.79	12.9	23109	65	3	279 - 289	K.DASAIVTGEGR.S
1167	AT4G01100.1	ANT1 (adenine nucleotide transporter 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	175	472.95	1415.84	472.95	1415.82	3	10.75	14.9	14889	43	2	64 - 75	K.ILLQVQNPHNIK.Y
1167	AT4G01100.1	ANT1 (adenine nucleotide transporter 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	68	476.76	951.51	476.76	951.50	2	6.80	12.3	10992	52	2	76 - 84	K.YSGTVQGLK.H
1167	AT4G01100.1	ANT1 (adenine nucleotide transporter 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	256	561.35	1120.68	561.34	1120.67	2	8.08	17.7	4651	43	3	182 - 192	R.GIAHALATVLR.E
1167	AT4G01100.1	ANT1 (adenine nucleotide transporter 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	323	587.64	1759.91	587.64	1759.90	3	9.61	22	6941	56	2	9 - 25	R.TESAAVSTIVNLAEEAR.E
1167	AT4G01100.1	ANT1 (adenine nucleotide transporter 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	64	428.75	855.49	428.75	855.48	2	9.09	12.2	6428	22	3	54 - 61	R.TAVAPLER.M
1450	AT4G01100.1	ANT1 (adenine nucleotide transporter 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	570	587.64	1759.88	587.64	1759.90	3	-5.99	21.8	26860	42	2	9 - 25	R.TESAAVSTIVNLAEEAR.E
1450	AT4G01100.1	ANT1 (adenine nucleotide transporter 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	572	587.64	1759.89	587.64	1759.90	3	-5.33	21.9	5262	52	2	9 - 25	R.TESAAVSTIVNLAEEAR.E
1450	AT4G01100.1	ANT1 (adenine nucleotide transporter 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	181	538.27	1074.52	538.27	1074.53	2	-6.26	13	35134	44	1	279 - 289	K.DASAIVTGEGR.S
1450	AT4G01100.1	ANT1 (adenine nucleotide transporter 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	569	880.95	1759.88	880.95	1759.90	2	-6.00	21.8	7356	58	2	9 - 25	R.TESAAVSTIVNLAEEAR.E
1450	AT4G01100.1	ANT1 (adenine nucleotide transporter 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	183	407.24	812.47	407.25	812.48	2	-10.38	13	25657	20	1	318 - 325	K.GLVPNSVK.V
1450	AT4G01100.1	ANT1 (adenine nucleotide transporter 1)	ADP/ATP carrier oligomers	d) transport	mitochondria	573	880.95	1759.89	880.95	1759.90	2	-5.34	21.9	24099	43	2	9 - 25	R.TESAAVSTIVNLAEEAR.E
942	AT3G22370.1	AOX1A (alternative oxidase 1A)	external / alternative enzymes	a) oxidative phosphorylation	mitochondrion	42	428.75	855.49	428.75	855.48	2	9.99	13	12109	35	3	307 - 314	R.LPADATLR.D
942	AT3G22370.1	AOX1A (alternative oxidase 1A)	external / alternative enzymes	a) oxidative phosphorylation	mitochondrion	86	587.30	1172.58	587.29	1172.57	2	10.42	14.4	3823	59	2	214 - 223	K.ALLEEAENER.M
942	AT3G22370.1	AOX1A (alternative oxidase 1A)	external / alternative enzymes	a) oxidative phosphorylation	mitochondrion	40	417.24	832.46	417.23	832.45	2	9.65	13	5455	22	2	315 - 321	R.DVVMVVR.A	Oxidation: 4
942	AT3G22370.1	AOX1A (alternative oxidase 1A)	external / alternative enzymes	a) oxidative phosphorylation	mitochondrion	41	428.75	855.49	428.75	855.48	2	10.69	13	4720	26	3	307 - 314	R.LPADATLR.D
942	AT3G22370.1	AOX1A (alternative oxidase 1A)	external / alternative enzymes	a) oxidative phosphorylation	mitochondrion	46	428.75	855.49	428.75	855.48	2	9.18	13.1	10208	23	3	307 - 314	R.LPADATLR.D
942	AT3G22370.1	AOX1A (alternative oxidase 1A)	external / alternative enzymes	a) oxidative phosphorylation	mitochondrion	88	587.30	1172.59	587.29	1172.57	2	16.38	14.5	4864	42	2	214 - 223	K.ALLEEAENER.M
942	AT3G22370.1	AOX1A (alternative oxidase 1A)	external / alternative enzymes	a) oxidative phosphorylation	mitochondrion	43	417.23	832.45	417.23	832.45	2	6.97	13	6875	21	2	315 - 321	R.DVVMVVR.A	Oxidation: 4
996	AT3G22370.1	AOX1A (alternative oxidase 1A)	external / alternative enzymes	a) oxidative phosphorylation	mitochondrion	186	888.50	887.49	888.50	887.50	1	-5.98	16.6	4084	20	1	136 - 143	K.ADITIDLK.K
996	AT3G22370.1	AOX1A (alternative oxidase 1A)	external / alternative enzymes	a) oxidative phosphorylation	mitochondrion	64	417.23	832.44	417.23	832.45	2	-4.80	13.1	7650	19	1	315 - 321	R.DVVMVVR.A	Oxidation: 4
996	AT3G22370.1	AOX1A (alternative oxidase 1A)	external / alternative enzymes	a) oxidative phosphorylation	mitochondrion	63	428.75	855.48	428.75	855.48	2	-2.81	13.1	11845	42	2	307 - 314	R.LPADATLR.D
996	AT3G22370.1	AOX1A (alternative oxidase 1A)	external / alternative enzymes	a) oxidative phosphorylation	mitochondrion	119	587.29	1172.57	587.29	1172.57	2	5.28	14.7	5065	42	1	214 - 223	K.ALLEEAENER.M
996	AT3G22370.1	AOX1A (alternative oxidase 1A)	external / alternative enzymes	a) oxidative phosphorylation	mitochondrion	67	428.75	855.48	428.75	855.48	2	-3.46	13.2	8830	38	2	307 - 314	R.LPADATLR.D
1168	AT3G22370.1	AOX1A (alternative oxidase 1A)	external / alternative enzymes	a) oxidative phosphorylation	mitochondrion	67	477.74	953.47	477.74	953.46	2	10.45	13	8100	59	3	346 - 354	K.EAPAPIGYH.-
1168	AT3G22370.1	AOX1A (alternative oxidase 1A)	external / alternative enzymes	a) oxidative phosphorylation	mitochondrion	69	417.23	832.45	417.23	832.45	2	7.01	13	9842	18	3	315 - 321	R.DVVMVVR.A	Oxidation: 4
1168	AT3G22370.1	AOX1A (alternative oxidase 1A)	external / alternative enzymes	a) oxidative phosphorylation	mitochondrion	189	440.75	879.49	440.75	879.49	2	7.13	16.9	6353	24	2	155 - 161	R.IAYWTVK.S
1168	AT3G22370.1	AOX1A (alternative oxidase 1A)	external / alternative enzymes	a) oxidative phosphorylation	mitochondrion	191	440.75	879.49	440.75	879.49	2	9.36	16.9	8388	17	2	155 - 161	R.IAYWTVK.S
1168	AT3G22370.1	AOX1A (alternative oxidase 1A)	external / alternative enzymes	a) oxidative phosphorylation	mitochondrion	81	408.22	1221.64	408.22	1221.63	3	9.50	13.4	6134	30	1	145 - 154	K.HHVPTTFLDR.I
1168	AT3G22370.1	AOX1A (alternative oxidase 1A)	external / alternative enzymes	a) oxidative phosphorylation	mitochondrion	177	888.51	887.50	888.50	887.50	1	9.38	16.5	5699	38	1	136 - 143	K.ADITIDLK.K
1168	AT3G22370.1	AOX1A (alternative oxidase 1A)	external / alternative enzymes	a) oxidative phosphorylation	mitochondrion	70	477.74	953.47	477.74	953.46	2	11.73	13	5931	44	3	346 - 354	K.EAPAPIGYH.-
1168	AT3G22370.1	AOX1A (alternative oxidase 1A)	external / alternative enzymes	a) oxidative phosphorylation	mitochondrion	64	477.75	953.48	477.74	953.46	2	15.50	12.9	5223	20	3	346 - 354	K.EAPAPIGYH.-
1168	AT3G22370.1	AOX1A (alternative oxidase 1A)	external / alternative enzymes	a) oxidative phosphorylation	mitochondrion	128	587.30	1172.59	587.29	1172.57	2	15.64	14.6	9836	43	2	214 - 223	K.ALLEEAENER.M
1168	AT3G22370.1	AOX1A (alternative oxidase 1A)	external / alternative enzymes	a) oxidative phosphorylation	mitochondrion	65	417.23	832.45	417.23	832.45	2	7.54	13	15714	22	3	315 - 321	R.DVVMVVR.A	Oxidation: 4
1168	AT3G22370.1	AOX1A (alternative oxidase 1A)	external / alternative enzymes	a) oxidative phosphorylation	mitochondrion	63	417.23	832.45	417.23	832.45	2	5.53	12.9	5209	20	3	315 - 321	R.DVVMVVR.A	Oxidation: 4
1168	AT3G22370.1	AOX1A (alternative oxidase 1A)	external / alternative enzymes	a) oxidative phosphorylation	mitochondrion	133	409.24	816.46	409.23	816.45	2	7.83	14.7	5732	25	1	315 - 321	R.DVVMVVR.A
1168	AT3G22370.1	AOX1A (alternative oxidase 1A)	external / alternative enzymes	a) oxidative phosphorylation	mitochondrion	127	587.30	1172.58	587.29	1172.57	2	11.44	14.5	6665	48	2	214 - 223	K.ALLEEAENER.M
1451	AT3G22370.1	AOX1A (alternative oxidase 1A)	external / alternative enzymes	a) oxidative phosphorylation	mitochondrion	170	408.22	1221.63	408.22	1221.63	3	-0.32	13	9485	31	1	145 - 154	K.HHVPTTFLDR.I
1451	AT3G22370.1	AOX1A (alternative oxidase 1A)	external / alternative enzymes	a) oxidative phosphorylation	mitochondrion	165	428.75	855.48	428.75	855.48	2	-2.60	12.9	21036	30	2	307 - 314	R.LPADATLR.D
1451	AT3G22370.1	AOX1A (alternative oxidase 1A)	external / alternative enzymes	a) oxidative phosphorylation	mitochondrion	555	605.31	1208.60	605.31	1208.60	2	4.36	21.8	4656	42	1	165 - 173	R.WPTDLFFQR.R
1451	AT3G22370.1	AOX1A (alternative oxidase 1A)	external / alternative enzymes	a) oxidative phosphorylation	mitochondrion	386	660.83	1319.65	660.83	1319.65	2	-1.66	17.8	4739	24	1	103 - 114	K.GIASYWGVEPNK.I
1451	AT3G22370.1	AOX1A (alternative oxidase 1A)	external / alternative enzymes	a) oxidative phosphorylation	mitochondrion	161	428.75	855.48	428.75	855.48	2	-1.25	12.8	20821	43	2	307 - 314	R.LPADATLR.D
1114	AT3G22360.1	AOX1B (alternative oxidase 1B)	external / alternative enzymes	a) oxidative phosphorylation	mitochondrion	140	409.24	816.47	409.23	816.45	2	17.65	14.8	7887	21	3	286 - 292	R.DVVMVVR.A
1114	AT3G22360.1	AOX1B (alternative oxidase 1B)	external / alternative enzymes	a) oxidative phosphorylation	mitochondrion	67	417.24	832.46	417.23	832.45	2	19.88	13	26976	22	3	286 - 292	R.DVVMVVR.A	Oxidation: 4
1114	AT3G22360.1	AOX1B (alternative oxidase 1B)	external / alternative enzymes	a) oxidative phosphorylation	mitochondrion	200	440.76	879.50	440.75	879.49	2	16.96	17	10186	27	1	126 - 132	K.LAYWTVK.S
1114	AT3G22360.1	AOX1B (alternative oxidase 1B)	external / alternative enzymes	a) oxidative phosphorylation	mitochondrion	83	442.24	1323.71	442.23	1323.68	3	17.23	13.5	7054	34	1	314 - 325	R.ELKEAPAPIGYH.-
1114	AT3G22360.1	AOX1B (alternative oxidase 1B)	external / alternative enzymes	a) oxidative phosphorylation	mitochondrion	138	409.24	816.47	409.23	816.45	2	18.80	14.8	8275	19	3	286 - 292	R.DVVMVVR.A
1114	AT3G22360.1	AOX1B (alternative oxidase 1B)	external / alternative enzymes	a) oxidative phosphorylation	mitochondrion	72	417.24	832.46	417.23	832.45	2	17.94	13.1	14005	21	3	286 - 292	R.DVVMVVR.A	Oxidation: 4
1114	AT3G22360.1	AOX1B (alternative oxidase 1B)	external / alternative enzymes	a) oxidative phosphorylation	mitochondrion	137	409.24	816.47	409.23	816.45	2	15.82	14.8	4911	22	3	286 - 292	R.DVVMVVR.A
1114	AT3G22360.1	AOX1B (alternative oxidase 1B)	external / alternative enzymes	a) oxidative phosphorylation	mitochondrion	65	417.24	832.46	417.23	832.45	2	17.18	13	14251	20	3	286 - 292	R.DVVMVVR.A	Oxidation: 4
941	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	220	550.84	1099.67	550.84	1099.66	2	11.94	18.6	21267	75	3	36 - 45	R.VIDASLTLIR.E
941	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	134	399.77	797.52	399.76	797.51	2	8.09	15.7	32377	43	3	217 - 223	R.LLQVGIR.S
941	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	159	579.77	1157.53	579.77	1157.52	2	14.99	16.5	3917	55	2	236 - 244	R.FGVEQYEMR.T
941	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	8	456.72	911.43	456.72	911.42	2	10.98	10.4	13716	44	4	208 - 215	R.IMEGGYAR.R	Oxidation: 2
941	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	192	770.43	1538.85	770.42	1538.83	2	13.52	17.7	14998	64	3	113 - 126	R.VLTDVGDVPVQEIR.D
941	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	222	550.84	1099.67	550.84	1099.66	2	11.40	18.7	35680	71	3	36 - 45	R.VIDASLTLIR.E
941	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	9	456.72	911.43	456.72	911.42	2	9.00	10.4	19935	42	4	208 - 215	R.IMEGGYAR.R	Oxidation: 2
941	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	5	407.76	813.52	407.76	813.51	2	9.67	10.3	13892	27	4	50 - 56	K.LKGELVR.L
941	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	257	874.48	2620.40	874.47	2620.38	3	10.62	21.1	3657	38	3	63 - 88	K.ASTSLLGVPLGHNSSFLQGPAFAPPR.I
941	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	206	513.96	1538.86	513.95	1538.83	3	16.75	18.3	10524	23	2	113 - 126	R.VLTDVGDVPVQEIR.D
941	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	226	706.14	2820.52	706.13	2820.48	4	13.30	18.9	2991	36	2	145 - 169	K.LVMEEEPLRPLVLGGDHSISYPVVR.A	Oxidation: 3
941	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	114	587.77	1173.53	587.76	1173.51	2	12.73	15	12617	73	3	236 - 244	R.FGVEQYEMR.T	Oxidation: 8
941	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	7	456.72	911.43	456.72	911.42	2	11.85	10.4	7850	27	4	208 - 215	R.IMEGGYAR.R	Oxidation: 2
941	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	205	513.96	1538.86	513.95	1538.83	3	17.10	18.3	10733	16	2	113 - 126	R.VLTDVGDVPVQEIR.D
941	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	190	770.43	1538.85	770.42	1538.83	2	14.03	17.7	18533	75	3	113 - 126	R.VLTDVGDVPVQEIR.D
941	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	15	671.32	1340.62	671.30	1340.60	2	15.60	11.2	4110	19	3	319 - 331	R.DTVDGMTAMVAAK.L	Oxidation: 6
941	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	19	671.31	1340.61	671.30	1340.60	2	11.46	11.3	5773	39	3	319 - 331	R.DTVDGMTAMVAAK.L	Oxidation: 6
941	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	17	671.31	1340.62	671.30	1340.60	2	15.05	11.2	6091	32	3	319 - 331	R.DTVDGMTAMVAAK.L	Oxidation: 6
941	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	3	407.76	813.51	407.76	813.51	2	6.36	10.2	5787	19	4	50 - 56	K.LKGELVR.L
941	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	10	456.72	911.43	456.72	911.42	2	11.65	10.5	17722	32	4	208 - 215	R.IMEGGYAR.R	Oxidation: 2
941	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	118	587.77	1173.53	587.76	1173.51	2	13.55	15.1	15708	70	3	236 - 244	R.FGVEQYEMR.T	Oxidation: 8
941	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	258	874.48	2620.41	874.47	2620.38	3	12.57	21.1	4556	70	3	63 - 88	K.ASTSLLGVPLGHNSSFLQGPAFAPPR.I
941	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	160	579.78	1157.54	579.77	1157.52	2	15.97	16.5	4579	40	2	236 - 244	R.FGVEQYEMR.T
941	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	135	399.77	797.52	399.76	797.51	2	8.16	15.7	45541	43	3	217 - 223	R.LLQVGIR.S
941	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	219	550.84	1099.67	550.84	1099.66	2	12.05	18.6	10244	75	3	36 - 45	R.VIDASLTLIR.E
941	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	228	706.14	2820.53	706.13	2820.48	4	14.86	19	3324	21	2	145 - 169	K.LVMEEEPLRPLVLGGDHSISYPVVR.A	Oxidation: 3
941	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	4	407.76	813.51	407.76	813.51	2	9.13	10.3	10875	39	4	50 - 56	K.LKGELVR.L
941	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	6	407.76	813.51	407.76	813.51	2	8.35	10.3	11354	27	4	50 - 56	K.LKGELVR.L
941	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	113	587.77	1173.52	587.76	1173.51	2	9.84	14.9	4716	31	3	236 - 244	R.FGVEQYEMR.T	Oxidation: 8
941	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	188	770.43	1538.85	770.42	1538.83	2	12.98	17.6	8087	74	3	113 - 126	R.VLTDVGDVPVQEIR.D
941	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	101	477.82	953.62	477.81	953.61	2	7.34	14.6	8213	24	1	216 - 223	R.RLLQVGIR.S
941	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	133	399.77	797.52	399.76	797.51	2	6.06	15.6	13168	31	3	217 - 223	R.LLQVGIR.S
941	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	259	874.48	2620.40	874.47	2620.38	3	10.65	21.1	5842	53	3	63 - 88	K.ASTSLLGVPLGHNSSFLQGPAFAPPR.I
995	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	3	456.72	911.42	456.72	911.42	2	2.57	10.2	5032	22	2	208 - 215	R.IMEGGYAR.R	Oxidation: 2
995	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	124	587.77	1173.52	587.76	1173.51	2	7.61	14.7	3678	41	2	236 - 244	R.FGVEQYEMR.T	Oxidation: 8
995	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	220	770.43	1538.85	770.42	1538.83	2	10.83	17.4	10264	80	1	113 - 126	R.VLTDVGDVPVQEIR.D
995	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	2	456.72	911.42	456.72	911.42	2	5.57	10.2	4361	41	2	208 - 215	R.IMEGGYAR.R	Oxidation: 2
995	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	148	399.77	797.52	399.76	797.51	2	4.38	15.4	11244	31	1	217 - 223	R.LLQVGIR.S
995	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	126	587.77	1173.52	587.76	1173.51	2	5.98	14.8	4584	47	2	236 - 244	R.FGVEQYEMR.T	Oxidation: 8
1395	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	43	407.76	813.51	407.76	813.51	2	-2.20	10.5	30764	36	3	50 - 56	K.LKGELVR.L
1395	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	271	399.76	797.51	399.76	797.51	2	-0.54	15.7	11301	42	3	217 - 223	R.LLQVGIR.S
1395	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	270	798.52	797.51	798.52	797.51	1	-0.26	15.6	19436	32	2	217 - 223	R.LLQVGIR.S
1395	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	378	513.95	1538.83	513.95	1538.83	3	0.86	18.2	14567	17	3	113 - 126	R.VLTDVGDVPVQEIR.D
1395	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	307	579.77	1157.52	579.77	1157.52	2	0.86	16.6	16392	73	2	236 - 244	R.FGVEQYEMR.T
1395	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	38	407.76	813.50	407.76	813.51	2	-3.00	10.4	44900	36	3	50 - 56	K.LKGELVR.L
1395	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	380	513.95	1538.83	513.95	1538.83	3	1.42	18.3	13787	18	3	113 - 126	R.VLTDVGDVPVQEIR.D
1395	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	397	550.84	1099.66	550.84	1099.66	2	-1.76	18.7	100933	75	3	36 - 45	R.VIDASLTLIR.E
1395	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	244	587.76	1173.51	587.76	1173.51	2	-0.20	15.1	7624	68	3	236 - 244	R.FGVEQYEMR.T	Oxidation: 8
1395	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	354	770.42	1538.83	770.42	1538.83	2	1.05	17.7	15740	71	5	113 - 126	R.VLTDVGDVPVQEIR.D
1395	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	240	587.77	1173.52	587.76	1173.51	2	3.26	15	4555	73	3	236 - 244	R.FGVEQYEMR.T	Oxidation: 8
1395	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	309	579.77	1157.52	579.77	1157.52	2	1.55	16.6	12916	65	2	236 - 244	R.FGVEQYEMR.T
1395	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	46	456.72	911.42	456.72	911.42	2	0.40	10.6	33748	36	3	208 - 215	R.IMEGGYAR.R	Oxidation: 2
1395	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	402	550.84	1099.66	550.84	1099.66	2	-1.93	18.7	26656	50	3	36 - 45	R.VIDASLTLIR.E
1395	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	48	456.72	911.42	456.72	911.42	2	-0.21	10.6	27927	40	3	208 - 215	R.IMEGGYAR.R	Oxidation: 2
1395	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	358	770.42	1538.83	770.42	1538.83	2	0.65	17.7	75736	39	5	113 - 126	R.VLTDVGDVPVQEIR.D
1395	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	274	399.76	797.51	399.76	797.51	2	-0.57	15.8	10246	42	3	217 - 223	R.LLQVGIR.S
1395	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	377	770.42	1538.83	770.42	1538.83	2	0.85	18.2	39192	26	5	113 - 126	R.VLTDVGDVPVQEIR.D
1395	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	382	513.95	1538.83	513.95	1538.83	3	1.15	18.3	33411	16	3	113 - 126	R.VLTDVGDVPVQEIR.D
1395	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	51	456.72	911.42	456.72	911.42	2	0.36	10.7	25447	30	3	208 - 215	R.IMEGGYAR.R	Oxidation: 2
1395	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	272	798.52	797.51	798.52	797.51	1	-0.55	15.7	8577	20	2	217 - 223	R.LLQVGIR.S
1395	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	241	587.76	1173.51	587.76	1173.51	2	-0.15	15	3808	65	3	236 - 244	R.FGVEQYEMR.T	Oxidation: 8
1395	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	394	550.84	1099.66	550.84	1099.66	2	-1.09	18.6	8125	81	3	36 - 45	R.VIDASLTLIR.E
1395	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	376	770.42	1538.82	770.42	1538.83	2	-3.63	18.2	87107	17	5	113 - 126	R.VLTDVGDVPVQEIR.D
1395	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	268	399.76	797.51	399.76	797.51	2	-0.27	15.6	8157	33	3	217 - 223	R.LLQVGIR.S
1395	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	40	407.76	813.51	407.76	813.51	2	-0.31	10.4	17387	39	3	50 - 56	K.LKGELVR.L
1395	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	379	770.42	1538.83	770.42	1538.83	2	1.42	18.3	14976	33	5	113 - 126	R.VLTDVGDVPVQEIR.D
1450	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	230	477.81	953.61	477.81	953.61	2	-5.11	14.1	7530	42	3	216 - 223	R.RLLQVGIR.S
1450	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	119	448.72	895.42	448.72	895.42	2	-4.72	11.6	114559	15	1	208 - 215	R.IMEGGYAR.R
1450	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	374	770.42	1538.83	770.42	1538.83	2	-0.20	17.3	45808	70	5	113 - 126	R.VLTDVGDVPVQEIR.D
1450	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	401	770.42	1538.83	770.42	1538.83	2	0.35	17.9	6823	27	5	113 - 126	R.VLTDVGDVPVQEIR.D
1450	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	54	456.71	911.41	456.72	911.42	2	-6.69	10.1	108892	34	3	208 - 215	R.IMEGGYAR.R	Oxidation: 2
1450	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	531	874.46	2620.37	874.47	2620.38	3	-1.34	20.8	137922	53	3	63 - 88	K.ASTSLLGVPLGHNSSFLQGPAFAPPR.I
1450	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	225	477.81	953.61	477.81	953.61	2	-6.03	14	16806	42	3	216 - 223	R.RLLQVGIR.S
1450	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	416	550.84	1099.66	550.84	1099.66	2	-2.05	18.3	7542	75	3	36 - 45	R.VIDASLTLIR.E
1450	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	279	798.52	797.51	798.52	797.51	1	-3.21	15.2	32473	38	3	217 - 223	R.LLQVGIR.S
1450	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	419	1100.66	1099.66	1100.67	1099.66	1	-2.42	18.3	12522	20	3	36 - 45	R.VIDASLTLIR.E
1450	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	275	399.76	797.51	399.76	797.51	2	-4.70	15.1	38094	42	3	217 - 223	R.LLQVGIR.S
1450	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	402	513.95	1538.83	513.95	1538.83	3	0.35	17.9	4121	18	3	113 - 126	R.VLTDVGDVPVQEIR.D
1450	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	251	587.76	1173.51	587.76	1173.51	2	-1.78	14.6	29691	68	3	236 - 244	R.FGVEQYEMR.T	Oxidation: 8
1450	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	417	1100.67	1099.66	1100.67	1099.66	1	-2.05	18.3	4678	30	3	36 - 45	R.VIDASLTLIR.E
1450	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	412	550.83	1099.65	550.84	1099.66	2	-7.35	18.2	14758	77	3	36 - 45	R.VIDASLTLIR.E
1450	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	323	579.76	1157.51	579.77	1157.52	2	-4.72	16.2	13347	79	2	236 - 244	R.FGVEQYEMR.T
1450	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	277	798.52	797.51	798.52	797.51	1	-4.70	15.1	65890	35	3	217 - 223	R.LLQVGIR.S
1450	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	398	770.42	1538.83	770.42	1538.83	2	0.99	17.9	7858	28	5	113 - 126	R.VLTDVGDVPVQEIR.D
1450	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	534	874.46	2620.37	874.47	2620.38	3	-2.68	20.9	26400	44	3	63 - 88	K.ASTSLLGVPLGHNSSFLQGPAFAPPR.I
1450	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	250	587.76	1173.51	587.76	1173.51	2	-1.90	14.5	25104	78	3	236 - 244	R.FGVEQYEMR.T	Oxidation: 8
1450	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	414	1100.67	1099.66	1100.67	1099.66	1	-2.05	18.2	5003	20	3	36 - 45	R.VIDASLTLIR.E
1450	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	254	587.76	1173.51	587.76	1173.51	2	-2.10	14.6	20398	73	3	236 - 244	R.FGVEQYEMR.T	Oxidation: 8
1450	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	227	477.81	953.61	477.81	953.61	2	-4.05	14	15796	42	3	216 - 223	R.RLLQVGIR.S
1450	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	413	550.84	1099.66	550.84	1099.66	2	-2.05	18.2	6436	75	3	36 - 45	R.VIDASLTLIR.E
1450	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	399	513.95	1538.83	513.95	1538.83	3	0.99	17.9	6001	24	3	113 - 126	R.VLTDVGDVPVQEIR.D
1450	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	45	407.76	813.50	407.76	813.51	2	-5.75	9.9	18371	39	3	50 - 56	K.LKGELVR.L
1450	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	278	399.76	797.51	399.76	797.51	2	-3.20	15.2	40996	42	3	217 - 223	R.LLQVGIR.S
1450	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	281	399.76	797.51	399.76	797.51	2	-3.37	15.2	42756	42	3	217 - 223	R.LLQVGIR.S
1450	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	428	706.13	2820.48	706.13	2820.48	4	0.03	18.5	22464	16	2	145 - 169	K.LVMEEEPLRPLVLGGDHSISYPVVR.A	Oxidation: 3
1450	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	282	798.52	797.51	798.52	797.51	1	-3.38	15.3	26263	30	3	217 - 223	R.LLQVGIR.S
1450	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	205	444.21	1329.61	444.21	1329.61	3	-1.85	13.5	20141	31	1	235 - 244	K.RFGVEQYEMR.T	Oxidation: 9
1450	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	320	579.76	1157.51	579.77	1157.52	2	-4.19	16.1	30162	66	2	236 - 244	R.FGVEQYEMR.T
1450	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	371	770.42	1538.83	770.42	1538.83	2	-0.75	17.3	6393	91	5	113 - 126	R.VLTDVGDVPVQEIR.D
1450	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	395	770.42	1538.83	770.42	1538.83	2	-0.49	17.8	2136	20	5	113 - 126	R.VLTDVGDVPVQEIR.D
1450	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	431	706.13	2820.49	706.13	2820.48	4	0.60	18.6	17317	21	2	145 - 169	K.LVMEEEPLRPLVLGGDHSISYPVVR.A	Oxidation: 3
1450	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	59	456.71	911.41	456.72	911.42	2	-3.30	10.3	18825	36	3	208 - 215	R.IMEGGYAR.R	Oxidation: 2
1450	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	43	407.76	813.50	407.76	813.51	2	-5.85	9.9	13645	39	3	50 - 56	K.LKGELVR.L
1450	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	56	456.71	911.41	456.72	911.42	2	-4.11	10.2	14078	36	3	208 - 215	R.IMEGGYAR.R	Oxidation: 2
1450	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	529	874.46	2620.36	874.47	2620.38	3	-4.79	20.8	71521	72	3	63 - 88	K.ASTSLLGVPLGHNSSFLQGPAFAPPR.I
1450	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	48	407.76	813.50	407.76	813.51	2	-5.85	10	49152	36	3	50 - 56	K.LKGELVR.L
1450	AT4G08900.1	arginase	amino acid metabolism	g) other metabolic pathways	NEW mitochondria	397	513.95	1538.83	513.95	1538.83	3	-0.49	17.8	10900	24	3	113 - 126	R.VLTDVGDVPVQEIR.D
941	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	222	550.84	1099.67	550.84	1099.66	2	11.40	18.7	35680	71	3	38 - 47	R.VIDASLTLIR.E
941	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	135	399.77	797.52	399.76	797.51	2	8.16	15.7	45541	43	3	219 - 225	R.LLQVGIR.S
941	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	228	706.14	2820.53	706.13	2820.48	4	14.86	19	3324	21	2	147 - 171	K.LVMEEEPLRPLVIGGDHSISYPVVR.A	Oxidation: 3
941	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	2	686.30	1370.59	686.29	1370.57	2	14.85	10.1	5568	60	2	321 - 333	R.DTADDMTAMVAAK.F	Oxidation: 6
941	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	149	701.38	1400.75	701.37	1400.73	2	13.62	16.1	6408	88	3	25 - 37	R.SLPTSLVETGQNR.V
941	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	204	513.96	1538.86	513.95	1538.83	3	16.54	18.2	7134	16	3	115 - 128	R.VLSDVGDIPVQEIR.E
941	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	114	587.77	1173.53	587.76	1173.51	2	12.73	15	12617	73	3	238 - 246	R.FGVEQYEMR.T	Oxidation: 8
941	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	226	706.14	2820.52	706.13	2820.48	4	13.30	18.9	2991	36	2	147 - 171	K.LVMEEEPLRPLVIGGDHSISYPVVR.A	Oxidation: 3
941	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	250	706.40	2821.55	706.39	2821.52	4	10.73	20.2	3280	29	1	65 - 92	K.ATTALLGVPLGHNSSFLEGPALAPPHVR.E
941	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	101	477.82	953.62	477.81	953.61	2	7.34	14.6	8213	24	1	218 - 225	R.RLLQVGIR.S
941	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	1	686.30	1370.59	686.29	1370.57	2	16.61	10.1	4262	33	2	321 - 333	R.DTADDMTAMVAAK.F	Oxidation: 6
941	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	133	399.77	797.52	399.76	797.51	2	6.06	15.6	13168	31	3	219 - 225	R.LLQVGIR.S
941	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	206	513.96	1538.86	513.95	1538.83	3	16.75	18.3	10524	35	3	115 - 128	R.VLSDVGDIPVQEIR.E
941	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	160	579.78	1157.54	579.77	1157.52	2	15.97	16.5	4579	40	2	238 - 246	R.FGVEQYEMR.T
941	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	9	456.72	911.43	456.72	911.42	2	9.00	10.4	19935	42	4	210 - 217	R.IMEGGYAR.R	Oxidation: 2
941	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	159	579.77	1157.53	579.77	1157.52	2	14.99	16.5	3917	55	2	238 - 246	R.FGVEQYEMR.T
941	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	5	407.76	813.52	407.76	813.51	2	9.67	10.3	13892	27	4	52 - 58	K.LKGELVR.L
941	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	7	456.72	911.43	456.72	911.42	2	11.85	10.4	7850	27	4	210 - 217	R.IMEGGYAR.R	Oxidation: 2
941	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	8	456.72	911.43	456.72	911.42	2	10.98	10.4	13716	44	4	210 - 217	R.IMEGGYAR.R	Oxidation: 2
941	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	143	701.38	1400.74	701.37	1400.73	2	11.96	16	5563	67	3	25 - 37	R.SLPTSLVETGQNR.V
941	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	10	456.72	911.43	456.72	911.42	2	11.65	10.5	17722	32	4	210 - 217	R.IMEGGYAR.R	Oxidation: 2
941	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	134	399.77	797.52	399.76	797.51	2	8.09	15.7	32377	43	3	219 - 225	R.LLQVGIR.S
941	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	205	513.96	1538.86	513.95	1538.83	3	17.10	18.3	10733	33	3	115 - 128	R.VLSDVGDIPVQEIR.E
941	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	113	587.77	1173.52	587.76	1173.51	2	9.84	14.9	4716	31	3	238 - 246	R.FGVEQYEMR.T	Oxidation: 8
941	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	6	407.76	813.51	407.76	813.51	2	8.35	10.3	11354	27	4	52 - 58	K.LKGELVR.L
941	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	118	587.77	1173.53	587.76	1173.51	2	13.55	15.1	15708	70	3	238 - 246	R.FGVEQYEMR.T	Oxidation: 8
941	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	203	770.44	1538.86	770.42	1538.83	2	17.44	18.2	4983	47	2	115 - 128	R.VLSDVGDIPVQEIR.E
941	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	3	407.76	813.51	407.76	813.51	2	6.36	10.2	5787	19	4	52 - 58	K.LKGELVR.L
941	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	220	550.84	1099.67	550.84	1099.66	2	11.94	18.6	21267	75	3	38 - 47	R.VIDASLTLIR.E
941	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	190	770.43	1538.85	770.42	1538.83	2	14.03	17.7	18533	17	2	115 - 128	R.VLSDVGDIPVQEIR.E
941	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	146	701.38	1400.75	701.37	1400.73	2	15.51	16.1	7924	78	3	25 - 37	R.SLPTSLVETGQNR.V
941	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	219	550.84	1099.67	550.84	1099.66	2	12.05	18.6	10244	75	3	38 - 47	R.VIDASLTLIR.E
941	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	4	407.76	813.51	407.76	813.51	2	9.13	10.3	10875	39	4	52 - 58	K.LKGELVR.L
1167	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	280	550.84	1099.67	550.84	1099.66	2	9.27	18.6	5523	43	3	38 - 47	R.VIDASLTLIR.E
1167	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	279	550.84	1099.66	550.84	1099.66	2	3.54	18.5	3579	47	3	38 - 47	R.VIDASLTLIR.E
1167	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	281	550.84	1099.67	550.84	1099.66	2	5.70	18.6	4559	31	3	38 - 47	R.VIDASLTLIR.E
1167	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	265	770.43	1538.85	770.42	1538.83	2	12.22	18.2	5112	46	2	115 - 128	R.VLSDVGDIPVQEIR.E
1167	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	264	770.43	1538.85	770.42	1538.83	2	12.53	18.1	4811	48	2	115 - 128	R.VLSDVGDIPVQEIR.E
1227	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	177	770.43	1538.84	770.42	1538.83	2	7.30	18.1	3882	67	1	115 - 128	R.VLSDVGDIPVQEIR.E
1227	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	5	456.72	911.42	456.72	911.42	2	1.69	10.2	4366	19	1	210 - 217	R.IMEGGYAR.R	Oxidation: 2
1282	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	296	550.84	1099.66	550.84	1099.66	2	-2.45	18.5	5984	49	2	38 - 47	R.VIDASLTLIR.E
1282	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	22	407.76	813.51	407.76	813.51	2	1.73	10.2	6706	27	3	52 - 58	K.LKGELVR.L
1282	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	215	701.37	1400.73	701.37	1400.73	2	1.53	15.8	5112	63	3	25 - 37	R.SLPTSLVETGQNR.V
1282	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	179	587.77	1173.52	587.76	1173.51	2	4.14	14.8	13437	59	2	238 - 246	R.FGVEQYEMR.T	Oxidation: 8
1282	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	156	477.81	953.61	477.81	953.61	2	-4.97	14.3	11980	16	1	218 - 225	R.RLLQVGIR.S
1282	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	284	770.43	1538.84	770.42	1538.83	2	5.17	18.1	12687	55	4	115 - 128	R.VLSDVGDIPVQEIR.E
1282	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	175	587.77	1173.52	587.76	1173.51	2	5.86	14.8	5491	42	2	238 - 246	R.FGVEQYEMR.T	Oxidation: 8
1282	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	57	448.72	895.42	448.72	895.42	2	0.82	11.7	9857	20	2	210 - 217	R.IMEGGYAR.R
1282	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	23	407.76	813.50	407.76	813.51	2	-2.81	10.3	5469	19	3	52 - 58	K.LKGELVR.L
1282	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	21	407.76	813.51	407.76	813.51	2	7.52	10.2	4566	30	3	52 - 58	K.LKGELVR.L
1282	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	285	770.43	1538.84	770.42	1538.83	2	5.34	18.1	12116	57	4	115 - 128	R.VLSDVGDIPVQEIR.E
1282	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	24	456.72	911.42	456.72	911.42	2	0.01	10.3	4703	28	4	210 - 217	R.IMEGGYAR.R	Oxidation: 2
1282	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	218	701.37	1400.73	701.37	1400.73	2	2.47	15.9	7806	71	3	25 - 37	R.SLPTSLVETGQNR.V
1282	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	302	706.13	2820.49	706.13	2820.48	4	0.70	18.8	3336	19	1	147 - 171	K.LVMEEEPLRPLVIGGDHSISYPVVR.A	Oxidation: 3
1282	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	295	550.84	1099.66	550.84	1099.66	2	-1.16	18.5	5191	53	2	38 - 47	R.VIDASLTLIR.E
1282	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	282	770.42	1538.83	770.42	1538.83	2	-1.15	18	3634	48	4	115 - 128	R.VLSDVGDIPVQEIR.E
1282	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	55	448.72	895.43	448.72	895.42	2	3.97	11.7	6115	29	2	210 - 217	R.IMEGGYAR.R
1282	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	25	456.72	911.42	456.72	911.42	2	0.73	10.4	13112	29	4	210 - 217	R.IMEGGYAR.R	Oxidation: 2
1282	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	19	686.30	1370.58	686.29	1370.57	2	7.20	10.1	7042	74	2	321 - 333	R.DTADDMTAMVAAK.F	Oxidation: 6
1282	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	204	399.76	797.51	399.76	797.51	2	-5.80	15.4	11531	31	2	219 - 225	R.LLQVGIR.S
1282	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	28	456.72	911.42	456.72	911.42	2	1.60	10.5	16110	24	4	210 - 217	R.IMEGGYAR.R	Oxidation: 2
1282	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	219	701.37	1400.73	701.37	1400.73	2	6.21	15.9	5787	64	3	25 - 37	R.SLPTSLVETGQNR.V
1282	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	283	770.42	1538.83	770.42	1538.83	2	2.21	18.1	8192	74	4	115 - 128	R.VLSDVGDIPVQEIR.E
1282	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	17	686.30	1370.58	686.29	1370.57	2	8.98	10.1	4018	49	2	321 - 333	R.DTADDMTAMVAAK.F	Oxidation: 6
1282	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	26	456.72	911.42	456.72	911.42	2	3.11	10.4	23010	26	4	210 - 217	R.IMEGGYAR.R	Oxidation: 2
1282	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	206	399.76	797.51	399.76	797.51	2	-2.27	15.5	25249	26	2	219 - 225	R.LLQVGIR.S
1339	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	97	446.23	890.44	446.23	890.45	2	-9.91	11.4	8215	23	4	253 - 259	R.QMLENLK.L	Oxidation: 2
1339	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	124	678.29	1354.56	678.29	1354.57	2	-7.62	12	12564	92	1	321 - 333	R.DTADDMTAMVAAK.F	Oxidation: 6
1339	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	131	442.20	1323.57	442.20	1323.58	3	-7.58	12.1	18597	22	1	129 - 139	R.EMGVDDDRLMK.V	Oxidation: 2
1339	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	266	798.51	797.51	798.52	797.51	1	-6.06	15.2	6318	43	1	219 - 225	R.LLQVGIR.S
1339	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	104	446.23	890.44	446.23	890.45	2	-9.22	11.5	52117	18	4	253 - 259	R.QMLENLK.L	Oxidation: 2
1339	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	262	399.76	797.50	399.76	797.51	2	-11.38	15.1	26004	32	3	219 - 225	R.LLQVGIR.S
1339	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	31	457.86	1370.56	457.86	1370.57	3	-6.83	9.8	11486	59	1	321 - 333	R.DTADDMTAMVAAK.F	Oxidation: 6
1339	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	51	447.53	1339.57	447.53	1339.57	3	-7.02	10.3	23989	40	3	129 - 139	R.EMGVDDDRLMK.V	Oxidation: 2
1339	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	236	545.91	1634.70	545.91	1634.71	3	-3.97	14.5	7313	52	1	196 - 209	R.FEGNYYSHASSFAR.I
1339	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	441	529.77	2115.06	529.78	2115.07	4	-8.14	19.2	3477	35	3	177 - 195	K.LGGPVDILHLDAHPDIYDR.F
1339	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	268	399.76	797.51	399.76	797.51	2	-7.02	15.2	25353	35	3	219 - 225	R.LLQVGIR.S
1339	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	466	706.38	2821.51	706.39	2821.52	4	-5.15	19.8	14843	27	3	65 - 92	K.ATTALLGVPLGHNSSFLEGPALAPPHVR.E
1339	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	381	513.95	1538.82	513.95	1538.83	3	-7.12	17.8	16107	60	2	115 - 128	R.VLSDVGDIPVQEIR.E
1339	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	238	587.76	1173.50	587.76	1173.51	2	-6.37	14.6	28895	72	3	238 - 246	R.FGVEQYEMR.T	Oxidation: 8
1339	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	306	670.30	1338.58	670.30	1338.58	2	0.10	16.1	23269	73	1	321 - 333	R.DTADDMTAMVAAK.F
1339	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	49	447.53	1339.57	447.53	1339.57	3	-5.03	10.2	30099	32	3	129 - 139	R.EMGVDDDRLMK.V	Oxidation: 2
1339	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	29	686.29	1370.56	686.29	1370.57	2	-6.83	9.8	23860	80	2	321 - 333	R.DTADDMTAMVAAK.F	Oxidation: 6
1339	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	58	470.22	938.42	469.72	937.43	2	1049.78	10.4	17637	19	1	210 - 217	R.IMEGGYAR.R	Acetyl: 1
1339	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	383	770.42	1538.82	770.42	1538.83	2	-7.27	17.9	32451	82	3	115 - 128	R.VLSDVGDIPVQEIR.E
1339	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	100	446.23	890.45	446.23	890.45	2	-9.06	11.5	8336	22	4	253 - 259	R.QMLENLK.L	Oxidation: 2
1339	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	284	701.37	1400.72	701.37	1400.73	2	-4.87	15.6	7368	76	3	25 - 37	R.SLPTSLVETGQNR.V
1339	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	463	706.38	2821.51	706.39	2821.52	4	-5.66	19.7	9546	25	3	65 - 92	K.ATTALLGVPLGHNSSFLEGPALAPPHVR.E
1339	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	467	941.51	2821.51	941.52	2821.52	3	-5.15	19.8	12313	46	2	65 - 92	K.ATTALLGVPLGHNSSFLEGPALAPPHVR.E
1339	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	35	407.76	813.50	407.76	813.51	2	-9.48	9.9	8207	36	3	52 - 58	K.LKGELVR.L
1339	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	27	686.29	1370.56	686.29	1370.57	2	-8.55	9.7	7606	73	2	321 - 333	R.DTADDMTAMVAAK.F	Oxidation: 6
1339	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	265	399.76	797.51	399.76	797.51	2	-6.05	15.2	28682	42	3	219 - 225	R.LLQVGIR.S
1339	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	380	770.42	1538.82	770.42	1538.83	2	-7.14	17.8	60922	95	3	115 - 128	R.VLSDVGDIPVQEIR.E
1339	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	282	701.37	1400.72	701.37	1400.73	2	-7.16	15.6	9974	85	3	25 - 37	R.SLPTSLVETGQNR.V
1339	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	413	706.12	2820.47	706.13	2820.48	4	-5.14	18.6	79631	15	1	147 - 171	K.LVMEEEPLRPLVIGGDHSISYPVVR.A	Oxidation: 3
1339	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	287	467.91	1400.72	467.92	1400.73	3	-5.38	15.7	9192	23	2	25 - 37	R.SLPTSLVETGQNR.V
1339	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	280	701.37	1400.72	701.37	1400.73	2	-6.95	15.5	8743	75	3	25 - 37	R.SLPTSLVETGQNR.V
1339	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	377	770.41	1538.81	770.42	1538.83	2	-10.33	17.8	40053	63	3	115 - 128	R.VLSDVGDIPVQEIR.E
1339	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	215	477.81	953.60	477.81	953.61	2	-8.88	14	18385	33	1	218 - 225	R.RLLQVGIR.S
1339	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	302	579.76	1157.51	579.77	1157.52	2	-4.50	16	29772	73	3	238 - 246	R.FGVEQYEMR.T
1339	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	447	529.77	2115.06	529.78	2115.07	4	-7.91	19.3	4768	43	3	177 - 195	K.LGGPVDILHLDAHPDIYDR.F
1339	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	470	706.38	2821.51	706.39	2821.52	4	-4.64	19.8	13937	22	3	65 - 92	K.ATTALLGVPLGHNSSFLEGPALAPPHVR.E
1339	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	43	456.71	911.41	456.72	911.42	2	-9.30	10.1	8036	37	3	210 - 217	R.IMEGGYAR.R	Oxidation: 2
1339	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	286	467.91	1400.72	467.92	1400.73	3	-4.87	15.6	11330	62	2	25 - 37	R.SLPTSLVETGQNR.V
1339	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	304	579.76	1157.51	579.77	1157.52	2	-6.45	16.1	29718	78	3	238 - 246	R.FGVEQYEMR.T
1339	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	472	747.36	3731.76	747.36	3731.78	5	-3.07	19.9	18695	26	1	177 - 209	K.LGGPVDILHLDAHPDIYDRFEGNYYSHASSFAR.I
1339	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	199	438.23	874.45	438.24	874.46	2	-9.37	13.7	4228	25	2	253 - 259	R.QMLENLK.L
1339	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	243	587.76	1173.50	587.76	1173.51	2	-7.51	14.7	12933	78	3	238 - 246	R.FGVEQYEMR.T	Oxidation: 8
1339	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	94	446.23	890.44	446.23	890.45	2	-12.13	11.3	4451	23	4	253 - 259	R.QMLENLK.L	Oxidation: 2
1339	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	443	529.77	2115.06	529.78	2115.07	4	-7.42	19.2	38871	29	3	177 - 195	K.LGGPVDILHLDAHPDIYDR.F
1339	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	384	513.95	1538.82	513.95	1538.83	3	-7.26	17.9	16318	53	2	115 - 128	R.VLSDVGDIPVQEIR.E
1339	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	54	447.53	1339.57	447.53	1339.57	3	-5.90	10.3	13736	39	3	129 - 139	R.EMGVDDDRLMK.V	Oxidation: 2
1339	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	237	587.76	1173.51	587.76	1173.51	2	-5.61	14.5	4714	78	3	238 - 246	R.FGVEQYEMR.T	Oxidation: 8
1339	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	197	438.23	874.45	438.24	874.46	2	-7.63	13.6	10480	27	2	253 - 259	R.QMLENLK.L
1339	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	307	579.76	1157.51	579.77	1157.52	2	-6.34	16.2	9042	79	3	238 - 246	R.FGVEQYEMR.T
1339	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	42	456.71	911.41	456.72	911.42	2	-9.54	10.1	8488	38	3	210 - 217	R.IMEGGYAR.R	Oxidation: 2
1339	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	465	941.51	2821.51	941.52	2821.52	3	-5.66	19.7	4121	44	2	65 - 92	K.ATTALLGVPLGHNSSFLEGPALAPPHVR.E
1339	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	124	678.29	1354.56	678.29	1354.57	2	-7.62	12	12564	51	1	321 - 333	R.DTADDMTAMVAAK.F	Oxidation: 9
1339	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	473	622.97	3731.76	622.97	3731.78	6	-3.07	19.9	8395	26	2	177 - 209	K.LGGPVDILHLDAHPDIYDRFEGNYYSHASSFAR.I
1339	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	46	456.71	911.41	456.72	911.42	2	-8.73	10.2	16058	37	3	210 - 217	R.IMEGGYAR.R	Oxidation: 2
1339	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	476	622.97	3731.77	622.97	3731.78	6	-1.13	20	6651	19	2	177 - 209	K.LGGPVDILHLDAHPDIYDRFEGNYYSHASSFAR.I
1339	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	39	407.76	813.50	407.76	813.51	2	-12.45	10	6249	39	3	52 - 58	K.LKGELVR.L
1339	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	32	407.76	813.50	407.76	813.51	2	-10.88	9.8	14970	39	3	52 - 58	K.LKGELVR.L
1395	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	397	550.84	1099.66	550.84	1099.66	2	-1.76	18.7	100933	75	3	38 - 47	R.VIDASLTLIR.E
1395	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	34	686.29	1370.57	686.29	1370.57	2	1.45	10.3	3790	83	3	321 - 333	R.DTADDMTAMVAAK.F	Oxidation: 6
1395	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	287	467.92	1400.73	467.92	1400.73	3	1.31	16.1	91776	67	2	25 - 37	R.SLPTSLVETGQNR.V
1395	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	37	686.29	1370.57	686.29	1370.57	2	1.53	10.4	21488	91	3	321 - 333	R.DTADDMTAMVAAK.F	Oxidation: 6
1395	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	243	545.91	1634.72	545.91	1634.71	3	2.77	15	14495	44	2	196 - 209	R.FEGNYYSHASSFAR.I
1395	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	43	407.76	813.51	407.76	813.51	2	-2.20	10.5	30764	36	3	52 - 58	K.LKGELVR.L
1395	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	394	550.84	1099.66	550.84	1099.66	2	-1.09	18.6	8125	81	3	38 - 47	R.VIDASLTLIR.E
1395	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	57	447.53	1339.58	447.53	1339.57	3	1.27	10.8	27276	33	3	129 - 139	R.EMGVDDDRLMK.V	Oxidation: 2
1395	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	458	706.39	2821.53	706.39	2821.52	4	2.35	20	5850	18	3	65 - 92	K.ATTALLGVPLGHNSSFLEGPALAPPHVR.E
1395	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	127	678.30	1354.58	678.29	1354.57	2	5.09	12.4	6333	43	3	321 - 333	R.DTADDMTAMVAAK.F	Oxidation: 9
1395	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	241	587.76	1173.51	587.76	1173.51	2	-0.15	15	3808	65	3	238 - 246	R.FGVEQYEMR.T	Oxidation: 8
1395	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	582	931.15	2790.44	931.15	2790.43	3	4.00	24.8	6071	65	3	296 - 320	R.DVLNILHNLQGDLVGADVVEYNPQR.D
1395	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	584	931.15	2790.44	931.15	2790.43	3	3.69	24.9	16779	59	3	296 - 320	R.DVLNILHNLQGDLVGADVVEYNPQR.D
1395	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	133	442.20	1323.58	442.20	1323.58	3	3.00	12.6	15746	20	2	129 - 139	R.EMGVDDDRLMK.V	Oxidation: 2
1395	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	309	579.77	1157.52	579.77	1157.52	2	1.55	16.6	12916	65	2	238 - 246	R.FGVEQYEMR.T
1395	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	307	579.77	1157.52	579.77	1157.52	2	0.86	16.6	16392	73	2	238 - 246	R.FGVEQYEMR.T
1395	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	465	941.52	2821.54	941.52	2821.52	3	4.07	20.2	4623	33	3	65 - 92	K.ATTALLGVPLGHNSSFLEGPALAPPHVR.E
1395	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	99	446.23	890.45	446.23	890.45	2	0.11	11.8	26352	26	3	253 - 259	R.QMLENLK.L	Oxidation: 2
1395	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	244	587.76	1173.51	587.76	1173.51	2	-0.20	15.1	7624	68	3	238 - 246	R.FGVEQYEMR.T	Oxidation: 8
1395	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	127	678.30	1354.58	678.29	1354.57	2	5.09	12.4	6333	97	3	321 - 333	R.DTADDMTAMVAAK.F	Oxidation: 6
1395	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	51	456.72	911.42	456.72	911.42	2	0.36	10.7	25447	30	3	210 - 217	R.IMEGGYAR.R	Oxidation: 2
1395	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	271	399.76	797.51	399.76	797.51	2	-0.54	15.7	11301	42	3	219 - 225	R.LLQVGIR.S
1395	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	461	706.39	2821.53	706.39	2821.52	4	3.51	20.1	5541	23	3	65 - 92	K.ATTALLGVPLGHNSSFLEGPALAPPHVR.E
1395	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	274	399.76	797.51	399.76	797.51	2	-0.57	15.8	10246	42	3	219 - 225	R.LLQVGIR.S
1395	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	463	565.31	2821.53	565.31	2821.52	5	3.51	20.1	9568	37	1	65 - 92	K.ATTALLGVPLGHNSSFLEGPALAPPHVR.E
1395	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	40	407.76	813.51	407.76	813.51	2	-0.31	10.4	17387	39	3	52 - 58	K.LKGELVR.L
1395	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	378	513.95	1538.83	513.95	1538.83	3	0.86	18.2	14567	61	3	115 - 128	R.VLSDVGDIPVQEIR.E
1395	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	282	701.37	1400.73	701.37	1400.73	2	0.85	16	8258	75	3	25 - 37	R.SLPTSLVETGQNR.V
1395	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	380	513.95	1538.83	513.95	1538.83	3	1.42	18.3	13787	72	3	115 - 128	R.VLSDVGDIPVQEIR.E
1395	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	268	399.76	797.51	399.76	797.51	2	-0.27	15.6	8157	33	3	219 - 225	R.LLQVGIR.S
1395	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	105	446.23	890.45	446.23	890.45	2	0.55	11.9	47495	26	3	253 - 259	R.QMLENLK.L	Oxidation: 2
1395	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	36	457.86	1370.57	457.86	1370.57	3	1.45	10.3	24777	47	1	321 - 333	R.DTADDMTAMVAAK.F	Oxidation: 6
1395	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	179	678.30	1354.59	678.29	1354.57	2	10.92	13.6	6709	32	3	321 - 333	R.DTADDMTAMVAAK.F	Oxidation: 6
1395	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	133	442.20	1323.58	442.20	1323.58	3	3.00	12.6	15746	18	1	129 - 139	R.EMGVDDDRLMK.V	Oxidation: 10
1395	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	583	931.15	2790.44	931.15	2790.43	3	2.98	24.9	13096	70	3	296 - 320	R.DVLNILHNLQGDLVGADVVEYNPQR.D
1395	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	46	456.72	911.42	456.72	911.42	2	0.40	10.6	33748	36	3	210 - 217	R.IMEGGYAR.R	Oxidation: 2
1395	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	377	770.42	1538.83	770.42	1538.83	2	0.85	18.2	39192	91	3	115 - 128	R.VLSDVGDIPVQEIR.E
1395	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	240	587.77	1173.52	587.76	1173.51	2	3.26	15	4555	73	3	238 - 246	R.FGVEQYEMR.T	Oxidation: 8
1395	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	103	891.46	890.45	891.46	890.45	1	0.37	11.9	34895	28	2	253 - 259	R.QMLENLK.L	Oxidation: 2
1395	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	48	456.72	911.42	456.72	911.42	2	-0.21	10.6	27927	40	3	210 - 217	R.IMEGGYAR.R	Oxidation: 2
1395	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	106	891.46	890.45	891.46	890.45	1	0.56	12	31125	17	2	253 - 259	R.QMLENLK.L	Oxidation: 2
1395	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	270	798.52	797.51	798.52	797.51	1	-0.26	15.6	19436	32	2	219 - 225	R.LLQVGIR.S
1395	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	437	529.78	2115.08	529.78	2115.07	4	2.26	19.5	29590	33	2	177 - 195	K.LGGPVDILHLDAHPDIYDR.F
1395	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	459	941.52	2821.53	941.52	2821.52	3	2.34	20.1	9393	42	3	65 - 92	K.ATTALLGVPLGHNSSFLEGPALAPPHVR.E
1395	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	272	798.52	797.51	798.52	797.51	1	-0.55	15.7	8577	20	2	219 - 225	R.LLQVGIR.S
1395	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	130	678.30	1354.58	678.29	1354.57	2	4.81	12.5	11689	61	3	321 - 333	R.DTADDMTAMVAAK.F	Oxidation: 6
1395	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	238	545.91	1634.72	545.91	1634.71	3	2.35	14.9	15237	53	2	196 - 209	R.FEGNYYSHASSFAR.I
1395	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	206	438.24	874.46	438.24	874.46	2	1.90	14.2	9972	27	1	253 - 259	R.QMLENLK.L
1395	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	135	442.20	1323.58	442.20	1323.58	3	3.36	12.6	46387	31	2	129 - 139	R.EMGVDDDRLMK.V	Oxidation: 2
1395	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	38	407.76	813.50	407.76	813.51	2	-3.00	10.4	44900	36	3	52 - 58	K.LKGELVR.L
1395	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	283	701.37	1400.73	701.37	1400.73	2	1.45	16	7891	79	3	25 - 37	R.SLPTSLVETGQNR.V
1395	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	464	706.39	2821.54	706.39	2821.52	4	4.06	20.2	10905	36	3	65 - 92	K.ATTALLGVPLGHNSSFLEGPALAPPHVR.E
1395	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	54	447.53	1339.58	447.53	1339.57	3	1.52	10.7	20416	34	3	129 - 139	R.EMGVDDDRLMK.V	Oxidation: 2
1395	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	130	678.30	1354.58	678.29	1354.57	2	4.81	12.5	11689	40	3	321 - 333	R.DTADDMTAMVAAK.F	Oxidation: 9
1395	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	31	686.29	1370.57	686.29	1370.57	2	0.83	10.2	7154	76	3	321 - 333	R.DTADDMTAMVAAK.F	Oxidation: 6
1395	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	98	581.80	1161.58	581.80	1161.58	2	2.54	11.8	35723	27	1	251 - 259	K.DRQMLENLK.L	Oxidation: 4
1395	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	179	678.30	1354.59	678.29	1354.57	2	10.92	13.6	6709	71	3	321 - 333	R.DTADDMTAMVAAK.F	Oxidation: 9
1395	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	376	770.42	1538.82	770.42	1538.83	2	-3.63	18.2	87107	83	3	115 - 128	R.VLSDVGDIPVQEIR.E
1395	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	379	770.42	1538.83	770.42	1538.83	2	1.42	18.3	14976	96	3	115 - 128	R.VLSDVGDIPVQEIR.E
1395	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	402	550.84	1099.66	550.84	1099.66	2	-1.93	18.7	26656	50	3	38 - 47	R.VIDASLTLIR.E
1395	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	462	941.52	2821.53	941.52	2821.52	3	3.51	20.1	5988	46	3	65 - 92	K.ATTALLGVPLGHNSSFLEGPALAPPHVR.E
1395	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	60	447.53	1339.58	447.53	1339.57	3	2.35	10.9	26719	41	3	129 - 139	R.EMGVDDDRLMK.V	Oxidation: 2
1395	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	286	701.37	1400.73	701.37	1400.73	2	1.30	16.1	13325	71	3	25 - 37	R.SLPTSLVETGQNR.V
1395	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	58	670.80	1339.58	670.79	1339.57	2	1.27	10.8	24662	46	1	129 - 139	R.EMGVDDDRLMK.V	Oxidation: 2
1395	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	382	513.95	1538.83	513.95	1538.83	3	1.15	18.3	33411	74	3	115 - 128	R.VLSDVGDIPVQEIR.E
1395	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	290	467.92	1400.73	467.92	1400.73	3	1.09	16.2	190465	38	2	25 - 37	R.SLPTSLVETGQNR.V
1395	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	102	446.23	890.45	446.23	890.45	2	0.37	11.9	40031	24	3	253 - 259	R.QMLENLK.L	Oxidation: 2
1395	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	439	529.78	2115.08	529.78	2115.07	4	1.52	19.6	66028	35	2	177 - 195	K.LGGPVDILHLDAHPDIYDR.F
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	458	529.78	2115.07	529.78	2115.07	4	-0.04	19.2	7733	40	3	177 - 195	K.LGGPVDILHLDAHPDIYDR.F
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	323	579.76	1157.51	579.77	1157.52	2	-4.72	16.2	13347	79	2	238 - 246	R.FGVEQYEMR.T
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	254	587.76	1173.51	587.76	1173.51	2	-2.10	14.6	20398	73	3	238 - 246	R.FGVEQYEMR.T	Oxidation: 8
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	59	456.71	911.41	456.72	911.42	2	-3.30	10.3	18825	36	3	210 - 217	R.IMEGGYAR.R	Oxidation: 2
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	293	701.37	1400.72	701.37	1400.73	2	-3.44	15.5	78398	76	3	25 - 37	R.SLPTSLVETGQNR.V
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	300	467.91	1400.72	467.92	1400.73	3	-2.37	15.7	43947	67	3	25 - 37	R.SLPTSLVETGQNR.V
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	116	446.23	890.45	446.23	890.45	2	-5.45	11.5	66347	23	3	253 - 259	R.QMLENLK.L	Oxidation: 2
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	281	399.76	797.51	399.76	797.51	2	-3.37	15.2	42756	42	3	219 - 225	R.LLQVGIR.S
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	296	701.37	1400.72	701.37	1400.73	2	-2.50	15.6	118391	82	3	25 - 37	R.SLPTSLVETGQNR.V
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	113	446.23	890.45	446.23	890.45	2	-5.54	11.5	35742	28	3	253 - 259	R.QMLENLK.L	Oxidation: 2
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	428	706.13	2820.48	706.13	2820.48	4	0.03	18.5	22464	16	2	147 - 171	K.LVMEEEPLRPLVIGGDHSISYPVVR.A	Oxidation: 3
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	486	941.51	2821.52	941.52	2821.52	3	-1.26	19.8	35134	30	3	65 - 92	K.ATTALLGVPLGHNSSFLEGPALAPPHVR.E
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	398	770.42	1538.83	770.42	1538.83	2	0.99	17.9	7858	108	5	115 - 128	R.VLSDVGDIPVQEIR.E
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	225	477.81	953.61	477.81	953.61	2	-6.03	14	16806	42	3	218 - 225	R.RLLQVGIR.S
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	119	448.72	895.42	448.72	895.42	2	-4.72	11.6	114559	15	1	210 - 217	R.IMEGGYAR.R
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	114	891.46	890.45	891.46	890.45	1	-5.55	11.5	12522	34	2	253 - 259	R.QMLENLK.L	Oxidation: 2
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	145	662.80	1323.58	662.80	1323.58	2	-3.32	12.2	284316	28	1	129 - 139	R.EMGVDDDRLMK.V	Oxidation: 2
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	217	438.23	874.45	438.24	874.46	2	-5.26	13.8	54738	26	2	253 - 259	R.QMLENLK.L
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	482	706.39	2821.52	706.39	2821.52	4	-0.74	19.8	5712	35	3	65 - 92	K.ATTALLGVPLGHNSSFLEGPALAPPHVR.E
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	479	706.39	2821.52	706.39	2821.52	4	-1.32	19.7	6183	24	3	65 - 92	K.ATTALLGVPLGHNSSFLEGPALAPPHVR.E
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	28	686.29	1370.57	686.29	1370.57	2	-2.78	9.5	57658	42	6	321 - 333	R.DTADDMTAMVAAK.F	Oxidation: 6
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	525	565.51	2822.51	565.31	2821.52	5	347.23	20.7	143455	22	2	65 - 92	K.ATTALLGVPLGHNSSFLEGPALAPPHVR.E
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	144	442.20	1323.58	442.20	1323.58	3	-3.31	12.2	23500	18	1	129 - 139	R.EMGVDDDRLMK.V	Oxidation: 10
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	402	513.95	1538.83	513.95	1538.83	3	0.35	17.9	4121	82	3	115 - 128	R.VLSDVGDIPVQEIR.E
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	56	456.71	911.41	456.72	911.42	2	-4.11	10.2	14078	36	3	210 - 217	R.IMEGGYAR.R	Oxidation: 2
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	399	513.95	1538.83	513.95	1538.83	3	0.99	17.9	6001	82	3	115 - 128	R.VLSDVGDIPVQEIR.E
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	249	818.36	1634.71	818.36	1634.71	2	-1.43	14.5	13489	70	1	196 - 209	R.FEGNYYSHASSFAR.I
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	484	565.31	2821.52	565.31	2821.52	5	-0.74	19.8	16907	42	2	65 - 92	K.ATTALLGVPLGHNSSFLEGPALAPPHVR.E
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	69	670.79	1339.57	670.79	1339.57	2	-3.01	10.5	45808	42	3	129 - 139	R.EMGVDDDRLMK.V	Oxidation: 2
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	247	885.38	1768.75	885.39	1768.76	2	-1.97	14.5	46885	92	1	93 - 108	R.EAIWCGSTNSTTEEGK.E	Carbamidomethyl: 5
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	45	407.76	813.50	407.76	813.51	2	-5.75	9.9	18371	39	3	52 - 58	K.LKGELVR.L
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	65	447.53	1339.57	447.53	1339.57	3	-4.00	10.4	26882	33	4	129 - 139	R.EMGVDDDRLMK.V	Oxidation: 2
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	248	545.91	1634.71	545.91	1634.71	3	-1.44	14.5	13537	55	2	196 - 209	R.FEGNYYSHASSFAR.I
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	29	686.29	1370.57	686.29	1370.57	2	-2.82	9.6	80815	73	6	321 - 333	R.DTADDMTAMVAAK.F	Oxidation: 6
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	230	477.81	953.61	477.81	953.61	2	-5.11	14.1	7530	42	3	218 - 225	R.RLLQVGIR.S
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	40	457.86	1370.57	457.86	1370.57	3	-2.99	9.8	40743	58	2	321 - 333	R.DTADDMTAMVAAK.F	Oxidation: 6
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	110	446.23	890.45	446.23	890.45	2	-6.28	11.4	18400	27	3	253 - 259	R.QMLENLK.L	Oxidation: 2
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	43	407.76	813.50	407.76	813.51	2	-5.85	9.9	13645	39	3	52 - 58	K.LKGELVR.L
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	480	941.51	2821.52	941.52	2821.52	3	-1.32	19.7	47274	60	3	65 - 92	K.ATTALLGVPLGHNSSFLEGPALAPPHVR.E
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	294	467.91	1400.72	467.92	1400.73	3	-3.44	15.5	58593	62	3	25 - 37	R.SLPTSLVETGQNR.V
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	30	686.29	1370.57	686.29	1370.57	2	-3.19	9.6	28443	74	6	321 - 333	R.DTADDMTAMVAAK.F	Oxidation: 6
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	191	678.29	1354.57	678.29	1354.57	2	-0.93	13.2	38288	77	4	321 - 333	R.DTADDMTAMVAAK.F	Oxidation: 9
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	275	399.76	797.51	399.76	797.51	2	-4.70	15.1	38094	42	3	219 - 225	R.LLQVGIR.S
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	278	399.76	797.51	399.76	797.51	2	-3.20	15.2	40996	42	3	219 - 225	R.LLQVGIR.S
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	48	407.76	813.50	407.76	813.51	2	-5.85	10	49152	36	3	52 - 58	K.LKGELVR.L
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	639	931.15	2790.42	931.15	2790.43	3	-3.31	24.6	80815	76	2	296 - 320	R.DVLNILHNLQGDLVGADVVEYNPQR.D
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	374	770.42	1538.83	770.42	1538.83	2	-0.20	17.3	45808	16	5	115 - 128	R.VLSDVGDIPVQEIR.E
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	191	678.29	1354.57	678.29	1354.57	2	-0.93	13.2	38288	39	4	321 - 333	R.DTADDMTAMVAAK.F	Oxidation: 6
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	219	438.23	874.45	438.24	874.46	2	-5.19	13.8	31468	27	2	253 - 259	R.QMLENLK.L
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	419	1100.66	1099.66	1100.67	1099.66	1	-2.42	18.3	12522	20	3	38 - 47	R.VIDASLTLIR.E
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	299	701.37	1400.72	701.37	1400.73	2	-2.36	15.6	56369	82	3	25 - 37	R.SLPTSLVETGQNR.V
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	485	706.39	2821.52	706.39	2821.52	4	-1.25	19.8	15824	27	3	65 - 92	K.ATTALLGVPLGHNSSFLEGPALAPPHVR.E
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	227	477.81	953.61	477.81	953.61	2	-4.05	14	15796	42	3	218 - 225	R.RLLQVGIR.S
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	431	706.13	2820.49	706.13	2820.48	4	0.60	18.6	17317	21	2	147 - 171	K.LVMEEEPLRPLVIGGDHSISYPVVR.A	Oxidation: 3
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	54	456.71	911.41	456.72	911.42	2	-6.69	10.1	108892	34	3	210 - 217	R.IMEGGYAR.R	Oxidation: 2
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	137	678.29	1354.57	678.29	1354.57	2	-1.42	12	49773	102	4	321 - 333	R.DTADDMTAMVAAK.F	Oxidation: 6
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	141	678.29	1354.57	678.29	1354.57	2	-2.29	12.1	8268	92	4	321 - 333	R.DTADDMTAMVAAK.F	Oxidation: 6
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	250	587.76	1173.51	587.76	1173.51	2	-1.90	14.5	25104	78	3	238 - 246	R.FGVEQYEMR.T	Oxidation: 8
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	455	529.78	2115.07	529.78	2115.07	4	-1.51	19.1	12418	35	3	177 - 195	K.LGGPVDILHLDAHPDIYDR.F
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	144	442.20	1323.58	442.20	1323.58	3	-3.31	12.2	23500	22	2	129 - 139	R.EMGVDDDRLMK.V	Oxidation: 2
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	413	550.84	1099.66	550.84	1099.66	2	-2.05	18.2	6436	75	3	38 - 47	R.VIDASLTLIR.E
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	141	678.29	1354.57	678.29	1354.57	2	-2.29	12.1	8268	43	4	321 - 333	R.DTADDMTAMVAAK.F	Oxidation: 9
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	111	581.80	1161.58	581.80	1161.58	2	-3.85	11.4	7542	35	2	251 - 259	K.DRQMLENLK.L	Oxidation: 4
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	320	579.76	1157.51	579.77	1157.52	2	-4.19	16.1	30162	66	2	238 - 246	R.FGVEQYEMR.T
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	147	442.20	1323.58	442.20	1323.58	3	-3.19	12.2	38928	30	2	129 - 139	R.EMGVDDDRLMK.V	Oxidation: 2
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	297	467.91	1400.72	467.92	1400.73	3	-2.50	15.6	44282	67	3	25 - 37	R.SLPTSLVETGQNR.V
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	195	678.30	1354.58	678.29	1354.57	2	1.27	13.3	32409	64	4	321 - 333	R.DTADDMTAMVAAK.F	Oxidation: 9
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	371	770.42	1538.83	770.42	1538.83	2	-0.75	17.3	6393	18	5	115 - 128	R.VLSDVGDIPVQEIR.E
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	121	581.80	1161.58	581.80	1161.58	2	-2.34	11.6	46099	19	2	251 - 259	K.DRQMLENLK.L	Oxidation: 4
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	62	447.53	1339.57	447.53	1339.57	3	-3.35	10.3	30984	27	4	129 - 139	R.EMGVDDDRLMK.V	Oxidation: 2
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	397	513.95	1538.83	513.95	1538.83	3	-0.49	17.8	10900	69	3	115 - 128	R.VLSDVGDIPVQEIR.E
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	20	686.30	1370.58	686.29	1370.57	2	4.97	9.3	120668	36	6	321 - 333	R.DTADDMTAMVAAK.F	Oxidation: 6
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	34	447.53	1339.58	447.53	1339.57	3	3.89	9.7	42178	25	4	129 - 139	R.EMGVDDDRLMK.V	Oxidation: 2
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	279	798.52	797.51	798.52	797.51	1	-3.21	15.2	32473	38	3	219 - 225	R.LLQVGIR.S
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	251	587.76	1173.51	587.76	1173.51	2	-1.78	14.6	29691	68	3	238 - 246	R.FGVEQYEMR.T	Oxidation: 8
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	282	798.52	797.51	798.52	797.51	1	-3.38	15.3	26263	30	3	219 - 225	R.LLQVGIR.S
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	277	798.52	797.51	798.52	797.51	1	-4.70	15.1	65890	35	3	219 - 225	R.LLQVGIR.S
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	21	686.29	1370.57	686.29	1370.57	2	-0.89	9.3	37228	75	6	321 - 333	R.DTADDMTAMVAAK.F	Oxidation: 6
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	414	1100.67	1099.66	1100.67	1099.66	1	-2.05	18.2	5003	20	3	38 - 47	R.VIDASLTLIR.E
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	416	550.84	1099.66	550.84	1099.66	2	-2.05	18.3	7542	75	3	38 - 47	R.VIDASLTLIR.E
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	205	444.21	1329.61	444.21	1329.61	3	-1.85	13.5	20141	31	1	237 - 246	K.RFGVEQYEMR.T	Oxidation: 9
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	641	931.15	2790.43	931.15	2790.43	3	0.44	24.6	15531	68	2	296 - 320	R.DVLNILHNLQGDLVGADVVEYNPQR.D
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	137	678.29	1354.57	678.29	1354.57	2	-1.42	12	49773	44	4	321 - 333	R.DTADDMTAMVAAK.F	Oxidation: 9
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	68	447.53	1339.57	447.53	1339.57	3	-3.00	10.5	209463	31	4	129 - 139	R.EMGVDDDRLMK.V	Oxidation: 2
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	195	678.30	1354.58	678.29	1354.57	2	1.27	13.3	32409	37	4	321 - 333	R.DTADDMTAMVAAK.F	Oxidation: 6
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	412	550.83	1099.65	550.84	1099.66	2	-7.35	18.2	14758	77	3	38 - 47	R.VIDASLTLIR.E
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	483	941.51	2821.52	941.52	2821.52	3	-0.75	19.8	111329	71	3	65 - 92	K.ATTALLGVPLGHNSSFLEGPALAPPHVR.E
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	22	686.29	1370.57	686.29	1370.57	2	-2.04	9.3	24720	72	6	321 - 333	R.DTADDMTAMVAAK.F	Oxidation: 6
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	417	1100.67	1099.66	1100.67	1099.66	1	-2.05	18.3	4678	30	3	38 - 47	R.VIDASLTLIR.E
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	252	545.91	1634.71	545.91	1634.71	3	0.12	14.6	16997	57	2	196 - 209	R.FEGNYYSHASSFAR.I
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	401	770.42	1538.83	770.42	1538.83	2	0.35	17.9	6823	95	5	115 - 128	R.VLSDVGDIPVQEIR.E
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	66	670.79	1339.57	670.79	1339.57	2	-3.99	10.4	6393	55	3	129 - 139	R.EMGVDDDRLMK.V	Oxidation: 2
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	642	698.62	2790.43	698.61	2790.43	4	0.44	24.6	83663	31	1	296 - 320	R.DVLNILHNLQGDLVGADVVEYNPQR.D
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	395	770.42	1538.83	770.42	1538.83	2	-0.49	17.8	2136	78	5	115 - 128	R.VLSDVGDIPVQEIR.E
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	44	457.86	1370.56	457.86	1370.57	3	-3.75	9.9	41490	59	2	321 - 333	R.DTADDMTAMVAAK.F	Oxidation: 6
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	118	891.46	890.45	891.46	890.45	1	-5.46	11.6	27927	27	2	253 - 259	R.QMLENLK.L	Oxidation: 2
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	461	529.78	2115.07	529.78	2115.07	4	-0.51	19.3	3937	47	3	177 - 195	K.LGGPVDILHLDAHPDIYDR.F
1450	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	64	670.79	1339.57	670.79	1339.57	2	-3.35	10.3	12232	51	3	129 - 139	R.EMGVDDDRLMK.V	Oxidation: 2
1502	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	74	442.19	1323.56	442.20	1323.58	3	-13.60	12.2	9670	26	1	129 - 139	R.EMGVDDDRLMK.V	Oxidation: 10
1502	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	279	513.94	1538.81	513.95	1538.83	3	-12.18	18	17681	42	4	115 - 128	R.VLSDVGDIPVQEIR.E
1502	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	273	513.94	1538.81	513.95	1538.83	3	-12.08	17.9	6239	55	4	115 - 128	R.VLSDVGDIPVQEIR.E
1502	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	69	678.29	1354.56	678.29	1354.57	2	-11.99	12.1	5478	91	1	321 - 333	R.DTADDMTAMVAAK.F	Oxidation: 6
1502	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	194	399.76	797.50	399.76	797.51	2	-13.08	15.3	53019	34	3	219 - 225	R.LLQVGIR.S
1502	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	28	670.78	1339.56	670.79	1339.57	2	-14.52	10.4	17708	31	3	129 - 139	R.EMGVDDDRLMK.V	Oxidation: 2
1502	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	69	678.29	1354.56	678.29	1354.57	2	-11.99	12.1	5478	44	1	321 - 333	R.DTADDMTAMVAAK.F	Oxidation: 9
1502	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	11	407.75	813.50	407.76	813.51	2	-14.46	10	32647	39	3	52 - 58	K.LKGELVR.L
1502	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	276	770.41	1538.81	770.42	1538.83	2	-11.78	18	104231	82	4	115 - 128	R.VLSDVGDIPVQEIR.E
1502	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	219	701.36	1400.71	701.37	1400.73	2	-10.53	15.8	34910	81	5	25 - 37	R.SLPTSLVETGQNR.V
1502	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	286	550.83	1099.64	550.84	1099.66	2	-14.02	18.2	6611	70	3	38 - 47	R.VIDASLTLIR.E
1502	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	1	686.28	1370.55	686.29	1370.57	2	-10.78	9.7	10357	87	3	321 - 333	R.DTADDMTAMVAAK.F	Oxidation: 6
1502	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	277	513.94	1538.81	513.95	1538.83	3	-11.77	18	32575	69	4	115 - 128	R.VLSDVGDIPVQEIR.E
1502	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	56	446.23	890.44	446.23	890.45	2	-15.02	11.5	123997	24	4	253 - 259	R.QMLENLK.L	Oxidation: 2
1502	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	278	770.41	1538.81	770.42	1538.83	2	-12.20	18	55904	73	4	115 - 128	R.VLSDVGDIPVQEIR.E
1502	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	215	701.36	1400.71	701.37	1400.73	2	-11.00	15.7	59518	95	5	25 - 37	R.SLPTSLVETGQNR.V
1502	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	297	529.77	2115.05	529.78	2115.07	4	-12.35	19.3	4231	57	1	177 - 195	K.LGGPVDILHLDAHPDIYDR.F
1502	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	26	670.79	1339.56	670.79	1339.57	2	-13.98	10.4	3585	39	3	129 - 139	R.EMGVDDDRLMK.V	Oxidation: 2
1502	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	21	456.71	911.40	456.72	911.42	2	-14.64	10.2	163587	36	4	210 - 217	R.IMEGGYAR.R	Oxidation: 2
1502	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	137	438.23	874.44	438.24	874.46	2	-16.26	13.9	15115	34	1	253 - 259	R.QMLENLK.L
1502	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	169	587.76	1173.50	587.76	1173.51	2	-11.21	14.6	7318	72	3	238 - 246	R.FGVEQYEMR.T	Oxidation: 8
1502	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	23	456.71	911.40	456.72	911.42	2	-15.58	10.3	89870	35	4	210 - 217	R.IMEGGYAR.R	Oxidation: 2
1502	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	58	446.23	890.44	446.23	890.45	2	-15.60	11.6	84094	23	4	253 - 259	R.QMLENLK.L	Oxidation: 2
1502	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	51	446.23	890.44	446.23	890.45	2	-17.58	11.4	16064	29	4	253 - 259	R.QMLENLK.L	Oxidation: 2
1502	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	150	477.81	953.60	477.81	953.61	2	-18.26	14.2	4592	31	1	218 - 225	R.RLLQVGIR.S
1502	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	9	407.75	813.49	407.76	813.51	2	-15.76	9.9	9746	43	3	52 - 58	K.LKGELVR.L
1502	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	18	456.71	911.40	456.72	911.42	2	-14.23	10.2	84212	38	4	210 - 217	R.IMEGGYAR.R	Oxidation: 2
1502	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	16	456.71	911.40	456.72	911.42	2	-13.26	10.1	14289	42	4	210 - 217	R.IMEGGYAR.R	Oxidation: 2
1502	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	25	447.53	1339.56	447.53	1339.57	3	-13.97	10.4	25282	28	2	129 - 139	R.EMGVDDDRLMK.V	Oxidation: 2
1502	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	53	581.79	1161.57	581.80	1161.58	2	-13.42	11.4	4272	25	1	251 - 259	K.DRQMLENLK.L	Oxidation: 4
1502	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	218	467.91	1400.71	467.92	1400.73	3	-11.56	15.8	9761	67	4	25 - 37	R.SLPTSLVETGQNR.V
1502	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	172	545.90	1634.69	545.91	1634.71	3	-11.88	14.7	29685	48	3	196 - 209	R.FEGNYYSHASSFAR.I
1502	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	52	446.23	890.44	446.23	890.45	2	-15.76	11.4	44113	29	4	253 - 259	R.QMLENLK.L	Oxidation: 2
1502	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	76	442.19	1323.56	442.20	1323.58	3	-13.35	12.2	11150	27	2	129 - 139	R.EMGVDDDRLMK.V	Oxidation: 2
1502	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	197	399.76	797.50	399.76	797.51	2	-12.83	15.3	143424	42	3	219 - 225	R.LLQVGIR.S
1502	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	176	545.91	1634.71	545.91	1634.71	3	2.20	14.8	7319	46	3	196 - 209	R.FEGNYYSHASSFAR.I
1502	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	274	770.41	1538.81	770.42	1538.83	2	-11.59	17.9	90023	77	4	115 - 128	R.VLSDVGDIPVQEIR.E
1502	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	54	891.45	890.44	891.46	890.45	1	-14.66	11.5	3682	15	2	253 - 259	R.QMLENLK.L	Oxidation: 2
1502	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	27	447.53	1339.56	447.53	1339.57	3	-14.50	10.4	93431	36	2	129 - 139	R.EMGVDDDRLMK.V	Oxidation: 2
1502	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	225	579.76	1157.50	579.77	1157.52	2	-13.49	16.2	12661	79	3	238 - 246	R.FGVEQYEMR.T
1502	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	216	467.91	1400.71	467.92	1400.73	3	-10.98	15.8	12930	67	4	25 - 37	R.SLPTSLVETGQNR.V
1502	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	171	587.76	1173.50	587.76	1173.51	2	-13.01	14.7	83199	78	3	238 - 246	R.FGVEQYEMR.T	Oxidation: 8
1502	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	168	545.91	1634.69	545.91	1634.71	3	-10.03	14.6	19826	66	3	196 - 209	R.FEGNYYSHASSFAR.I
1502	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	4	457.86	1370.56	457.86	1370.57	3	-9.80	9.8	6611	53	2	321 - 333	R.DTADDMTAMVAAK.F	Oxidation: 6
1502	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	211	701.36	1400.71	701.37	1400.73	2	-11.64	15.6	31760	81	5	25 - 37	R.SLPTSLVETGQNR.V
1502	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	5	686.28	1370.55	686.29	1370.57	2	-11.11	9.8	85004	87	3	321 - 333	R.DTADDMTAMVAAK.F	Oxidation: 6
1502	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	174	587.76	1173.50	587.76	1173.51	2	-12.33	14.7	88662	73	3	238 - 246	R.FGVEQYEMR.T	Oxidation: 8
1502	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	213	701.36	1400.71	701.37	1400.73	2	-11.68	15.7	60733	77	5	25 - 37	R.SLPTSLVETGQNR.V
1502	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	212	467.91	1400.71	467.92	1400.73	3	-11.62	15.7	7619	67	4	25 - 37	R.SLPTSLVETGQNR.V
1502	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	200	399.76	797.50	399.76	797.51	2	-13.28	15.4	85850	42	3	219 - 225	R.LLQVGIR.S
1502	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	217	701.36	1400.71	701.37	1400.73	2	-11.57	15.8	44692	88	5	25 - 37	R.SLPTSLVETGQNR.V
1502	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	289	550.83	1099.64	550.84	1099.66	2	-15.16	18.3	26444	65	3	38 - 47	R.VIDASLTLIR.E
1502	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	30	670.79	1339.56	670.79	1339.57	2	-13.70	10.5	13460	15	3	129 - 139	R.EMGVDDDRLMK.V	Oxidation: 2
1502	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	13	407.75	813.49	407.76	813.51	2	-16.64	10	28211	43	3	52 - 58	K.LKGELVR.L
1502	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	214	467.91	1400.71	467.92	1400.73	3	-11.67	15.7	14826	81	4	25 - 37	R.SLPTSLVETGQNR.V
1502	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	227	579.76	1157.50	579.77	1157.52	2	-12.74	16.3	13034	69	3	238 - 246	R.FGVEQYEMR.T
1502	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	55	891.45	890.44	891.46	890.45	1	-15.44	11.5	4066	28	2	253 - 259	R.QMLENLK.L	Oxidation: 2
1502	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	74	442.19	1323.56	442.20	1323.58	3	-13.60	12.2	9670	16	2	129 - 139	R.EMGVDDDRLMK.V	Oxidation: 2
1502	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	287	550.83	1099.65	550.84	1099.66	2	-12.75	18.3	18106	75	3	38 - 47	R.VIDASLTLIR.E
1502	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	272	770.41	1538.81	770.42	1538.83	2	-12.09	17.9	17372	88	4	115 - 128	R.VLSDVGDIPVQEIR.E
1502	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	224	579.76	1157.51	579.77	1157.52	2	-10.00	16.2	6036	72	3	238 - 246	R.FGVEQYEMR.T
1502	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	7	457.86	1370.55	457.86	1370.57	3	-11.11	9.8	16979	59	2	321 - 333	R.DTADDMTAMVAAK.F	Oxidation: 6
1502	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	275	513.94	1538.81	513.95	1538.83	3	-11.58	17.9	27176	60	4	115 - 128	R.VLSDVGDIPVQEIR.E
1502	AT4G08870.1	arginase	amino acid metabolism	g) other metabolic pathways	mitochondria	2	686.29	1370.56	686.29	1370.57	2	-9.80	9.8	30554	87	3	321 - 333	R.DTADDMTAMVAAK.F	Oxidation: 6
713	AT1G01520.1	ASG4 (altered seed germination 4)	nucleic acid metabolism - general	f) nucleic acid biosynthesis & processing	nucleus	153	642.35	641.34	642.36	641.35	1	-16.16	12.9	18981	19	1	240 - 245	K.TTGHVK.R
713	AT1G01520.1	ASG4 (altered seed germination 4)	nucleic acid metabolism - general	f) nucleic acid biosynthesis & processing	nucleus	108	399.73	797.44	399.73	797.45	2	-17.38	11.5	18080	20	1	240 - 246	K.TTGHVKR.L
159	AT5G47570.1	ASHI	complex I	a) oxidative phosphorylation	mitochondria	14	423.22	844.43	423.23	844.45	2	-16.19	11.7	11532	48	4	31 - 39	R.AGMGLPVGK.H	Oxidation: 3
159	AT5G47570.1	ASHI	complex I	a) oxidative phosphorylation	mitochondria	13	423.22	844.43	423.23	844.45	2	-15.44	11.7	9958	36	4	31 - 39	R.AGMGLPVGK.H	Oxidation: 3
159	AT5G47570.1	ASHI	complex I	a) oxidative phosphorylation	mitochondria	16	423.22	844.43	423.23	844.45	2	-18.23	11.8	9074	42	4	31 - 39	R.AGMGLPVGK.H	Oxidation: 3
159	AT5G47570.1	ASHI	complex I	a) oxidative phosphorylation	mitochondria	12	423.22	844.43	423.23	844.45	2	-17.16	11.7	4997	41	4	31 - 39	R.AGMGLPVGK.H	Oxidation: 3
159	AT5G47570.1	ASHI	complex I	a) oxidative phosphorylation	mitochondria	68	520.26	1038.50	520.26	1038.51	2	-15.64	15.2	4261	30	1	111 - 118	R.VYPYDNLR.V
377	AT5G47570.1	ASHI	complex I	a) oxidative phosphorylation	mitochondria	36	423.23	844.44	423.23	844.45	2	-7.52	13.1	10860	37	6	31 - 39	R.AGMGLPVGK.H	Oxidation: 3
377	AT5G47570.1	ASHI	complex I	a) oxidative phosphorylation	mitochondria	61	700.35	699.34	700.35	699.34	1	-0.08	15.6	4436	22	1	119 - 125	R.VELGGEP.-
377	AT5G47570.1	ASHI	complex I	a) oxidative phosphorylation	mitochondria	35	423.23	844.44	423.23	844.45	2	-8.94	13.1	4034	47	6	31 - 39	R.AGMGLPVGK.H	Oxidation: 3
377	AT5G47570.1	ASHI	complex I	a) oxidative phosphorylation	mitochondria	39	423.23	844.44	423.23	844.45	2	-7.97	13.2	17316	44	6	31 - 39	R.AGMGLPVGK.H	Oxidation: 3
377	AT5G47570.1	ASHI	complex I	a) oxidative phosphorylation	mitochondria	99	520.26	1038.51	520.26	1038.51	2	-2.61	16.9	11890	53	1	111 - 118	R.VYPYDNLR.V
377	AT5G47570.1	ASHI	complex I	a) oxidative phosphorylation	mitochondria	40	423.23	844.44	423.23	844.45	2	-7.24	13.3	15704	30	6	31 - 39	R.AGMGLPVGK.H	Oxidation: 3
377	AT5G47570.1	ASHI	complex I	a) oxidative phosphorylation	mitochondria	37	423.23	844.44	423.23	844.45	2	-7.99	13.2	17894	64	6	31 - 39	R.AGMGLPVGK.H	Oxidation: 3
377	AT5G47570.1	ASHI	complex I	a) oxidative phosphorylation	mitochondria	38	423.23	844.44	423.23	844.45	2	-9.06	13.2	22091	53	6	31 - 39	R.AGMGLPVGK.H	Oxidation: 3
1163	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	265	788.09	2361.23	788.07	2361.20	3	14.86	20.4	3130	74	3	406 - 428	R.ISMAGVTTGNVGYLANAIHEVTK.S	Oxidation: 3
1163	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	32	477.73	953.45	477.73	953.44	2	12.11	11.2	4888	18	1	278 - 285	K.NMGLYGQR.V	Oxidation: 2
1163	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	122	702.88	1403.74	702.87	1403.72	2	12.54	14.2	18463	84	3	125 - 138	R.IAAVQTLSGTGACR.L	Carbamidomethyl: 13
1163	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	152	512.79	1023.56	512.78	1023.55	2	10.51	14.9	4922	38	1	139 - 146	R.LFADFQKR.F
1163	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	79	472.28	942.54	472.27	942.52	2	19.66	13	5668	17	1	304 - 311	K.SQLQQLAR.P
1163	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	202	658.35	1972.03	658.34	1972.01	3	11.12	16.8	3953	42	1	286 - 303	R.VGCLSVLCEDPKQAVAVK.S	Carbamidomethyl: 3
1163	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	262	663.83	1325.64	663.82	1325.62	2	13.93	19.5	5415	59	2	186 - 197	K.GLDFSALMDDVK.N	Oxidation: 8
1163	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	27	446.88	1337.62	446.88	1337.60	3	12.66	10.8	5948	22	1	176 - 185	K.TYHYYHPETK.G
1163	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	120	702.88	1403.74	702.87	1403.72	2	14.01	14.2	3633	76	3	125 - 138	R.IAAVQTLSGTGACR.L	Carbamidomethyl: 13
1163	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	261	663.83	1325.64	663.82	1325.62	2	18.52	19.5	5823	54	2	186 - 197	K.GLDFSALMDDVK.N	Oxidation: 8
1163	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	267	788.09	2361.23	788.07	2361.20	3	14.26	20.5	7002	31	3	406 - 428	R.ISMAGVTTGNVGYLANAIHEVTK.S	Oxidation: 3
1163	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	121	702.88	1403.74	702.87	1403.72	2	15.37	14.2	10838	111	3	125 - 138	R.IAAVQTLSGTGACR.L	Carbamidomethyl: 13
1163	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	124	468.92	1403.74	468.91	1403.72	3	12.53	14.3	5626	16	1	125 - 138	R.IAAVQTLSGTGACR.L	Carbamidomethyl: 13
1163	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	266	788.08	2361.23	788.07	2361.20	3	13.87	20.5	6498	28	3	406 - 428	R.ISMAGVTTGNVGYLANAIHEVTK.S	Oxidation: 3
1163	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	231	896.43	1790.85	896.42	1790.82	2	16.17	17.8	4719	42	1	87 - 103	R.LAGSTFMEYLPMGGSAK.M	Oxidation: 7
1224	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	112	702.88	1403.74	702.87	1403.72	2	11.86	14	5043	54	1	125 - 138	R.IAAVQTLSGTGACR.L	Carbamidomethyl: 13
1224	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	74	472.27	942.53	472.27	942.52	2	3.67	12.8	7190	16	1	304 - 311	K.SQLQQLAR.P
1278	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	427	788.08	2361.21	788.07	2361.20	3	4.95	20.2	5588	40	3	406 - 428	R.ISMAGVTTGNVGYLANAIHEVTK.S	Oxidation: 3
1278	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	56	446.88	1337.61	446.88	1337.60	3	4.11	10.4	16400	26	2	176 - 185	K.TYHYYHPETK.G
1278	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	426	788.08	2361.21	788.07	2361.20	3	5.78	20.1	13321	35	3	406 - 428	R.ISMAGVTTGNVGYLANAIHEVTK.S	Oxidation: 3
1278	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	95	538.80	1075.58	538.80	1075.59	2	-3.61	11.5	7150	19	1	354 - 362	R.TTLRESLEK.L
1278	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	425	788.08	2361.21	788.07	2361.20	3	3.61	20.1	22784	43	3	406 - 428	R.ISMAGVTTGNVGYLANAIHEVTK.S	Oxidation: 3
1278	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	59	446.88	1337.61	446.88	1337.60	3	1.58	10.5	4578	26	2	176 - 185	K.TYHYYHPETK.G
1278	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	406	663.82	1325.62	663.82	1325.62	2	1.51	19.2	12755	32	2	186 - 197	K.GLDFSALMDDVK.N	Oxidation: 8
1278	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	346	896.42	1790.83	896.42	1790.82	2	4.65	17.4	31606	86	3	87 - 103	R.LAGSTFMEYLPMGGSAK.M	Oxidation: 7
1278	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	349	896.42	1790.83	896.42	1790.82	2	4.36	17.5	28650	20	3	87 - 103	R.LAGSTFMEYLPMGGSAK.M	Oxidation: 7
1278	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	407	663.82	1325.62	663.82	1325.62	2	2.84	19.3	13793	30	2	186 - 197	K.GLDFSALMDDVK.N	Oxidation: 8
1278	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	311	658.34	1972.01	658.34	1972.01	3	-1.76	16.5	11030	20	1	286 - 303	R.VGCLSVLCEDPKQAVAVK.S	Carbamidomethyl: 3
1278	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	344	896.42	1790.83	896.42	1790.82	2	6.80	17.4	32939	32	3	87 - 103	R.LAGSTFMEYLPMGGSAK.M	Oxidation: 7
1278	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	197	702.87	1403.72	702.87	1403.72	2	2.41	13.8	9647	112	1	125 - 138	R.IAAVQTLSGTGACR.L	Carbamidomethyl: 13
1336	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	319	434.73	867.44	434.73	867.45	2	-6.24	16.1	11858	31	3	139 - 145	R.LFADFQK.R
1336	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	472	888.42	1774.82	888.42	1774.83	2	-3.47	19.6	51047	51	3	87 - 103	R.LAGSTFMEYLPMGGSAK.M	Oxidation: 12
1336	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	549	782.74	2345.20	782.74	2345.20	3	-2.55	21.6	57200	29	2	406 - 428	R.ISMAGVTTGNVGYLANAIHEVTK.S
1336	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	577	869.79	2606.34	869.79	2606.35	3	-2.16	22.2	23505	93	3	35 - 59	K.SVEPAPKDPILGVTEAFLADPSPEK.V
1336	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	434	760.35	2278.02	760.35	2278.03	3	-1.42	18.8	8518	41	1	235 - 254	K.KHFAFFDMAYQGFASGDPAR.D	Oxidation: 8
1336	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	217	468.91	1403.71	468.91	1403.72	3	-4.42	13.8	37495	47	1	125 - 138	R.IAAVQTLSGTGACR.L	Carbamidomethyl: 13
1336	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	255	418.23	834.44	418.23	834.45	2	-14.06	14.6	32794	21	1	104 - 110	K.MVDLTLK.L	Oxidation: 1
1336	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	302	479.50	1913.95	479.50	1913.96	4	-5.10	15.7	4245	39	2	261 - 277	R.IFLEDGHHIGISQSYAK.N
1336	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	218	702.86	1403.71	702.87	1403.72	2	-5.70	13.8	14845	114	2	125 - 138	R.IAAVQTLSGTGACR.L	Carbamidomethyl: 13
1336	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	339	864.47	863.47	864.48	863.48	1	-9.13	16.5	59777	17	2	226 - 232	R.EISQLFK.A
1336	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	492	788.07	2361.19	788.07	2361.20	3	-4.29	20.1	39783	45	3	406 - 428	R.ISMAGVTTGNVGYLANAIHEVTK.S	Oxidation: 3
1336	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	82	477.72	953.43	477.73	953.44	2	-6.44	10.8	5488	25	3	278 - 285	K.NMGLYGQR.V	Oxidation: 2
1336	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	386	896.41	1790.81	896.42	1790.82	2	-4.34	17.6	14340	27	3	87 - 103	R.LAGSTFMEYLPMGGSAK.M	Oxidation: 7
1336	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	435	888.42	1774.82	888.42	1774.83	2	-5.14	18.8	6812	24	3	87 - 103	R.LAGSTFMEYLPMGGSAK.M	Oxidation: 12
1336	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	476	1000.96	1999.91	1000.96	1999.91	2	-2.08	19.7	38945	56	1	375 - 391	K.QIGMFCYSGLTPEQVDR.L	Carbamidomethyl: 6
1336	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	271	471.90	1412.67	471.90	1412.68	3	-4.67	15	32190	41	2	392 - 402	R.LTSEYHIYMTR.N
1336	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	188	467.76	933.50	467.76	933.50	2	-7.83	13.2	69015	48	2	60 - 68	K.VNVGVGAYR.D
1336	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	318	434.73	867.44	434.73	867.45	2	-5.74	16.1	25178	28	3	139 - 145	R.LFADFQK.R
1336	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	182	469.73	937.44	469.73	937.44	2	-8.41	13	155824	35	1	278 - 285	K.NMGLYGQR.V
1336	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	307	628.81	1255.60	628.81	1255.61	2	-5.74	15.8	12273	77	2	111 - 121	K.LAYGDNSEFIK.D
1336	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	497	788.07	2361.19	788.07	2361.20	3	-4.48	20.2	24712	37	3	406 - 428	R.ISMAGVTTGNVGYLANAIHEVTK.S	Oxidation: 3
1336	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	341	864.48	863.47	864.48	863.48	1	-7.77	16.6	29918	29	2	226 - 232	R.EISQLFK.A
1336	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	305	628.81	1255.60	628.81	1255.61	2	-6.03	15.8	4056	77	2	111 - 121	K.LAYGDNSEFIK.D
1336	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	563	655.82	1309.62	655.82	1309.62	2	-3.95	21.9	5283	27	2	186 - 197	K.GLDFSALMDDVK.N
1336	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	470	888.42	1774.82	888.42	1774.83	2	-3.65	19.6	10475	65	3	87 - 103	R.LAGSTFMEYLPMGGSAK.M	Oxidation: 12
1336	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	79	477.72	953.43	477.73	953.44	2	-6.19	10.7	7390	26	3	278 - 285	K.NMGLYGQR.V	Oxidation: 2
1336	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	322	434.73	867.44	434.73	867.45	2	-7.39	16.2	14195	36	3	139 - 145	R.LFADFQK.R
1336	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	383	896.41	1790.81	896.42	1790.82	2	-4.01	17.5	11221	67	3	87 - 103	R.LAGSTFMEYLPMGGSAK.M	Oxidation: 7
1336	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	566	655.82	1309.62	655.82	1309.62	2	-4.66	21.9	4803	35	2	186 - 197	K.GLDFSALMDDVK.N
1336	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	453	663.82	1325.62	663.82	1325.62	2	-1.39	19.2	32960	58	3	186 - 197	K.GLDFSALMDDVK.N	Oxidation: 8
1336	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	435	888.42	1774.82	888.42	1774.83	2	-5.14	18.8	6812	62	1	87 - 103	R.LAGSTFMEYLPMGGSAK.M	Oxidation: 7
1336	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	461	663.81	1325.61	663.82	1325.62	2	-4.98	19.4	12821	27	3	186 - 197	K.GLDFSALMDDVK.N	Oxidation: 8
1336	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	456	663.81	1325.61	663.82	1325.62	2	-3.19	19.3	114598	55	3	186 - 197	K.GLDFSALMDDVK.N	Oxidation: 8
1336	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	481	652.83	2607.29	652.83	2607.30	4	-3.42	19.8	47914	19	1	147 - 168	R.FSPGSQIYIPVPTWSNHHNIWK.D
1336	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	328	451.91	1352.70	451.91	1352.71	3	-4.99	16.3	4939	41	2	363 - 374	K.LGSPLSWEHVTK.Q
1336	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	562	883.79	2648.34	883.79	2648.35	3	-4.40	21.8	24730	19	1	312 - 335	R.PMYSNPPLHGAQLVSTILEDPELK.S
1336	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	337	432.74	863.47	432.74	863.48	2	-9.13	16.5	13272	36	2	226 - 232	R.EISQLFK.A
1336	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	160	472.27	942.52	472.27	942.52	2	-1.18	12.5	5960	18	1	304 - 311	K.SQLQQLAR.P
1336	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	64	446.87	1337.60	446.88	1337.60	3	-2.36	10.3	39957	26	2	176 - 185	K.TYHYYHPETK.G
1336	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	274	471.90	1412.67	471.90	1412.68	3	-4.75	15.1	4226	42	2	392 - 402	R.LTSEYHIYMTR.N
1336	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	340	432.74	863.47	432.74	863.48	2	-7.77	16.6	14880	43	2	226 - 232	R.EISQLFK.A
1336	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	494	788.07	2361.19	788.07	2361.20	3	-4.38	20.2	36389	55	3	406 - 428	R.ISMAGVTTGNVGYLANAIHEVTK.S	Oxidation: 3
1336	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	299	479.50	1913.96	479.50	1913.96	4	-3.52	15.6	11305	42	2	261 - 277	R.IFLEDGHHIGISQSYAK.N
1336	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	320	410.23	818.45	410.24	818.46	2	-8.20	16.1	7616	19	1	104 - 110	K.MVDLTLK.L
1336	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	300	638.99	1913.96	639.00	1913.96	3	-3.52	15.6	4982	29	1	261 - 277	R.IFLEDGHHIGISQSYAK.N
1336	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	548	782.74	2345.21	782.74	2345.20	3	0.51	21.5	4715	31	2	406 - 428	R.ISMAGVTTGNVGYLANAIHEVTK.S
1336	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	332	646.39	645.38	646.39	645.38	1	-6.70	16.4	31270	19	2	336 - 340	K.SLWLK.E
1336	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	203	477.23	1428.66	477.23	1428.67	3	-4.21	13.5	79090	20	1	392 - 402	R.LTSEYHIYMTR.N	Oxidation: 9
1336	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	576	869.79	2606.34	869.79	2606.35	3	-2.70	22.2	32190	83	3	35 - 59	K.SVEPAPKDPILGVTEAFLADPSPEK.V
1336	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	326	451.91	1352.70	451.91	1352.71	3	-4.06	16.2	3904	40	2	363 - 374	K.LGSPLSWEHVTK.Q
1336	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	85	477.72	953.43	477.73	953.44	2	-4.37	10.8	6613	27	3	278 - 285	K.NMGLYGQR.V	Oxidation: 2
1336	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	432	570.51	2278.02	570.51	2278.03	4	-1.42	18.8	15997	42	1	235 - 254	K.KHFAFFDMAYQGFASGDPAR.D	Oxidation: 8
1336	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	61	446.87	1337.60	446.88	1337.60	3	-1.33	10.2	18954	20	2	176 - 185	K.TYHYYHPETK.G
1336	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	191	467.75	933.50	467.76	933.50	2	-8.41	13.2	125439	50	2	60 - 68	K.VNVGVGAYR.D
1336	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	379	896.41	1790.81	896.42	1790.82	2	-4.73	17.5	8610	63	3	87 - 103	R.LAGSTFMEYLPMGGSAK.M	Oxidation: 7
1336	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	499	717.65	2149.93	717.65	2149.93	3	-0.66	20.2	46533	62	1	236 - 254	K.HFAFFDMAYQGFASGDPAR.D	Oxidation: 7
1336	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	579	869.79	2606.34	869.79	2606.35	3	-2.20	22.2	4226	89	3	35 - 59	K.SVEPAPKDPILGVTEAFLADPSPEK.V
1336	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	335	646.39	645.38	646.39	645.38	1	-5.73	16.4	107000	17	2	336 - 340	K.SLWLK.E
1336	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	527	880.42	1758.83	880.42	1758.83	2	-3.02	21	26179	108	1	87 - 103	R.LAGSTFMEYLPMGGSAK.M
1336	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	215	702.86	1403.71	702.87	1403.72	2	-4.42	13.8	21775	105	2	125 - 138	R.IAAVQTLSGTGACR.L	Carbamidomethyl: 13
1336	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	321	819.46	818.45	819.46	818.46	1	-8.22	16.1	40016	33	1	104 - 110	K.MVDLTLK.L
1392	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	609	949.99	1897.97	949.99	1897.97	2	0.51	22.8	67661	94	3	42 - 59	K.DPILGVTEAFLADPSPEK.V
1392	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	607	633.66	1897.97	633.66	1897.97	3	1.49	22.7	13310	82	2	42 - 59	K.DPILGVTEAFLADPSPEK.V
1392	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	506	788.08	2361.21	788.07	2361.20	3	3.20	20.4	5140	56	3	406 - 428	R.ISMAGVTTGNVGYLANAIHEVTK.S	Oxidation: 3
1392	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	315	628.81	1255.61	628.81	1255.61	2	2.07	16.1	45133	53	3	111 - 121	K.LAYGDNSEFIK.D
1392	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	329	434.73	867.45	434.73	867.45	2	0.41	16.4	19534	31	2	139 - 145	R.LFADFQK.R
1392	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	487	1000.97	1999.92	1000.96	1999.91	2	3.72	19.9	4382	83	2	375 - 391	K.QIGMFCYSGLTPEQVDR.L	Carbamidomethyl: 6
1392	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	96	477.73	953.44	477.73	953.44	2	-0.75	11.2	13312	39	3	278 - 285	K.NMGLYGQR.V	Oxidation: 2
1392	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	391	896.42	1790.83	896.42	1790.82	2	4.13	17.8	282923	64	3	87 - 103	R.LAGSTFMEYLPMGGSAK.M	Oxidation: 7
1392	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	387	597.95	1790.83	597.95	1790.82	3	3.36	17.7	923263	36	1	87 - 103	R.LAGSTFMEYLPMGGSAK.M	Oxidation: 7
1392	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	585	883.79	2648.36	883.79	2648.35	3	3.22	22.1	108041	28	1	312 - 335	R.PMYSNPPLHGAQLVSTILEDPELK.S
1392	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	335	451.91	1352.71	451.91	1352.71	3	1.82	16.5	13850	39	1	363 - 374	K.LGSPLSWEHVTK.Q
1392	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	448	760.35	2278.04	760.35	2278.03	3	6.95	19	48961	41	1	235 - 254	K.KHFAFFDMAYQGFASGDPAR.D	Oxidation: 8
1392	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	504	788.08	2361.20	788.07	2361.20	3	2.08	20.3	48460	45	3	406 - 428	R.ISMAGVTTGNVGYLANAIHEVTK.S	Oxidation: 3
1392	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	232	468.91	1403.72	468.91	1403.72	3	0.68	14.2	7564	30	1	125 - 138	R.IAAVQTLSGTGACR.L	Carbamidomethyl: 13
1392	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	594	869.79	2606.36	869.79	2606.35	3	3.06	22.3	46837	105	3	35 - 59	K.SVEPAPKDPILGVTEAFLADPSPEK.V
1392	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	348	864.48	863.48	864.48	863.48	1	0.09	16.8	470897	38	1	226 - 232	R.EISQLFK.A
1392	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	466	663.82	1325.62	663.82	1325.62	2	4.54	19.5	131897	60	2	186 - 197	K.GLDFSALMDDVK.N	Oxidation: 8
1392	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	100	477.73	953.44	477.73	953.44	2	-0.89	11.2	199189	29	3	278 - 285	K.NMGLYGQR.V	Oxidation: 2
1392	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	559	889.13	2664.36	889.12	2664.35	3	4.12	21.5	12890	24	1	312 - 335	R.PMYSNPPLHGAQLVSTILEDPELK.S	Oxidation: 2
1392	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	268	418.23	834.44	418.23	834.45	2	-12.63	15	28059	17	2	104 - 110	K.MVDLTLK.L	Oxidation: 1
1392	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	584	655.82	1309.62	655.82	1309.62	2	1.42	22.1	691740	19	2	186 - 197	K.GLDFSALMDDVK.N
1392	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	347	432.74	863.48	432.74	863.48	2	0.09	16.8	47598	40	2	226 - 232	R.EISQLFK.A
1392	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	253	500.92	1499.74	500.92	1499.74	3	1.63	14.7	17466	16	1	69 - 81	R.DDNGKPVVLECVR.E	Carbamidomethyl: 11
1392	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	93	477.73	953.44	477.73	953.44	2	-0.52	11.1	18462	36	3	278 - 285	K.NMGLYGQR.V	Oxidation: 2
1392	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	587	655.82	1309.62	655.82	1309.62	2	0.77	22.2	430300	21	2	186 - 197	K.GLDFSALMDDVK.N
1392	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	489	1000.97	1999.92	1000.96	1999.91	2	5.31	20	3578	38	2	375 - 391	K.QIGMFCYSGLTPEQVDR.L	Carbamidomethyl: 6
1392	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	317	628.81	1255.61	628.81	1255.61	2	1.72	16.1	12325	76	3	111 - 121	K.LAYGDNSEFIK.D
1392	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	230	702.87	1403.72	702.87	1403.72	2	0.69	14.2	5310	95	2	125 - 138	R.IAAVQTLSGTGACR.L	Carbamidomethyl: 13
1392	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	481	888.42	1774.83	888.42	1774.83	2	4.14	19.8	14708	74	2	87 - 103	R.LAGSTFMEYLPMGGSAK.M	Oxidation: 12
1392	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	264	418.23	834.44	418.23	834.45	2	-9.50	14.9	8825	21	2	104 - 110	K.MVDLTLK.L	Oxidation: 1
1392	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	566	782.75	2345.22	782.74	2345.20	3	5.16	21.7	7629	27	2	406 - 428	R.ISMAGVTTGNVGYLANAIHEVTK.S
1392	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	610	633.66	1897.97	633.66	1897.97	3	0.51	22.8	15431	70	2	42 - 59	K.DPILGVTEAFLADPSPEK.V
1392	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	73	446.88	1337.61	446.88	1337.60	3	4.29	10.6	98489	21	4	176 - 185	K.TYHYYHPETK.G
1392	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	332	434.73	867.45	434.73	867.45	2	0.54	16.5	17414	32	2	139 - 145	R.LFADFQK.R
1392	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	206	467.76	933.50	467.76	933.50	2	0.08	13.6	3731	52	2	60 - 68	K.VNVGVGAYR.D
1392	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	509	788.08	2361.21	788.07	2361.20	3	2.70	20.4	3949	50	3	406 - 428	R.ISMAGVTTGNVGYLANAIHEVTK.S	Oxidation: 3
1392	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	481	888.42	1774.83	888.42	1774.83	2	4.14	19.8	14708	16	2	87 - 103	R.LAGSTFMEYLPMGGSAK.M	Oxidation: 7
1392	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	336	677.36	1352.71	677.36	1352.71	2	1.81	16.5	119172	45	1	363 - 374	K.LGSPLSWEHVTK.Q
1392	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	592	869.79	2606.35	869.79	2606.35	3	2.51	22.3	51506	92	3	35 - 59	K.SVEPAPKDPILGVTEAFLADPSPEK.V
1392	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	218	477.24	1428.69	477.23	1428.67	3	13.85	13.9	56367	16	1	392 - 402	R.LTSEYHIYMTR.N	Oxidation: 9
1392	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	77	446.88	1337.61	446.88	1337.60	3	2.21	10.7	46632	28	4	176 - 185	K.TYHYYHPETK.G
1392	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	386	896.42	1790.83	896.42	1790.82	2	3.37	17.7	23051	70	3	87 - 103	R.LAGSTFMEYLPMGGSAK.M	Oxidation: 7
1392	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	569	782.75	2345.21	782.74	2345.20	3	4.11	21.8	8825	29	2	406 - 428	R.ISMAGVTTGNVGYLANAIHEVTK.S
1392	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	483	888.42	1774.83	888.42	1774.83	2	3.05	19.8	49602	82	2	87 - 103	R.LAGSTFMEYLPMGGSAK.M	Oxidation: 12
1392	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	79	669.81	1337.61	669.81	1337.60	2	2.22	10.8	99932	45	1	176 - 185	K.TYHYYHPETK.G
1392	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	283	471.90	1412.68	471.90	1412.68	3	2.88	15.3	176166	36	1	392 - 402	R.LTSEYHIYMTR.N
1392	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	195	469.73	937.44	469.73	937.44	2	-1.70	13.4	6463	23	1	278 - 285	K.NMGLYGQR.V
1392	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	385	896.42	1790.83	896.42	1790.82	2	5.11	17.6	30575	47	3	87 - 103	R.LAGSTFMEYLPMGGSAK.M	Oxidation: 7
1392	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	203	467.76	933.50	467.76	933.50	2	-0.29	13.6	3964	49	2	60 - 68	K.VNVGVGAYR.D
1392	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	612	949.99	1897.97	949.99	1897.97	2	1.29	22.8	80233	69	3	42 - 59	K.DPILGVTEAFLADPSPEK.V
1392	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	80	446.88	1337.61	446.88	1337.60	3	3.28	10.8	30575	18	4	176 - 185	K.TYHYYHPETK.G
1392	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	447	570.52	2278.04	570.51	2278.03	4	6.94	19	115776	40	1	235 - 254	K.KHFAFFDMAYQGFASGDPAR.D	Oxidation: 8
1392	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	74	446.88	1337.61	446.88	1337.60	3	2.45	10.7	76256	16	4	176 - 185	K.TYHYYHPETK.G
1392	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	339	688.83	1375.65	688.83	1375.65	2	1.51	16.6	76059	76	1	286 - 297	R.VGCLSVLCEDPK.Q	Carbamidomethyl: 3
1392	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	229	702.87	1403.72	702.87	1403.72	2	-0.28	14.1	16057	97	2	125 - 138	R.IAAVQTLSGTGACR.L	Carbamidomethyl: 13
1392	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	351	432.74	863.47	432.74	863.48	2	-0.44	16.9	137976	29	2	226 - 232	R.EISQLFK.A
1392	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	596	869.79	2606.36	869.79	2606.35	3	4.61	22.4	112272	86	3	35 - 59	K.SVEPAPKDPILGVTEAFLADPSPEK.V
1392	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	606	949.99	1897.97	949.99	1897.97	2	1.48	22.7	20384	101	3	42 - 59	K.DPILGVTEAFLADPSPEK.V
1392	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	321	628.81	1255.61	628.81	1255.61	2	2.15	16.2	34369	21	3	111 - 121	K.LAYGDNSEFIK.D
1392	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	467	663.82	1325.62	663.82	1325.62	2	1.18	19.5	6121	47	2	186 - 197	K.GLDFSALMDDVK.N	Oxidation: 8
1392	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	483	888.42	1774.83	888.42	1774.83	2	3.05	19.8	49602	16	2	87 - 103	R.LAGSTFMEYLPMGGSAK.M	Oxidation: 7
1447	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	76	669.81	1337.60	669.81	1337.60	2	-0.15	10.4	67719	45	1	176 - 185	K.TYHYYHPETK.G
1447	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	600	869.79	2606.35	869.79	2606.35	3	1.59	22.1	70183	113	3	35 - 59	K.SVEPAPKDPILGVTEAFLADPSPEK.V
1447	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	330	451.91	1352.71	451.91	1352.71	3	-0.24	16.1	146421	28	2	363 - 374	K.LGSPLSWEHVTK.Q
1447	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	514	717.65	2149.93	717.65	2149.93	3	0.45	20.2	24688	83	1	236 - 254	K.HFAFFDMAYQGFASGDPAR.D	Oxidation: 7
1447	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	391	597.95	1790.82	597.95	1790.82	3	1.00	17.4	209502	52	3	87 - 103	R.LAGSTFMEYLPMGGSAK.M	Oxidation: 7
1447	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	445	888.42	1774.83	888.42	1774.83	2	0.68	18.6	49254	63	4	87 - 103	R.LAGSTFMEYLPMGGSAK.M	Oxidation: 7
1447	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	261	418.23	834.45	418.23	834.45	2	-5.26	14.5	9939	26	3	104 - 110	K.MVDLTLK.L	Oxidation: 1
1447	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	446	570.52	2278.03	570.51	2278.03	4	2.65	18.7	83037	39	1	235 - 254	K.KHFAFFDMAYQGFASGDPAR.D	Oxidation: 8
1447	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	388	597.95	1790.82	597.95	1790.82	3	0.13	17.4	471053	34	3	87 - 103	R.LAGSTFMEYLPMGGSAK.M	Oxidation: 7
1447	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	616	949.99	1897.97	949.99	1897.97	2	0.17	22.6	64168	59	3	42 - 59	K.DPILGVTEAFLADPSPEK.V
1447	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	200	467.76	933.50	467.76	933.50	2	-4.37	13.1	10571	52	2	60 - 68	K.VNVGVGAYR.D
1447	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	488	888.42	1774.83	888.42	1774.83	2	0.71	19.6	6808	24	4	87 - 103	R.LAGSTFMEYLPMGGSAK.M	Oxidation: 7
1447	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	612	633.66	1897.96	633.66	1897.97	3	-2.00	22.5	209440	88	2	42 - 59	K.DPILGVTEAFLADPSPEK.V
1447	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	573	782.74	2345.21	782.74	2345.20	3	1.64	21.5	386635	29	3	406 - 428	R.ISMAGVTTGNVGYLANAIHEVTK.S
1447	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	225	702.87	1403.72	702.87	1403.72	2	-1.20	13.7	10380	99	2	125 - 138	R.IAAVQTLSGTGACR.L	Carbamidomethyl: 13
1447	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	483	888.42	1774.83	888.42	1774.83	2	1.32	19.5	10724	75	4	87 - 103	R.LAGSTFMEYLPMGGSAK.M	Oxidation: 12
1447	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	280	471.90	1412.68	471.90	1412.68	3	0.91	14.9	349959	39	1	392 - 402	R.LTSEYHIYMTR.N
1447	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	395	597.95	1790.82	597.95	1790.82	3	0.71	17.5	61909	32	3	87 - 103	R.LAGSTFMEYLPMGGSAK.M	Oxidation: 7
1447	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	75	446.88	1337.60	446.88	1337.60	3	-0.16	10.4	125219	23	3	176 - 185	K.TYHYYHPETK.G
1447	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	327	434.73	867.45	434.73	867.45	2	-1.78	16	95151	26	2	139 - 145	R.LFADFQK.R
1447	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	570	782.74	2345.21	782.74	2345.20	3	1.69	21.5	104340	26	3	406 - 428	R.ISMAGVTTGNVGYLANAIHEVTK.S
1447	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	508	788.07	2361.20	788.07	2361.20	3	-0.46	20.1	13155	64	2	406 - 428	R.ISMAGVTTGNVGYLANAIHEVTK.S	Oxidation: 3
1447	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	304	479.50	1913.96	479.50	1913.96	4	-1.41	15.5	105780	42	3	261 - 277	R.IFLEDGHHIGISQSYAK.N
1447	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	89	477.72	953.43	477.73	953.44	2	-4.24	10.6	76655	36	2	278 - 285	K.NMGLYGQR.V	Oxidation: 2
1447	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	387	896.42	1790.82	896.42	1790.82	2	0.12	17.4	86451	76	3	87 - 103	R.LAGSTFMEYLPMGGSAK.M	Oxidation: 7
1447	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	449	888.42	1774.83	888.42	1774.83	2	-0.27	18.7	24821	59	4	87 - 103	R.LAGSTFMEYLPMGGSAK.M	Oxidation: 7
1447	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	312	628.81	1255.61	628.81	1255.61	2	-0.89	15.7	52169	76	2	111 - 121	K.LAYGDNSEFIK.D
1447	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	306	479.50	1913.97	479.50	1913.96	4	0.80	15.5	28474	40	3	261 - 277	R.IFLEDGHHIGISQSYAK.N
1447	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	72	446.88	1337.60	446.88	1337.60	3	-0.52	10.3	141580	25	3	176 - 185	K.TYHYYHPETK.G
1447	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	201	467.76	933.50	467.76	933.50	2	-3.11	13.2	6428	49	2	60 - 68	K.VNVGVGAYR.D
1447	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	560	889.12	2664.34	889.12	2664.35	3	-0.75	21.2	173945	40	1	312 - 335	R.PMYSNPPLHGAQLVSTILEDPELK.S	Oxidation: 2
1447	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	264	418.23	834.45	418.23	834.45	2	-7.11	14.6	7617	28	3	104 - 110	K.MVDLTLK.L	Oxidation: 1
1447	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	613	949.99	1897.96	949.99	1897.97	2	-2.01	22.5	41441	115	3	42 - 59	K.DPILGVTEAFLADPSPEK.V
1447	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	307	639.00	1913.97	639.00	1913.96	3	0.80	15.6	209440	40	1	261 - 277	R.IFLEDGHHIGISQSYAK.N
1447	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	603	869.79	2606.35	869.79	2606.35	3	1.38	22.2	19287	92	3	35 - 59	K.SVEPAPKDPILGVTEAFLADPSPEK.V
1447	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	90	477.72	953.44	477.73	953.44	2	-3.87	10.7	61909	36	2	278 - 285	K.NMGLYGQR.V	Oxidation: 2
1447	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	324	434.73	867.45	434.73	867.45	2	-1.25	15.9	292445	37	2	139 - 145	R.LFADFQK.R
1447	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	341	864.48	863.47	864.48	863.48	1	-1.31	16.3	13080	31	1	226 - 232	R.EISQLFK.A
1447	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	610	633.66	1897.96	633.66	1897.97	3	-1.52	22.4	62245	70	2	42 - 59	K.DPILGVTEAFLADPSPEK.V
1447	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	611	949.99	1897.96	949.99	1897.97	2	-1.53	22.4	28474	96	3	42 - 59	K.DPILGVTEAFLADPSPEK.V
1447	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	390	896.42	1790.82	896.42	1790.82	2	0.99	17.4	152349	90	3	87 - 103	R.LAGSTFMEYLPMGGSAK.M	Oxidation: 7
1447	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	569	782.75	2345.22	782.74	2345.20	3	4.98	21.4	7617	28	3	406 - 428	R.ISMAGVTTGNVGYLANAIHEVTK.S
1447	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	510	788.07	2361.20	788.07	2361.20	3	-0.50	20.1	15701	63	2	406 - 428	R.ISMAGVTTGNVGYLANAIHEVTK.S	Oxidation: 3
1447	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	229	702.87	1403.72	702.87	1403.72	2	-2.57	13.8	121216	41	2	125 - 138	R.IAAVQTLSGTGACR.L	Carbamidomethyl: 13
1447	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	213	477.23	1428.68	477.23	1428.67	3	8.19	13.5	36323	27	1	392 - 402	R.LTSEYHIYMTR.N	Oxidation: 9
1447	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	488	888.42	1774.83	888.42	1774.83	2	0.71	19.6	6808	80	4	87 - 103	R.LAGSTFMEYLPMGGSAK.M	Oxidation: 12
1447	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	449	888.42	1774.83	888.42	1774.83	2	-0.27	18.7	24821	22	4	87 - 103	R.LAGSTFMEYLPMGGSAK.M	Oxidation: 12
1447	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	597	869.79	2606.35	869.79	2606.35	3	0.69	22.1	156231	109	3	35 - 59	K.SVEPAPKDPILGVTEAFLADPSPEK.V
1447	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	465	663.82	1325.62	663.82	1325.62	2	-0.10	19.1	8332	60	2	186 - 197	K.GLDFSALMDDVK.N	Oxidation: 8
1447	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	470	663.82	1325.62	663.82	1325.62	2	0.78	19.2	5287	26	2	186 - 197	K.GLDFSALMDDVK.N	Oxidation: 8
1447	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	445	888.42	1774.83	888.42	1774.83	2	0.68	18.6	49254	24	4	87 - 103	R.LAGSTFMEYLPMGGSAK.M	Oxidation: 12
1447	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	316	628.81	1255.61	628.81	1255.61	2	0.11	15.8	1036675	43	2	111 - 121	K.LAYGDNSEFIK.D
1447	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	491	1000.96	1999.91	1000.96	1999.91	2	0.86	19.7	24852	18	1	375 - 391	K.QIGMFCYSGLTPEQVDR.L	Carbamidomethyl: 6
1447	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	394	896.42	1790.82	896.42	1790.82	2	0.71	17.5	76655	77	3	87 - 103	R.LAGSTFMEYLPMGGSAK.M	Oxidation: 7
1447	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	333	451.91	1352.71	451.91	1352.71	3	-1.83	16.1	163671	37	2	363 - 374	K.LGSPLSWEHVTK.Q
1447	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	258	418.23	834.45	418.23	834.45	2	-4.26	14.5	46033	25	3	104 - 110	K.MVDLTLK.L	Oxidation: 1
1447	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	78	446.88	1337.60	446.88	1337.60	3	0.04	10.4	96167	22	3	176 - 185	K.TYHYYHPETK.G
1447	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	483	888.42	1774.83	888.42	1774.83	2	1.32	19.5	10724	18	4	87 - 103	R.LAGSTFMEYLPMGGSAK.M	Oxidation: 7
1447	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	167	472.27	942.52	472.27	942.52	2	-4.92	12.4	14279	18	1	304 - 311	K.SQLQQLAR.P
1447	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	339	432.74	863.47	432.74	863.48	2	-1.32	16.3	12321	43	1	226 - 232	R.EISQLFK.A
1447	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	310	479.50	1913.96	479.50	1913.96	4	0.05	15.6	323535	30	3	261 - 277	R.IFLEDGHHIGISQSYAK.N
1495	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	48	477.72	953.42	477.73	953.44	2	-16.17	11.3	51394	29	3	278 - 285	K.NMGLYGQR.V	Oxidation: 2
1495	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	258	628.80	1255.59	628.81	1255.61	2	-18.42	16.2	4355	19	2	111 - 121	K.LAYGDNSEFIK.D
1495	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	391	663.80	1325.60	663.82	1325.62	2	-16.67	19.5	43920	47	2	186 - 197	K.GLDFSALMDDVK.N	Oxidation: 8
1495	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	329	896.41	1790.80	896.42	1790.82	2	-14.56	17.9	6551	17	1	87 - 103	R.LAGSTFMEYLPMGGSAK.M	Oxidation: 7
1495	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	46	477.72	953.42	477.73	953.44	2	-17.74	11.2	58704	32	3	278 - 285	K.NMGLYGQR.V	Oxidation: 2
1495	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	413	788.06	2361.17	788.07	2361.20	3	-14.66	20.4	8291	25	3	406 - 428	R.ISMAGVTTGNVGYLANAIHEVTK.S	Oxidation: 3
1495	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	393	663.81	1325.60	663.82	1325.62	2	-13.05	19.6	5075	34	2	186 - 197	K.GLDFSALMDDVK.N	Oxidation: 8
1495	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	51	477.72	953.43	477.73	953.44	2	-13.14	11.4	11554	30	3	278 - 285	K.NMGLYGQR.V	Oxidation: 2
1495	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	412	788.06	2361.17	788.07	2361.20	3	-13.22	20.4	26671	72	3	406 - 428	R.ISMAGVTTGNVGYLANAIHEVTK.S	Oxidation: 3
1495	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	414	788.06	2361.17	788.07	2361.20	3	-14.70	20.5	41353	46	3	406 - 428	R.ISMAGVTTGNVGYLANAIHEVTK.S	Oxidation: 3
1495	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	35	446.87	1337.59	446.88	1337.60	3	-11.53	10.9	11720	24	2	176 - 185	K.TYHYYHPETK.G
1495	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	260	628.80	1255.59	628.81	1255.61	2	-17.67	16.3	10832	30	2	111 - 121	K.LAYGDNSEFIK.D
1495	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	252	479.49	1913.94	479.50	1913.96	4	-14.36	16.1	64033	23	1	261 - 277	R.IFLEDGHHIGISQSYAK.N
1495	AT2G30970.1	ASP1 (Aspartate aminotransferase 1)	amino acid metabolism	g) other metabolic pathways	mitochondria	36	446.87	1337.59	446.88	1337.60	3	-12.18	10.9	10755	22	2	176 - 185	K.TYHYYHPETK.G
240	AT1G01170.1	At1g01170	uncharacterised	h) uncharacterised	mitochondrion	127	677.85	1353.69	677.86	1353.71	2	-9.75	14.61745	17204	68	2	61 - 73	R.TAGPPVVMNPISR.Q	Oxidation: 8
240	AT1G01170.1	At1g01170	uncharacterised	h) uncharacterised	mitochondrion	94	639.83	1277.65	639.84	1277.66	2	-11.19	13.54178333	11325	63	1	33 - 45	K.IFGGTTPGTVSNK.E
240	AT1G01170.1	At1g01170	uncharacterised	h) uncharacterised	mitochondrion	174	669.86	1337.70	669.86	1337.71	2	-12.77	16.19058333	4043	41	1	61 - 73	R.TAGPPVVMNPISR.Q
240	AT1G01170.1	At1g01170	uncharacterised	h) uncharacterised	mitochondrion	125	677.85	1353.69	677.86	1353.71	2	-9.61	14.53683333	5610	64	2	61 - 73	R.TAGPPVVMNPISR.Q	Oxidation: 8
873	AT1G01170.1	At1g01170	uncharacterised	h) uncharacterised	mitochondrion	67	677.86	1353.70	677.86	1353.71	2	-8.53	15	7055	24	4	61 - 73	R.TAGPPVVMNPISR.Q	Oxidation: 8
873	AT1G01170.1	At1g01170	uncharacterised	h) uncharacterised	mitochondrion	65	677.85	1353.69	677.86	1353.71	2	-9.61	15	7009	42	4	61 - 73	R.TAGPPVVMNPISR.Q	Oxidation: 8
873	AT1G01170.1	At1g01170	uncharacterised	h) uncharacterised	mitochondrion	29	639.83	1277.65	639.84	1277.66	2	-7.27	13.9	4068	32	1	33 - 45	K.IFGGTTPGTVSNK.E
873	AT1G01170.1	At1g01170	uncharacterised	h) uncharacterised	mitochondrion	63	677.86	1353.70	677.86	1353.71	2	-6.95	14.9	4227	48	4	61 - 73	R.TAGPPVVMNPISR.Q	Oxidation: 8
873	AT1G01170.1	At1g01170	uncharacterised	h) uncharacterised	mitochondrion	64	677.86	1353.70	677.86	1353.71	2	-6.82	15	4975	48	4	61 - 73	R.TAGPPVVMNPISR.Q	Oxidation: 8
922	AT1G01170.1	At1g01170	uncharacterised	h) uncharacterised	mitochondrion	81	645.68	1934.03	645.68	1934.01	3	9.64	15.3	21852	45	3	27 - 45	K.VISDNKIFGGTTPGTVSNK.E
922	AT1G01170.1	At1g01170	uncharacterised	h) uncharacterised	mitochondrion	108	669.87	1337.73	669.86	1337.71	2	9.71	16.5	31204	62	3	61 - 73	R.TAGPPVVMNPISR.Q
922	AT1G01170.1	At1g01170	uncharacterised	h) uncharacterised	mitochondrion	89	402.71	803.41	402.71	803.41	2	8.16	15.7	28869	17	3	55 - 60	K.FQAWPR.T
922	AT1G01170.1	At1g01170	uncharacterised	h) uncharacterised	mitochondrion	68	452.25	1353.72	452.24	1353.71	3	9.77	15	17883	41	3	61 - 73	R.TAGPPVVMNPISR.Q	Oxidation: 8
922	AT1G01170.1	At1g01170	uncharacterised	h) uncharacterised	mitochondrion	84	645.68	1934.03	645.68	1934.01	3	9.59	15.4	14028	39	3	27 - 45	K.VISDNKIFGGTTPGTVSNK.E
922	AT1G01170.1	At1g01170	uncharacterised	h) uncharacterised	mitochondrion	162	799.06	2394.17	799.06	2394.15	3	8.60	18.5	18181	20	3	33 - 54	K.IFGGTTPGTVSNKEWWAATDEK.F
922	AT1G01170.1	At1g01170	uncharacterised	h) uncharacterised	mitochondrion	24	426.90	1277.67	426.89	1277.66	3	8.63	13.9	8065	25	1	33 - 45	K.IFGGTTPGTVSNK.E
922	AT1G01170.1	At1g01170	uncharacterised	h) uncharacterised	mitochondrion	184	640.98	1919.90	640.97	1919.90	3	4.61	20.3	5895	65	3	46 - 60	K.EWWAATDEKFQAWPR.T
922	AT1G01170.1	At1g01170	uncharacterised	h) uncharacterised	mitochondrion	127	568.26	1134.51	568.26	1134.50	2	6.51	17	16134	57	3	46 - 54	K.EWWAATDEK.F
922	AT1G01170.1	At1g01170	uncharacterised	h) uncharacterised	mitochondrion	56	677.87	1353.72	677.86	1353.71	2	6.84	14.7	19301	71	3	61 - 73	R.TAGPPVVMNPISR.Q	Oxidation: 8
922	AT1G01170.1	At1g01170	uncharacterised	h) uncharacterised	mitochondrion	63	452.25	1353.72	452.24	1353.71	3	8.69	14.8	25183	63	3	61 - 73	R.TAGPPVVMNPISR.Q	Oxidation: 8
922	AT1G01170.1	At1g01170	uncharacterised	h) uncharacterised	mitochondrion	182	640.97	1919.90	640.97	1919.90	3	3.92	20.3	9967	38	3	46 - 60	K.EWWAATDEKFQAWPR.T
922	AT1G01170.1	At1g01170	uncharacterised	h) uncharacterised	mitochondrion	158	799.06	2394.17	799.06	2394.15	3	7.73	18.4	40150	38	3	33 - 54	K.IFGGTTPGTVSNKEWWAATDEK.F
922	AT1G01170.1	At1g01170	uncharacterised	h) uncharacterised	mitochondrion	64	452.25	1353.72	452.24	1353.71	3	9.15	14.9	27103	60	3	61 - 73	R.TAGPPVVMNPISR.Q	Oxidation: 8
922	AT1G01170.1	At1g01170	uncharacterised	h) uncharacterised	mitochondrion	96	402.71	803.41	402.71	803.41	2	7.26	15.8	82311	18	3	55 - 60	K.FQAWPR.T
922	AT1G01170.1	At1g01170	uncharacterised	h) uncharacterised	mitochondrion	58	677.87	1353.72	677.86	1353.71	2	8.64	14.7	86371	76	3	61 - 73	R.TAGPPVVMNPISR.Q	Oxidation: 8
922	AT1G01170.1	At1g01170	uncharacterised	h) uncharacterised	mitochondrion	18	639.84	1277.67	639.84	1277.66	2	8.39	13.7	3899	72	4	33 - 45	K.IFGGTTPGTVSNK.E
922	AT1G01170.1	At1g01170	uncharacterised	h) uncharacterised	mitochondrion	104	669.87	1337.72	669.86	1337.71	2	7.76	16.4	10408	57	3	61 - 73	R.TAGPPVVMNPISR.Q
922	AT1G01170.1	At1g01170	uncharacterised	h) uncharacterised	mitochondrion	61	677.87	1353.72	677.86	1353.71	2	8.70	14.8	218212	72	3	61 - 73	R.TAGPPVVMNPISR.Q	Oxidation: 8
922	AT1G01170.1	At1g01170	uncharacterised	h) uncharacterised	mitochondrion	130	1135.51	1134.50	1135.51	1134.50	1	5.41	17.1	6363	21	1	46 - 54	K.EWWAATDEK.F
922	AT1G01170.1	At1g01170	uncharacterised	h) uncharacterised	mitochondrion	23	1278.68	1277.67	1278.67	1277.66	1	7.42	13.8	9244	22	1	33 - 45	K.IFGGTTPGTVSNK.E
922	AT1G01170.1	At1g01170	uncharacterised	h) uncharacterised	mitochondrion	90	402.71	803.41	402.71	803.41	2	6.99	15.7	98580	21	3	55 - 60	K.FQAWPR.T
922	AT1G01170.1	At1g01170	uncharacterised	h) uncharacterised	mitochondrion	180	640.98	1919.91	640.97	1919.90	3	7.46	20.2	3993	79	3	46 - 60	K.EWWAATDEKFQAWPR.T
922	AT1G01170.1	At1g01170	uncharacterised	h) uncharacterised	mitochondrion	78	645.68	1934.03	645.68	1934.01	3	9.25	15.3	6154	42	3	27 - 45	K.VISDNKIFGGTTPGTVSNK.E
922	AT1G01170.1	At1g01170	uncharacterised	h) uncharacterised	mitochondrion	94	804.42	803.41	804.42	803.41	1	6.22	15.8	17927	18	2	55 - 60	K.FQAWPR.T
922	AT1G01170.1	At1g01170	uncharacterised	h) uncharacterised	mitochondrion	13	748.44	747.43	748.44	747.43	1	5.38	13.6	38220	30	3	74 - 79	R.QNFIVK.T
922	AT1G01170.1	At1g01170	uncharacterised	h) uncharacterised	mitochondrion	12	748.44	747.43	748.44	747.43	1	4.80	13.5	5142	28	3	74 - 79	R.QNFIVK.T
922	AT1G01170.1	At1g01170	uncharacterised	h) uncharacterised	mitochondrion	92	804.42	803.41	804.42	803.41	1	6.96	15.7	21983	18	2	55 - 60	K.FQAWPR.T
922	AT1G01170.1	At1g01170	uncharacterised	h) uncharacterised	mitochondrion	14	748.44	747.43	748.44	747.43	1	5.96	13.6	62014	29	3	74 - 79	R.QNFIVK.T
922	AT1G01170.1	At1g01170	uncharacterised	h) uncharacterised	mitochondrion	125	568.26	1134.51	568.26	1134.50	2	6.26	17	3208	47	3	46 - 54	K.EWWAATDEK.F
922	AT1G01170.1	At1g01170	uncharacterised	h) uncharacterised	mitochondrion	156	799.06	2394.17	799.06	2394.15	3	8.14	18.4	14414	32	3	33 - 54	K.IFGGTTPGTVSNKEWWAATDEK.F
922	AT1G01170.1	At1g01170	uncharacterised	h) uncharacterised	mitochondrion	106	669.87	1337.72	669.86	1337.71	2	9.09	16.5	23220	64	3	61 - 73	R.TAGPPVVMNPISR.Q
922	AT1G01170.1	At1g01170	uncharacterised	h) uncharacterised	mitochondrion	26	639.84	1277.67	639.84	1277.66	2	9.13	13.9	76358	78	4	33 - 45	K.IFGGTTPGTVSNK.E
922	AT1G01170.1	At1g01170	uncharacterised	h) uncharacterised	mitochondrion	129	568.26	1134.50	568.26	1134.50	2	5.40	17.1	42258	50	3	46 - 54	K.EWWAATDEK.F
922	AT1G01170.1	At1g01170	uncharacterised	h) uncharacterised	mitochondrion	19	639.84	1277.67	639.84	1277.66	2	7.63	13.7	65435	58	4	33 - 45	K.IFGGTTPGTVSNK.E
922	AT1G01170.1	At1g01170	uncharacterised	h) uncharacterised	mitochondrion	21	639.84	1277.67	639.84	1277.66	2	7.41	13.8	215881	59	4	33 - 45	K.IFGGTTPGTVSNK.E
973	AT1G01170.1	At1g01170	uncharacterised	h) uncharacterised	mitochondrion	57	402.72	803.42	402.71	803.41	2	19.78	15.8	17728	21	4	55 - 60	K.FQAWPR.T
973	AT1G01170.1	At1g01170	uncharacterised	h) uncharacterised	mitochondrion	58	402.72	803.42	402.71	803.41	2	14.54	15.8	28014	21	4	55 - 60	K.FQAWPR.T
973	AT1G01170.1	At1g01170	uncharacterised	h) uncharacterised	mitochondrion	76	568.27	1134.52	568.26	1134.50	2	16.54	17.2	6246	33	2	46 - 54	K.EWWAATDEK.F
973	AT1G01170.1	At1g01170	uncharacterised	h) uncharacterised	mitochondrion	15	639.85	1277.69	639.84	1277.66	2	19.21	13.9	28016	67	4	33 - 45	K.IFGGTTPGTVSNK.E
973	AT1G01170.1	At1g01170	uncharacterised	h) uncharacterised	mitochondrion	13	639.85	1277.69	639.84	1277.66	2	19.80	13.8	6448	62	4	33 - 45	K.IFGGTTPGTVSNK.E
973	AT1G01170.1	At1g01170	uncharacterised	h) uncharacterised	mitochondrion	59	402.72	803.42	402.71	803.41	2	16.10	15.8	29899	19	4	55 - 60	K.FQAWPR.T
973	AT1G01170.1	At1g01170	uncharacterised	h) uncharacterised	mitochondrion	14	639.85	1277.69	639.84	1277.66	2	19.12	13.9	19477	68	4	33 - 45	K.IFGGTTPGTVSNK.E
973	AT1G01170.1	At1g01170	uncharacterised	h) uncharacterised	mitochondrion	78	568.27	1134.52	568.26	1134.50	2	17.79	17.2	7687	29	2	46 - 54	K.EWWAATDEK.F
973	AT1G01170.1	At1g01170	uncharacterised	h) uncharacterised	mitochondrion	50	452.25	1353.73	452.24	1353.71	3	19.55	15	5646	39	1	61 - 73	R.TAGPPVVMNPISR.Q	Oxidation: 8
973	AT1G01170.1	At1g01170	uncharacterised	h) uncharacterised	mitochondrion	42	677.87	1353.73	677.86	1353.71	2	19.69	14.8	3972	65	1	61 - 73	R.TAGPPVVMNPISR.Q	Oxidation: 8
973	AT1G01170.1	At1g01170	uncharacterised	h) uncharacterised	mitochondrion	16	639.85	1277.69	639.84	1277.66	2	19.52	13.9	19667	68	4	33 - 45	K.IFGGTTPGTVSNK.E
973	AT1G01170.1	At1g01170	uncharacterised	h) uncharacterised	mitochondrion	60	402.72	803.42	402.71	803.41	2	15.78	15.9	19953	16	4	55 - 60	K.FQAWPR.T
1366	AT1G22520.1	At1g22520	uncharacterised	h) uncharacterised	cytosol	226	555.96	1664.86	555.96	1664.86	3	-0.91	17.1	4133	87	2	71 - 87	R.VFDASSSTSATLLAAPK.S
1366	AT1G22520.1	At1g22520	uncharacterised	h) uncharacterised	cytosol	42	619.77	1237.53	619.77	1237.53	2	0.99	11.7	5017	48	2	88 - 99	K.STETSVSQAAEE.-
1366	AT1G22520.1	At1g22520	uncharacterised	h) uncharacterised	cytosol	246	610.79	1219.56	610.79	1219.57	2	-0.47	18.1	12305	50	2	17 - 26	K.WDACLDLTAR.R	Carbamidomethyl: 4
1366	AT1G22520.1	At1g22520	uncharacterised	h) uncharacterised	cytosol	39	619.77	1237.53	619.77	1237.53	2	0.57	11.6	5189	76	2	88 - 99	K.STETSVSQAAEE.-
1366	AT1G22520.1	At1g22520	uncharacterised	h) uncharacterised	cytosol	227	833.44	1664.86	833.44	1664.86	2	0.38	17.2	11125	111	2	71 - 87	R.VFDASSSTSATLLAAPK.S
1366	AT1G22520.1	At1g22520	uncharacterised	h) uncharacterised	cytosol	224	833.44	1664.86	833.44	1664.86	2	-0.91	17.1	7355	135	2	71 - 87	R.VFDASSSTSATLLAAPK.S
1366	AT1G22520.1	At1g22520	uncharacterised	h) uncharacterised	cytosol	244	610.79	1219.56	610.79	1219.57	2	-2.96	18.1	5710	58	2	17 - 26	K.WDACLDLTAR.R	Carbamidomethyl: 4
1366	AT1G22520.1	At1g22520	uncharacterised	h) uncharacterised	cytosol	228	555.96	1664.86	555.96	1664.86	3	0.37	17.2	6948	71	2	71 - 87	R.VFDASSSTSATLLAAPK.S
1426	AT1G22520.1	At1g22520	uncharacterised	h) uncharacterised	cytosol	258	610.79	1219.56	610.79	1219.57	2	-2.42	18.1	6370	51	3	17 - 26	K.WDACLDLTAR.R	Carbamidomethyl: 4
1426	AT1G22520.1	At1g22520	uncharacterised	h) uncharacterised	cytosol	255	610.79	1219.57	610.79	1219.57	2	0.63	18	3953	59	3	17 - 26	K.WDACLDLTAR.R	Carbamidomethyl: 4
1426	AT1G22520.1	At1g22520	uncharacterised	h) uncharacterised	cytosol	256	610.79	1219.56	610.79	1219.57	2	-1.79	18	6600	58	3	17 - 26	K.WDACLDLTAR.R	Carbamidomethyl: 4
1426	AT1G22520.1	At1g22520	uncharacterised	h) uncharacterised	cytosol	56	619.78	1237.54	619.77	1237.53	2	9.76	11.8	8336	49	2	88 - 99	K.STETSVSQAAEE.-
1426	AT1G22520.1	At1g22520	uncharacterised	h) uncharacterised	cytosol	243	555.96	1664.87	555.96	1664.86	3	2.63	17.1	4990	85	2	71 - 87	R.VFDASSSTSATLLAAPK.S
1426	AT1G22520.1	At1g22520	uncharacterised	h) uncharacterised	cytosol	241	555.96	1664.85	555.96	1664.86	3	-4.40	17	12392	81	2	71 - 87	R.VFDASSSTSATLLAAPK.S
1426	AT1G22520.1	At1g22520	uncharacterised	h) uncharacterised	cytosol	240	833.43	1664.85	833.44	1664.86	2	-4.41	17	5821	136	3	71 - 87	R.VFDASSSTSATLLAAPK.S
1426	AT1G22520.1	At1g22520	uncharacterised	h) uncharacterised	cytosol	247	833.44	1664.87	833.44	1664.86	2	2.63	17.1	7740	104	3	71 - 87	R.VFDASSSTSATLLAAPK.S
1426	AT1G22520.1	At1g22520	uncharacterised	h) uncharacterised	cytosol	242	833.44	1664.87	833.44	1664.86	2	2.65	17	18973	146	3	71 - 87	R.VFDASSSTSATLLAAPK.S
1426	AT1G22520.1	At1g22520	uncharacterised	h) uncharacterised	cytosol	52	619.77	1237.53	619.77	1237.53	2	2.84	11.7	16688	65	2	88 - 99	K.STETSVSQAAEE.-
1475	AT1G22520.1	At1g22520	uncharacterised	h) uncharacterised	cytosol	42	619.77	1237.52	619.77	1237.53	2	-6.76	11.6	5423	47	1	88 - 99	K.STETSVSQAAEE.-
1475	AT1G22520.1	At1g22520	uncharacterised	h) uncharacterised	cytosol	222	833.43	1664.85	833.44	1664.86	2	-8.20	17	7226	117	2	71 - 87	R.VFDASSSTSATLLAAPK.S
1475	AT1G22520.1	At1g22520	uncharacterised	h) uncharacterised	cytosol	226	833.43	1664.85	833.44	1664.86	2	-7.43	17.1	6233	37	2	71 - 87	R.VFDASSSTSATLLAAPK.S
1458	AT1G55160.1	At1g55160	uncharacterized	h) uncharacterized	mitochondria	73	587.82	1173.62	587.82	1173.62	2	-2.59	12.3	11668	40	2	109 - 120	K.SSSVAAPVTVEK.T
1458	AT1G55160.1	At1g55160	uncharacterized	h) uncharacterized	mitochondria	69	587.82	1173.62	587.82	1173.62	2	-2.70	12.2	13842	39	2	109 - 120	K.SSSVAAPVTVEK.T
1458	AT1G55160.1	At1g55160	uncharacterized	h) uncharacterized	mitochondria	256	721.92	1441.83	721.93	1441.84	2	-5.88	16.7	5793	50	2	121 - 134	K.TLSSTVVAEPVVIK.A
1458	AT1G55160.1	At1g55160	uncharacterized	h) uncharacterized	mitochondria	196	643.83	1285.64	643.83	1285.64	2	-2.74	15.1	8161	46	1	97 - 108	K.DLDPVVEETAAK.S
1458	AT1G55160.1	At1g55160	uncharacterized	h) uncharacterized	mitochondria	258	721.92	1441.83	721.93	1441.84	2	-3.87	16.7	8478	72	2	121 - 134	K.TLSSTVVAEPVVIK.A
1517	AT1G55160.1	At1g55160	uncharacterized	h) uncharacterized	mitochondria	166	721.92	1441.82	721.93	1441.84	2	-13.83	16.9	4502	31	1	121 - 134	K.TLSSTVVAEPVVIK.A
1517	AT1G55160.1	At1g55160	uncharacterized	h) uncharacterized	mitochondria	26	587.81	1173.60	587.82	1173.62	2	-18.35	12.3	5834	48	2	109 - 120	K.SSSVAAPVTVEK.T
1517	AT1G55160.1	At1g55160	uncharacterized	h) uncharacterized	mitochondria	28	587.81	1173.60	587.82	1173.62	2	-18.16	12.3	8246	42	2	109 - 120	K.SSSVAAPVTVEK.T
150	AT1G67350.1	At1g67350 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	49	415.18	1242.53	415.19	1242.55	3	-11.55	10.7	6142	35	2	28 - 36	R.EHIYEMHER.C
150	AT1G67350.1	At1g67350 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	14	435.53	1303.57	435.53	1303.58	3	-12.47	9	19058	30	4	15 - 24	R.LMENPEERDR.K	Oxidation: 2
150	AT1G67350.1	At1g67350 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	13	435.53	1303.56	435.53	1303.58	3	-13.82	9	11391	30	4	15 - 24	R.LMENPEERDR.K	Oxidation: 2
150	AT1G67350.1	At1g67350 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	27	517.23	1032.45	517.23	1032.45	2	-6.46	9.5	4031	48	3	15 - 22	R.LMENPEER.D	Oxidation: 2
150	AT1G67350.1	At1g67350 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	12	435.53	1303.57	435.53	1303.58	3	-12.61	8.9	4276	35	4	15 - 24	R.LMENPEERDR.K	Oxidation: 2
150	AT1G67350.1	At1g67350 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	134	628.82	1255.62	628.82	1255.63	2	-6.24	15.9	18319	59	2	65 - 75	R.WDPQISQVAGR.R
150	AT1G67350.1	At1g67350 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	29	517.23	1032.44	517.23	1032.45	2	-9.88	9.6	13675	47	3	15 - 22	R.LMENPEER.D	Oxidation: 2
150	AT1G67350.1	At1g67350 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	182	849.69	2546.04	849.69	2546.06	3	-4.72	18.2	2710	38	1	76 - 98	R.RDPYDDLLEDNYTPPSSSSSSSD.-
150	AT1G67350.1	At1g67350 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	132	628.82	1255.62	628.82	1255.63	2	-8.78	15.8	17901	84	2	65 - 75	R.WDPQISQVAGR.R
150	AT1G67350.1	At1g67350 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	8	420.52	1258.53	420.52	1258.54	3	-11.47	8.7	6538	43	3	28 - 36	R.EHIYEMHER.C	Oxidation: 6
150	AT1G67350.1	At1g67350 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	10	420.52	1258.52	420.52	1258.54	3	-13.06	8.8	8248	24	3	28 - 36	R.EHIYEMHER.C	Oxidation: 6
150	AT1G67350.1	At1g67350 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	48	415.18	1242.53	415.19	1242.55	3	-12.32	10.7	4993	58	2	28 - 36	R.EHIYEMHER.C
150	AT1G67350.1	At1g67350 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	9	420.52	1258.52	420.52	1258.54	3	-13.06	8.7	13945	32	3	28 - 36	R.EHIYEMHER.C	Oxidation: 6
150	AT1G67350.1	At1g67350 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	52	509.23	1016.45	509.24	1016.46	2	-10.69	11.4	4033	31	2	15 - 22	R.LMENPEER.D
150	AT1G67350.1	At1g67350 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	53	509.23	1016.45	509.24	1016.46	2	-10.20	11.4	5834	40	2	15 - 22	R.LMENPEER.D
150	AT1G67350.1	At1g67350 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	15	435.53	1303.57	435.53	1303.58	3	-11.48	9.1	13201	35	4	15 - 24	R.LMENPEERDR.K	Oxidation: 2
150	AT1G67350.1	At1g67350 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	28	517.23	1032.44	517.23	1032.45	2	-10.96	9.6	17399	46	3	15 - 22	R.LMENPEER.D	Oxidation: 2
230	AT1G67350.1	At1g67350 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	52	509.23	1016.45	509.24	1016.46	2	-12.22	11.51491667	7925	54	3	15 - 22	R.LMENPEER.D
230	AT1G67350.1	At1g67350 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	13	435.53	1303.56	435.53	1303.58	3	-14.54	9.0669	29208	28	2	15 - 24	R.LMENPEERDR.K	Oxidation: 2
230	AT1G67350.1	At1g67350 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	12	435.53	1303.56	435.53	1303.58	3	-14.31	9.02645	21126	29	2	15 - 24	R.LMENPEERDR.K	Oxidation: 2
230	AT1G67350.1	At1g67350 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	47	415.18	1242.53	415.19	1242.55	3	-14.44	10.79618333	10944	40	1	28 - 36	R.EHIYEMHER.C
230	AT1G67350.1	At1g67350 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	207	849.69	2546.04	849.69	2546.06	3	-6.71	18.43474167	6681	43	3	76 - 98	R.RDPYDDLLEDNYTPPSSSSSSSD.-
230	AT1G67350.1	At1g67350 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	25	517.23	1032.44	517.23	1032.45	2	-13.88	9.72905	9988	58	3	15 - 22	R.LMENPEER.D	Oxidation: 2
230	AT1G67350.1	At1g67350 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	45	430.20	1287.57	430.20	1287.59	3	-12.77	10.71525	6155	19	1	15 - 24	R.LMENPEERDR.K
230	AT1G67350.1	At1g67350 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	20	517.23	1032.44	517.23	1032.45	2	-13.50	9.56781667	9822	58	3	15 - 22	R.LMENPEER.D	Oxidation: 2
230	AT1G67350.1	At1g67350 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	143	628.82	1255.62	628.82	1255.63	2	-11.04	15.90206667	17324	70	2	65 - 75	R.WDPQISQVAGR.R
230	AT1G67350.1	At1g67350 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	203	849.69	2546.04	849.69	2546.06	3	-7.88	18.2869	7568	64	3	76 - 98	R.RDPYDDLLEDNYTPPSSSSSSSD.-
230	AT1G67350.1	At1g67350 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	51	509.23	1016.45	509.24	1016.46	2	-13.99	11.47444167	6035	53	3	15 - 22	R.LMENPEER.D
230	AT1G67350.1	At1g67350 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	146	628.82	1255.62	628.82	1255.63	2	-9.45	15.99605833	44758	66	2	65 - 75	R.WDPQISQVAGR.R
230	AT1G67350.1	At1g67350 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	204	849.69	2546.04	849.69	2546.06	3	-6.82	18.34073333	16588	79	3	76 - 98	R.RDPYDDLLEDNYTPPSSSSSSSD.-
230	AT1G67350.1	At1g67350 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	22	517.23	1032.44	517.23	1032.45	2	-12.53	9.63503333	19107	57	3	15 - 22	R.LMENPEER.D	Oxidation: 2
230	AT1G67350.1	At1g67350 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	53	509.23	1016.45	509.24	1016.46	2	-13.20	11.55538333	6850	40	3	15 - 22	R.LMENPEER.D
230	AT1G67350.1	At1g67350 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	8	420.51	1258.52	420.52	1258.54	3	-14.82	8.75636667	19717	32	1	28 - 36	R.EHIYEMHER.C	Oxidation: 6
370	AT1G67350.1	At1g67350 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	66	430.20	1287.59	430.20	1287.59	3	3.04	12.2	12216	33	2	15 - 24	R.LMENPEERDR.K
370	AT1G67350.1	At1g67350 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	70	622.28	1242.55	622.28	1242.55	2	0.25	12.3	11324	43	1	28 - 36	R.EHIYEMHER.C
370	AT1G67350.1	At1g67350 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	41	517.24	1032.46	517.23	1032.45	2	5.24	11.3	18273	51	3	15 - 22	R.LMENPEER.D	Oxidation: 2
370	AT1G67350.1	At1g67350 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	148	471.59	1411.74	471.58	1411.73	3	3.23	16.6	11995	26	1	65 - 76	R.WDPQISQVAGRR.D
370	AT1G67350.1	At1g67350 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	36	517.24	1032.46	517.23	1032.45	2	2.03	11.1	14580	59	3	15 - 22	R.LMENPEER.D	Oxidation: 2
370	AT1G67350.1	At1g67350 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	187	628.83	1255.64	628.82	1255.63	2	6.23	17.9	56402	67	3	65 - 75	R.WDPQISQVAGR.R
370	AT1G67350.1	At1g67350 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	37	517.24	1032.46	517.23	1032.45	2	5.10	11.2	33932	57	3	15 - 22	R.LMENPEER.D	Oxidation: 2
370	AT1G67350.1	At1g67350 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	85	509.24	1016.46	509.24	1016.46	2	2.49	13	8289	39	3	15 - 22	R.LMENPEER.D
370	AT1G67350.1	At1g67350 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	87	509.24	1016.46	509.24	1016.46	2	2.27	13.1	18891	62	3	15 - 22	R.LMENPEER.D
370	AT1G67350.1	At1g67350 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	16	420.52	1258.54	420.52	1258.54	3	2.35	10.3	28249	39	3	28 - 36	R.EHIYEMHER.C	Oxidation: 6
370	AT1G67350.1	At1g67350 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	9	496.23	1485.68	496.23	1485.68	3	0.09	9.8	6930	25	1	26 - 36	K.AREHIYEMHER.C	Oxidation: 8
370	AT1G67350.1	At1g67350 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	15	420.52	1258.54	420.52	1258.54	3	2.11	10.2	8960	38	3	28 - 36	R.EHIYEMHER.C	Oxidation: 6
370	AT1G67350.1	At1g67350 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	22	435.54	1303.58	435.53	1303.58	3	1.60	10.5	12114	34	3	15 - 24	R.LMENPEERDR.K	Oxidation: 2
370	AT1G67350.1	At1g67350 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	65	430.20	1287.59	430.20	1287.59	3	0.30	12.2	4978	25	2	15 - 24	R.LMENPEERDR.K
370	AT1G67350.1	At1g67350 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	242	849.70	2546.06	849.69	2546.06	3	2.92	19.7	4273	38	5	76 - 98	R.RDPYDDLLEDNYTPPSSSSSSSD.-
370	AT1G67350.1	At1g67350 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	17	630.28	1258.54	630.28	1258.54	2	2.36	10.3	10887	41	1	28 - 36	R.EHIYEMHER.C	Oxidation: 6
370	AT1G67350.1	At1g67350 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	241	849.70	2546.07	849.69	2546.06	3	4.24	19.7	2775	33	5	76 - 98	R.RDPYDDLLEDNYTPPSSSSSSSD.-
370	AT1G67350.1	At1g67350 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	23	435.54	1303.59	435.53	1303.58	3	2.91	10.5	28896	33	3	15 - 24	R.LMENPEERDR.K	Oxidation: 2
370	AT1G67350.1	At1g67350 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	182	628.83	1255.64	628.82	1255.63	2	5.04	17.7	20124	61	3	65 - 75	R.WDPQISQVAGR.R
370	AT1G67350.1	At1g67350 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	249	849.70	2546.07	849.69	2546.06	3	6.46	20	6799	81	5	76 - 98	R.RDPYDDLLEDNYTPPSSSSSSSD.-
370	AT1G67350.1	At1g67350 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	84	509.24	1016.46	509.24	1016.46	2	-1.83	13	4731	44	3	15 - 22	R.LMENPEER.D
370	AT1G67350.1	At1g67350 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	50	490.90	1469.69	490.90	1469.68	3	2.06	11.6	5663	20	1	26 - 36	K.AREHIYEMHER.C
370	AT1G67350.1	At1g67350 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	285	1195.99	2389.97	1195.99	2389.96	2	5.52	21.5	4471	18	2	77 - 98	R.DPYDDLLEDNYTPPSSSSSSSD.-
370	AT1G67350.1	At1g67350 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	69	415.19	1242.55	415.19	1242.55	3	0.25	12.3	19694	40	1	28 - 36	R.EHIYEMHER.C
370	AT1G67350.1	At1g67350 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	253	849.70	2546.07	849.69	2546.06	3	5.43	20.2	35420	65	5	76 - 98	R.RDPYDDLLEDNYTPPSSSSSSSD.-
370	AT1G67350.1	At1g67350 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	25	652.80	1303.59	652.80	1303.58	2	3.80	10.6	13924	16	1	15 - 24	R.LMENPEERDR.K	Oxidation: 2
370	AT1G67350.1	At1g67350 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	184	628.83	1255.64	628.82	1255.63	2	7.25	17.8	221935	71	3	65 - 75	R.WDPQISQVAGR.R
370	AT1G67350.1	At1g67350 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	250	849.70	2546.07	849.69	2546.06	3	5.84	20.1	40665	91	5	76 - 98	R.RDPYDDLLEDNYTPPSSSSSSSD.-
370	AT1G67350.1	At1g67350 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	18	420.52	1258.54	420.52	1258.54	3	3.34	10.3	16967	33	3	28 - 36	R.EHIYEMHER.C	Oxidation: 6
370	AT1G67350.1	At1g67350 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	288	1195.99	2389.97	1195.99	2389.96	2	5.28	21.6	3143	18	2	77 - 98	R.DPYDDLLEDNYTPPSSSSSSSD.-
370	AT1G67350.1	At1g67350 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	21	435.54	1303.58	435.53	1303.58	3	0.39	10.5	4916	29	3	15 - 24	R.LMENPEERDR.K	Oxidation: 2
428	AT1G67350.1	At1g67350 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	72	628.83	1255.65	628.82	1255.63	2	16.02	17.7	8390	39	2	65 - 75	R.WDPQISQVAGR.R
428	AT1G67350.1	At1g67350 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	75	628.83	1255.65	628.82	1255.63	2	12.75	17.8	9261	31	2	65 - 75	R.WDPQISQVAGR.R
428	AT1G67350.1	At1g67350 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	3	435.54	1303.59	435.53	1303.58	3	6.59	10.5	6395	39	1	15 - 24	R.LMENPEERDR.K	Oxidation: 2
428	AT1G67350.1	At1g67350 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	2	420.52	1258.55	420.52	1258.54	3	6.10	10.2	4679	46	1	28 - 36	R.EHIYEMHER.C	Oxidation: 6
491	AT1G67350.1	At1g67350 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	1	435.53	1303.56	435.53	1303.58	3	-13.96	10.5	6557	20	1	15 - 24	R.LMENPEERDR.K	Oxidation: 2
491	AT1G67350.1	At1g67350 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	2	517.23	1032.44	517.23	1032.45	2	-9.38	11	5160	36	3	15 - 22	R.LMENPEER.D	Oxidation: 2
491	AT1G67350.1	At1g67350 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	4	517.23	1032.44	517.23	1032.45	2	-14.23	11.1	6442	35	3	15 - 22	R.LMENPEER.D	Oxidation: 2
491	AT1G67350.1	At1g67350 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	160	628.82	1255.62	628.82	1255.63	2	-5.97	17.9	5440	24	2	65 - 75	R.WDPQISQVAGR.R
491	AT1G67350.1	At1g67350 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	155	628.82	1255.62	628.82	1255.63	2	-10.77	17.8	13694	58	2	65 - 75	R.WDPQISQVAGR.R
491	AT1G67350.1	At1g67350 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	3	517.23	1032.44	517.23	1032.45	2	-10.98	11	6440	31	3	15 - 22	R.LMENPEER.D	Oxidation: 2
165	AT1G67785.1	At1g67785 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	35	450.72	899.42	450.72	899.43	2	-15.68	12.3	6179	22	3	56 - 63	K.AREEDPLA.-
165	AT1G67785.1	At1g67785 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	59	673.30	672.29	673.30	672.30	1	-9.05	14	5643	22	2	58 - 63	R.EEDPLA.-
165	AT1G67785.1	At1g67785 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	36	450.72	899.42	450.72	899.43	2	-16.34	12.4	10698	37	3	56 - 63	K.AREEDPLA.-
165	AT1G67785.1	At1g67785 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	32	428.76	855.51	428.77	855.53	2	-17.57	12	25799	29	2	48 - 54	R.VRAELLR.K
165	AT1G67785.1	At1g67785 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	39	450.72	899.42	450.72	899.43	2	-13.81	12.5	14033	25	3	56 - 63	K.AREEDPLA.-
165	AT1G67785.1	At1g67785 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	96	492.26	1473.76	492.26	1473.77	3	-11.97	15.1	14584	45	1	24 - 35	K.VHVWIALHQDEK.Q
165	AT1G67785.1	At1g67785 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	57	673.30	672.29	673.30	672.30	1	-7.49	13.9	6618	23	2	58 - 63	R.EEDPLA.-
165	AT1G67785.1	At1g67785 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	33	428.76	855.51	428.77	855.53	2	-18.15	12	31190	40	2	48 - 54	R.VRAELLR.K
242	AT1G67785.1	At1g67785 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	31	428.77	855.52	428.77	855.53	2	-12.81	11.88756667	5112	21	2	48 - 54	R.VRAELLR.K
242	AT1G67785.1	At1g67785 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	41	450.72	899.42	450.72	899.43	2	-12.00	12.36033333	7547	26	2	56 - 63	K.AREEDPLA.-
242	AT1G67785.1	At1g67785 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	32	428.77	855.52	428.77	855.53	2	-14.91	11.928075	11281	32	2	48 - 54	R.VRAELLR.K
242	AT1G67785.1	At1g67785 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	39	450.72	899.42	450.72	899.43	2	-11.77	12.29310833	4311	26	2	56 - 63	K.AREEDPLA.-
380	AT1G67785.1	At1g67785 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	75	673.30	672.29	673.30	672.30	1	-11.10	15.4	10526	18	2	58 - 63	R.EEDPLA.-
380	AT1G67785.1	At1g67785 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	72	673.30	672.29	673.30	672.30	1	-11.65	15.3	7897	23	2	58 - 63	R.EEDPLA.-
380	AT1G67785.1	At1g67785 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	25	601.36	600.35	601.37	600.36	1	-14.73	13.1	13715	33	2	50 - 54	R.AELLR.K
380	AT1G67785.1	At1g67785 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	118	492.26	1473.75	492.26	1473.77	3	-12.94	16.9	22897	34	2	24 - 35	K.VHVWIALHQDEK.Q
380	AT1G67785.1	At1g67785 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	38	450.72	899.42	450.72	899.43	2	-14.64	13.8	9031	32	3	56 - 63	K.AREEDPLA.-
380	AT1G67785.1	At1g67785 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	116	737.88	1473.75	737.89	1473.77	2	-12.29	16.8	19226	47	1	24 - 35	K.VHVWIALHQDEK.Q
380	AT1G67785.1	At1g67785 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	37	450.72	899.42	450.72	899.43	2	-11.09	13.7	4740	33	3	56 - 63	K.AREEDPLA.-
380	AT1G67785.1	At1g67785 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	115	492.26	1473.75	492.26	1473.77	3	-12.27	16.8	37443	49	2	24 - 35	K.VHVWIALHQDEK.Q
380	AT1G67785.1	At1g67785 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	27	601.36	600.35	601.37	600.36	1	-13.35	13.2	12937	26	2	50 - 54	R.AELLR.K
380	AT1G67785.1	At1g67785 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	41	450.72	899.42	450.72	899.43	2	-13.93	13.9	17087	36	3	56 - 63	K.AREEDPLA.-
442	AT1G67785.1	At1g67785 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	16	428.77	855.52	428.77	855.53	2	-11.76	13.2	3907	28	3	48 - 54	R.VRAELLR.K
442	AT1G67785.1	At1g67785 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	75	492.26	1473.76	492.26	1473.77	3	-8.17	16.8	8262	31	3	24 - 35	K.VHVWIALHQDEK.Q
442	AT1G67785.1	At1g67785 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	17	428.77	855.52	428.77	855.53	2	-7.92	13.3	9511	28	3	48 - 54	R.VRAELLR.K
442	AT1G67785.1	At1g67785 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	24	450.72	899.42	450.72	899.43	2	-11.37	13.6	7213	25	3	56 - 63	K.AREEDPLA.-
442	AT1G67785.1	At1g67785 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	23	450.72	899.43	450.72	899.43	2	-7.74	13.6	7329	41	3	56 - 63	K.AREEDPLA.-
442	AT1G67785.1	At1g67785 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	74	492.26	1473.76	492.26	1473.77	3	-8.74	16.8	8662	20	3	24 - 35	K.VHVWIALHQDEK.Q
442	AT1G67785.1	At1g67785 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	73	492.26	1473.76	492.26	1473.77	3	-9.78	16.8	4276	18	3	24 - 35	K.VHVWIALHQDEK.Q
442	AT1G67785.1	At1g67785 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	18	428.77	855.52	428.77	855.53	2	-10.92	13.3	11373	28	3	48 - 54	R.VRAELLR.K
442	AT1G67785.1	At1g67785 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	22	450.72	899.43	450.72	899.43	2	-9.07	13.5	5999	19	3	56 - 63	K.AREEDPLA.-
1364	AT1G72170.1	At1g72170 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	111	775.38	1548.74	775.38	1548.74	2	0.08	14	5811	81	2	72 - 87	R.AFDSPSSSSANLAAPK.N
1364	AT1G72170.1	At1g72170 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	114	775.38	1548.74	775.38	1548.74	2	0.49	14	36450	114	2	72 - 87	R.AFDSPSSSSANLAAPK.N
1364	AT1G72170.1	At1g72170 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	86	667.32	1332.62	667.32	1332.62	2	1.65	13.4	79116	29	2	6 - 17	K.DSVPPEYDVNAK.W
1364	AT1G72170.1	At1g72170 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	136	788.36	1574.71	788.36	1574.71	2	3.21	14.5	3468	85	1	88 - 102	K.NNITETSPVSQAADE.-
1364	AT1G72170.1	At1g72170 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	88	667.32	1332.62	667.32	1332.62	2	2.60	13.4	15486	24	2	6 - 17	K.DSVPPEYDVNAK.W
1424	AT1G72170.1	At1g72170 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	92	775.38	1548.74	775.38	1548.74	2	1.18	13.9	23814	82	3	72 - 87	R.AFDSPSSSSANLAAPK.N
1424	AT1G72170.1	At1g72170 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	86	775.38	1548.75	775.38	1548.74	2	3.52	13.7	8764	80	3	72 - 87	R.AFDSPSSSSANLAAPK.N
1424	AT1G72170.1	At1g72170 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	65	667.32	1332.62	667.32	1332.62	2	2.70	13.2	8758	34	2	6 - 17	K.DSVPPEYDVNAK.W
1424	AT1G72170.1	At1g72170 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	88	517.26	1548.75	517.25	1548.74	3	3.52	13.8	4015	19	2	72 - 87	R.AFDSPSSSSANLAAPK.N
1424	AT1G72170.1	At1g72170 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	112	788.36	1574.71	788.36	1574.71	2	4.82	14.3	7435	50	2	88 - 102	K.NNITETSPVSQAADE.-
1424	AT1G72170.1	At1g72170 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	89	775.38	1548.74	775.38	1548.74	2	1.82	13.8	28817	103	3	72 - 87	R.AFDSPSSSSANLAAPK.N
1424	AT1G72170.1	At1g72170 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	64	667.32	1332.62	667.32	1332.62	2	0.75	13.2	4503	17	2	6 - 17	K.DSVPPEYDVNAK.W
1424	AT1G72170.1	At1g72170 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	110	788.36	1574.71	788.36	1574.71	2	4.40	14.3	8290	78	2	88 - 102	K.NNITETSPVSQAADE.-
1424	AT1G72170.1	At1g72170 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	91	517.26	1548.74	517.25	1548.74	3	1.82	13.8	9891	57	2	72 - 87	R.AFDSPSSSSANLAAPK.N
150	AT2G27730.1	At2g27730 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	24	431.21	860.41	431.22	860.42	2	-15.62	9.4	9108	54	2	19 - 25	K.VLSEEER.A
150	AT2G27730.1	At2g27730 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	25	431.21	860.41	431.22	860.42	2	-14.70	9.5	21336	65	2	19 - 25	K.VLSEEER.A
150	AT2G27730.1	At2g27730 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	22	652.32	1302.63	652.33	1302.64	2	-10.14	9.4	15723	109	3	61 - 75	K.VAGATASASAESGPK.V
150	AT2G27730.1	At2g27730 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	23	652.32	1302.63	652.33	1302.64	2	-8.32	9.4	37536	103	3	61 - 75	K.VAGATASASAESGPK.V
150	AT2G27730.1	At2g27730 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	17	694.32	1386.63	694.33	1386.64	2	-7.91	9.1	5095	57	2	46 - 60	R.QGPGEQAAGSASEAK.V
150	AT2G27730.1	At2g27730 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	100	446.25	890.48	446.25	890.49	2	-10.64	14.6	10965	49	2	26 - 33	R.AAENVFIK.K
150	AT2G27730.1	At2g27730 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	98	446.25	890.48	446.25	890.49	2	-10.11	14.5	17687	66	2	26 - 33	R.AAENVFIK.K
150	AT2G27730.1	At2g27730 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	19	694.32	1386.63	694.33	1386.64	2	-5.77	9.2	10805	69	2	46 - 60	R.QGPGEQAAGSASEAK.V
150	AT2G27730.1	At2g27730 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	21	652.32	1302.63	652.33	1302.64	2	-12.20	9.3	3801	68	3	61 - 75	K.VAGATASASAESGPK.V
229	AT2G27730.1	At2g27730 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	7	429.22	856.42	429.22	856.43	2	-12.81	8.67378333	4832	24	3	107 - 113	K.KQPEVQE.-
229	AT2G27730.1	At2g27730 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	13	694.32	1386.63	694.33	1386.64	2	-7.12	9.16088333	5467	51	3	46 - 60	R.QGPGEQAAGSASEAK.V
229	AT2G27730.1	At2g27730 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	20	652.32	1302.63	652.33	1302.64	2	-6.98	9.45746667	4365	71	3	61 - 75	K.VAGATASASAESGPK.V
229	AT2G27730.1	At2g27730 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	21	652.32	1302.63	652.33	1302.64	2	-6.83	9.497925	23611	116	3	61 - 75	K.VAGATASASAESGPK.V
229	AT2G27730.1	At2g27730 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	123	446.25	890.48	446.25	890.49	2	-9.99	14.69751667	22630	65	2	26 - 33	R.AAENVFIK.K
229	AT2G27730.1	At2g27730 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	23	431.21	860.41	431.22	860.42	2	-14.28	9.55178333	20003	49	2	19 - 25	K.VLSEEER.A
229	AT2G27730.1	At2g27730 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	125	446.25	890.48	446.25	890.49	2	-10.89	14.76473333	31221	50	2	26 - 33	R.AAENVFIK.K
229	AT2G27730.1	At2g27730 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	9	429.22	856.42	429.22	856.43	2	-13.98	8.72763333	7975	23	3	107 - 113	K.KQPEVQE.-
229	AT2G27730.1	At2g27730 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	25	431.21	860.41	431.22	860.42	2	-13.12	9.63240833	27344	50	2	19 - 25	K.VLSEEER.A
229	AT2G27730.1	At2g27730 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	198	578.64	1732.89	578.64	1732.90	3	-7.72	17.527575	20600	18	1	19 - 33	K.VLSEEERAAENVFIK.K
229	AT2G27730.1	At2g27730 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	18	463.22	1386.63	463.22	1386.64	3	-6.88	9.29540833	3889	38	1	46 - 60	R.QGPGEQAAGSASEAK.V
229	AT2G27730.1	At2g27730 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	16	694.32	1386.63	694.33	1386.64	2	-6.83	9.26864167	23781	109	3	46 - 60	R.QGPGEQAAGSASEAK.V
229	AT2G27730.1	At2g27730 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	12	429.22	856.42	429.22	856.43	2	-12.58	8.80823333	6245	18	3	107 - 113	K.KQPEVQE.-
229	AT2G27730.1	At2g27730 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	14	694.32	1386.63	694.33	1386.64	2	-7.70	9.2014	9015	76	3	46 - 60	R.QGPGEQAAGSASEAK.V
229	AT2G27730.1	At2g27730 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	22	652.32	1302.63	652.33	1302.64	2	-8.06	9.53839167	67489	117	3	61 - 75	K.VAGATASASAESGPK.V
368	AT2G27730.1	At2g27730 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	131	446.25	890.49	446.25	890.49	2	0.94	16.5	37230	79	2	26 - 33	R.AAENVFIK.K
368	AT2G27730.1	At2g27730 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	23	431.22	860.42	431.22	860.42	2	-0.20	11	4965	51	3	19 - 25	K.VLSEEER.A
368	AT2G27730.1	At2g27730 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	222	578.64	1732.91	578.64	1732.90	3	7.18	19.4	28601	16	2	19 - 33	K.VLSEEERAAENVFIK.K
368	AT2G27730.1	At2g27730 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	10	429.22	856.43	429.22	856.43	2	3.84	10.3	4754	16	2	107 - 113	K.KQPEVQE.-
368	AT2G27730.1	At2g27730 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	14	694.33	1386.65	694.33	1386.64	2	5.94	10.6	6316	49	3	46 - 60	R.QGPGEQAAGSASEAK.V
368	AT2G27730.1	At2g27730 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	15	694.33	1386.65	694.33	1386.64	2	7.14	10.7	12231	109	3	46 - 60	R.QGPGEQAAGSASEAK.V
368	AT2G27730.1	At2g27730 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	77	510.30	1018.58	510.30	1018.58	2	2.11	13.8	12586	35	2	26 - 34	R.AAENVFIKK.M
368	AT2G27730.1	At2g27730 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	21	652.33	1302.65	652.33	1302.64	2	5.43	11	6502	84	3	61 - 75	K.VAGATASASAESGPK.V
368	AT2G27730.1	At2g27730 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	16	694.33	1386.64	694.33	1386.64	2	5.19	10.7	21499	114	3	46 - 60	R.QGPGEQAAGSASEAK.V
368	AT2G27730.1	At2g27730 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	128	446.25	890.49	446.25	890.49	2	1.68	16.4	35395	43	2	26 - 33	R.AAENVFIK.K
368	AT2G27730.1	At2g27730 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	27	431.22	860.43	431.22	860.42	2	2.40	11.2	15091	57	3	19 - 25	K.VLSEEER.A
368	AT2G27730.1	At2g27730 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	24	652.33	1302.65	652.33	1302.64	2	6.71	11.1	158367	115	3	61 - 75	K.VAGATASASAESGPK.V
368	AT2G27730.1	At2g27730 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	9	429.22	856.43	429.22	856.43	2	2.17	10.2	4294	19	2	107 - 113	K.KQPEVQE.-
368	AT2G27730.1	At2g27730 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	22	652.33	1302.65	652.33	1302.64	2	4.57	11	35761	108	3	61 - 75	K.VAGATASASAESGPK.V
368	AT2G27730.1	At2g27730 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	76	510.30	1018.58	510.30	1018.58	2	2.94	13.8	3965	17	2	26 - 34	R.AAENVFIKK.M
368	AT2G27730.1	At2g27730 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	25	431.22	860.42	431.22	860.42	2	0.84	11.1	35004	57	3	19 - 25	K.VLSEEER.A
368	AT2G27730.1	At2g27730 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	219	578.64	1732.91	578.64	1732.90	3	6.11	19.3	60261	31	2	19 - 33	K.VLSEEERAAENVFIK.K
427	AT2G27730.1	At2g27730 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	8	431.22	860.43	431.22	860.42	2	7.24	10.8	25963	61	3	19 - 25	K.VLSEEER.A
427	AT2G27730.1	At2g27730 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	10	652.34	1302.66	652.33	1302.64	2	13.24	10.9	19716	110	3	61 - 75	K.VAGATASASAESGPK.V
427	AT2G27730.1	At2g27730 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	4	694.33	1386.65	694.33	1386.64	2	10.98	10.6	13376	63	3	46 - 60	R.QGPGEQAAGSASEAK.V
427	AT2G27730.1	At2g27730 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	18	510.30	1018.59	510.30	1018.58	2	5.05	13.7	3624	36	2	26 - 34	R.AAENVFIKK.M
427	AT2G27730.1	At2g27730 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	59	446.25	890.49	446.25	890.49	2	8.96	16.2	19751	63	3	26 - 33	R.AAENVFIK.K
427	AT2G27730.1	At2g27730 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	6	431.22	860.43	431.22	860.42	2	6.55	10.7	18334	61	3	19 - 25	K.VLSEEER.A
427	AT2G27730.1	At2g27730 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	63	446.25	890.49	446.25	890.49	2	8.47	16.3	14282	24	3	26 - 33	R.AAENVFIK.K
427	AT2G27730.1	At2g27730 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	5	431.22	860.43	431.22	860.42	2	4.99	10.7	3981	61	3	19 - 25	K.VLSEEER.A
427	AT2G27730.1	At2g27730 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	3	694.33	1386.66	694.33	1386.64	2	12.68	10.6	11904	86	3	46 - 60	R.QGPGEQAAGSASEAK.V
427	AT2G27730.1	At2g27730 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	13	652.34	1302.66	652.33	1302.64	2	12.04	11	34143	106	3	61 - 75	K.VAGATASASAESGPK.V
427	AT2G27730.1	At2g27730 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	2	694.34	1386.66	694.33	1386.64	2	13.26	10.6	7340	57	3	46 - 60	R.QGPGEQAAGSASEAK.V
427	AT2G27730.1	At2g27730 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	61	446.25	890.50	446.25	890.49	2	10.06	16.2	24670	45	3	26 - 33	R.AAENVFIK.K
427	AT2G27730.1	At2g27730 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	20	510.30	1018.58	510.30	1018.58	2	3.39	13.7	5077	48	2	26 - 34	R.AAENVFIKK.M
427	AT2G27730.1	At2g27730 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	11	652.34	1302.66	652.33	1302.64	2	11.78	10.9	41693	92	3	61 - 75	K.VAGATASASAESGPK.V
1472	AT2G27730.1	At2g27730 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	2	694.32	1386.63	694.33	1386.64	2	-7.31	9.4	41303	42	2	46 - 60	R.QGPGEQAAGSASEAK.V
1472	AT2G27730.1	At2g27730 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	9	431.22	860.42	431.22	860.42	2	-8.02	9.6	2650	22	3	19 - 25	K.VLSEEER.A
1472	AT2G27730.1	At2g27730 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	3	431.21	860.42	431.22	860.42	2	-9.97	9.5	14465	29	3	19 - 25	K.VLSEEER.A
1472	AT2G27730.1	At2g27730 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	10	652.32	1302.63	652.33	1302.64	2	-5.16	9.7	20493	95	3	61 - 75	K.VAGATASASAESGPK.V
1472	AT2G27730.1	At2g27730 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	4	431.22	860.42	431.22	860.42	2	-7.48	9.5	8218	51	3	19 - 25	K.VLSEEER.A
1472	AT2G27730.1	At2g27730 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	173	446.25	890.48	446.25	890.49	2	-9.97	14.8	16248	32	2	26 - 33	R.AAENVFIK.K
1472	AT2G27730.1	At2g27730 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	1	694.32	1386.63	694.33	1386.64	2	-6.36	9.3	7092	60	2	46 - 60	R.QGPGEQAAGSASEAK.V
1472	AT2G27730.1	At2g27730 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	6	652.32	1302.63	652.33	1302.64	2	-6.39	9.5	5504	102	3	61 - 75	K.VAGATASASAESGPK.V
1472	AT2G27730.1	At2g27730 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	169	446.25	890.48	446.25	890.49	2	-11.45	14.7	6133	47	2	26 - 33	R.AAENVFIK.K
1472	AT2G27730.1	At2g27730 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	7	652.32	1302.63	652.33	1302.64	2	-5.50	9.6	4040	123	3	61 - 75	K.VAGATASASAESGPK.V
1526	AT2G27730.1	At2g27730 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	13	652.32	1302.62	652.33	1302.64	2	-13.19	9.4	69937	106	3	61 - 75	K.VAGATASASAESGPK.V
1526	AT2G27730.1	At2g27730 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	11	431.21	860.41	431.22	860.42	2	-16.41	9.3	56959	41	3	19 - 25	K.VLSEEER.A
1526	AT2G27730.1	At2g27730 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	4	463.21	1386.62	463.22	1386.64	3	-14.98	9.1	5467	18	2	46 - 60	R.QGPGEQAAGSASEAK.V
1526	AT2G27730.1	At2g27730 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	3	694.32	1386.62	694.33	1386.64	2	-14.98	9.1	16680	95	3	46 - 60	R.QGPGEQAAGSASEAK.V
1526	AT2G27730.1	At2g27730 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	142	446.24	890.47	446.25	890.49	2	-16.49	14.5	43812	47	3	26 - 33	R.AAENVFIK.K
1526	AT2G27730.1	At2g27730 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	10	652.32	1302.62	652.33	1302.64	2	-13.93	9.3	69921	110	3	61 - 75	K.VAGATASASAESGPK.V
1526	AT2G27730.1	At2g27730 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	140	446.24	890.47	446.25	890.49	2	-15.19	14.4	7142	53	3	26 - 33	R.AAENVFIK.K
1526	AT2G27730.1	At2g27730 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	9	652.32	1302.62	652.33	1302.64	2	-13.21	9.3	11709	114	3	61 - 75	K.VAGATASASAESGPK.V
1526	AT2G27730.1	At2g27730 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	8	431.21	860.41	431.22	860.42	2	-16.04	9.3	17902	46	3	19 - 25	K.VLSEEER.A
1526	AT2G27730.1	At2g27730 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	7	431.21	860.41	431.22	860.42	2	-17.32	9.3	3319	29	3	19 - 25	K.VLSEEER.A
1526	AT2G27730.1	At2g27730 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	1	694.32	1386.62	694.33	1386.64	2	-11.63	9.1	5231	60	3	46 - 60	R.QGPGEQAAGSASEAK.V
1526	AT2G27730.1	At2g27730 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	2	694.32	1386.62	694.33	1386.64	2	-13.83	9.1	10537	56	3	46 - 60	R.QGPGEQAAGSASEAK.V
1526	AT2G27730.1	At2g27730 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	5	463.21	1386.62	463.22	1386.64	3	-12.99	9.2	7613	56	2	46 - 60	R.QGPGEQAAGSASEAK.V
1526	AT2G27730.1	At2g27730 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	143	891.48	890.47	891.49	890.49	1	-16.52	14.5	4504	32	2	26 - 33	R.AAENVFIK.K
1526	AT2G27730.1	At2g27730 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	147	891.48	890.47	891.49	890.49	1	-15.96	14.6	6198	19	2	26 - 33	R.AAENVFIK.K
1526	AT2G27730.1	At2g27730 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	145	446.24	890.47	446.25	890.49	2	-15.93	14.6	66983	47	3	26 - 33	R.AAENVFIK.K
162	AT2G31490.1	At2g31490 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	2	432.43	1725.69	432.44	1725.73	4	-19.17	9.2	10311	43	1	55 - 68	K.DFHMQDEDAGRPHR.K	Oxidation: 4
162	AT2G31490.1	At2g31490 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	106	540.75	1079.49	540.76	1079.50	2	-14.61	16.6	20058	40	2	12 - 20	K.FIEDWGSAR.E
162	AT2G31490.1	At2g31490 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	25	529.75	1057.48	529.75	1057.49	2	-13.18	11.7	17622	37	3	21 - 28	R.ENLEHNFR.W
162	AT2G31490.1	At2g31490 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	24	529.75	1057.48	529.75	1057.49	2	-16.35	11.7	4670	35	3	21 - 28	R.ENLEHNFR.W
162	AT2G31490.1	At2g31490 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	26	529.75	1057.48	529.75	1057.49	2	-12.93	11.8	17349	30	3	21 - 28	R.ENLEHNFR.W
162	AT2G31490.1	At2g31490 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	104	540.75	1079.49	540.76	1079.50	2	-14.92	16.5	4352	40	2	12 - 20	K.FIEDWGSAR.E
240	AT2G31490.1	At2g31490 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	51	428.44	1709.71	428.44	1709.73	4	-12.34	11.20369167	3967	20	1	55 - 68	K.DFHMQDEDAGRPHR.K
240	AT2G31490.1	At2g31490 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	185	540.75	1079.49	540.76	1079.50	2	-11.61	16.594275	20310	40	2	12 - 20	K.FIEDWGSAR.E
240	AT2G31490.1	At2g31490 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	61	529.75	1057.48	529.75	1057.49	2	-12.89	11.594575	19301	38	2	21 - 28	R.ENLEHNFR.W
240	AT2G31490.1	At2g31490 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	17	432.43	1725.70	432.44	1725.73	4	-14.84	9.01150833	15209	34	1	55 - 68	K.DFHMQDEDAGRPHR.K	Oxidation: 4
240	AT2G31490.1	At2g31490 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	181	540.75	1079.49	540.76	1079.50	2	-11.06	16.486875	71357	60	2	12 - 20	K.FIEDWGSAR.E
240	AT2G31490.1	At2g31490 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	60	529.75	1057.48	529.75	1057.49	2	-13.46	11.5541	8621	48	2	21 - 28	R.ENLEHNFR.W
378	AT2G31490.1	At2g31490 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	223	540.76	1079.50	540.76	1079.50	2	-2.50	18.1	22852	38	3	12 - 20	K.FIEDWGSAR.E
378	AT2G31490.1	At2g31490 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	73	529.75	1057.49	529.75	1057.49	2	-4.00	13.2	80699	51	3	21 - 28	R.ENLEHNFR.W
378	AT2G31490.1	At2g31490 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	226	540.76	1079.50	540.76	1079.50	2	-4.44	18.2	173640	37	3	12 - 20	K.FIEDWGSAR.E
378	AT2G31490.1	At2g31490 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	26	432.44	1725.72	432.44	1725.73	4	-4.00	10.7	8378	32	2	55 - 68	K.DFHMQDEDAGRPHR.K	Oxidation: 4
378	AT2G31490.1	At2g31490 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	70	529.75	1057.49	529.75	1057.49	2	-4.44	13	10973	45	3	21 - 28	R.ENLEHNFR.W
378	AT2G31490.1	At2g31490 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	24	432.44	1725.72	432.44	1725.73	4	-4.62	10.6	7347	32	2	55 - 68	K.DFHMQDEDAGRPHR.K	Oxidation: 4
378	AT2G31490.1	At2g31490 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	66	428.44	1709.72	428.44	1709.73	4	-5.72	12.8	3769	17	1	55 - 68	K.DFHMQDEDAGRPHR.K
378	AT2G31490.1	At2g31490 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	229	540.76	1079.50	540.76	1079.50	2	-2.61	18.3	47904	22	3	12 - 20	K.FIEDWGSAR.E
378	AT2G31490.1	At2g31490 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	84	578.60	1732.78	578.60	1732.78	3	-3.24	13.5	5634	24	1	51 - 65	K.GIVKDFHMQDEDAGR.P	Oxidation: 8
378	AT2G31490.1	At2g31490 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	71	529.75	1057.49	529.75	1057.49	2	-2.85	13.1	79549	54	3	21 - 28	R.ENLEHNFR.W
378	AT2G31490.1	At2g31490 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	23	576.25	1725.72	576.25	1725.73	3	-4.62	10.6	7421	17	1	55 - 68	K.DFHMQDEDAGRPHR.K	Oxidation: 4
378	AT2G31490.1	At2g31490 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	206	661.83	1321.64	661.83	1321.64	2	1.20	17.6	7221	39	1	10 - 20	K.NKFIEDWGSAR.E
439	AT2G31490.1	At2g31490 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	2	529.75	1057.49	529.75	1057.49	2	-5.85	13.1	8256	35	3	21 - 28	R.ENLEHNFR.W
439	AT2G31490.1	At2g31490 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	1	529.75	1057.49	529.75	1057.49	2	-5.59	13.1	4192	44	3	21 - 28	R.ENLEHNFR.W
439	AT2G31490.1	At2g31490 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	89	540.76	1079.50	540.76	1079.50	2	-3.57	18.2	5389	40	2	12 - 20	K.FIEDWGSAR.E
439	AT2G31490.1	At2g31490 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	90	540.76	1079.50	540.76	1079.50	2	-6.27	18.2	18210	40	2	12 - 20	K.FIEDWGSAR.E
439	AT2G31490.1	At2g31490 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	3	529.75	1057.49	529.75	1057.49	2	-4.98	13.1	6809	37	3	21 - 28	R.ENLEHNFR.W
157	AT2G42310.1	At2g42310/At3g57785-1 (plant specific complex I su	complex I	a) oxidative phosphorylation	mitochondria	39	741.83	1481.64	741.84	1481.66	2	-8.83	12.1	7693	42	3	101 - 114	R.LEMEKLATAGDSSD.-	Oxidation: 3
157	AT2G42310.1	At2g42310/At3g57785-1 (plant specific complex I su	complex I	a) oxidative phosphorylation	mitochondria	40	402.17	802.33	402.18	802.34	2	-10.40	12.2	3563	26	3	43 - 48	K.GYFMNR.T	Oxidation: 4
157	AT2G42310.1	At2g42310/At3g57785-1 (plant specific complex I su	complex I	a) oxidative phosphorylation	mitochondria	41	402.17	802.33	402.18	802.34	2	-14.52	12.2	12547	25	3	43 - 48	K.GYFMNR.T	Oxidation: 4
157	AT2G42310.1	At2g42310/At3g57785-1 (plant specific complex I su	complex I	a) oxidative phosphorylation	mitochondria	34	567.79	1133.56	567.79	1133.58	2	-16.28	11.2	12470	23	2	97 - 105	K.ALERLEMEK.L	Oxidation: 7
157	AT2G42310.1	At2g42310/At3g57785-1 (plant specific complex I su	complex I	a) oxidative phosphorylation	mitochondria	26	436.55	1306.62	436.55	1306.64	3	-15.75	10.4	4328	38	3	32 - 42	R.WATPGHEERPK.G
157	AT2G42310.1	At2g42310/At3g57785-1 (plant specific complex I su	complex I	a) oxidative phosphorylation	mitochondria	27	436.55	1306.62	436.55	1306.64	3	-14.72	10.4	8498	39	3	32 - 42	R.WATPGHEERPK.G
157	AT2G42310.1	At2g42310/At3g57785-1 (plant specific complex I su	complex I	a) oxidative phosphorylation	mitochondria	16	836.36	835.35	836.36	835.36	1	-6.14	8.7	3343	46	2	106 - 114	K.LATAGDSSD.-
157	AT2G42310.1	At2g42310/At3g57785-1 (plant specific complex I su	complex I	a) oxidative phosphorylation	mitochondria	6	455.73	909.45	455.74	909.47	2	-14.55	8.3	23588	30	6	49 - 57	R.TPPAPGQSR.K
157	AT2G42310.1	At2g42310/At3g57785-1 (plant specific complex I su	complex I	a) oxidative phosphorylation	mitochondria	8	455.73	909.45	455.74	909.47	2	-13.96	8.4	42525	40	6	49 - 57	R.TPPAPGQSR.K
157	AT2G42310.1	At2g42310/At3g57785-1 (plant specific complex I su	complex I	a) oxidative phosphorylation	mitochondria	28	436.55	1306.62	436.55	1306.64	3	-14.28	10.4	8517	40	3	32 - 42	R.WATPGHEERPK.G
157	AT2G42310.1	At2g42310/At3g57785-1 (plant specific complex I su	complex I	a) oxidative phosphorylation	mitochondria	43	402.17	802.33	402.18	802.34	2	-16.59	12.3	19666	22	3	43 - 48	K.GYFMNR.T	Oxidation: 4
157	AT2G42310.1	At2g42310/At3g57785-1 (plant specific complex I su	complex I	a) oxidative phosphorylation	mitochondria	10	455.73	909.45	455.74	909.47	2	-15.54	8.5	25611	29	6	49 - 57	R.TPPAPGQSR.K
157	AT2G42310.1	At2g42310/At3g57785-1 (plant specific complex I su	complex I	a) oxidative phosphorylation	mitochondria	38	741.83	1481.64	741.84	1481.66	2	-7.63	12.1	9475	112	3	101 - 114	R.LEMEKLATAGDSSD.-	Oxidation: 3
157	AT2G42310.1	At2g42310/At3g57785-1 (plant specific complex I su	complex I	a) oxidative phosphorylation	mitochondria	5	455.73	909.46	455.74	909.47	2	-12.71	8.3	5673	29	6	49 - 57	R.TPPAPGQSR.K
157	AT2G42310.1	At2g42310/At3g57785-1 (plant specific complex I su	complex I	a) oxidative phosphorylation	mitochondria	7	455.73	909.45	455.74	909.47	2	-13.19	8.3	40569	32	6	49 - 57	R.TPPAPGQSR.K
157	AT2G42310.1	At2g42310/At3g57785-1 (plant specific complex I su	complex I	a) oxidative phosphorylation	mitochondria	9	455.73	909.45	455.74	909.47	2	-14.66	8.4	32040	37	6	49 - 57	R.TPPAPGQSR.K
157	AT2G42310.1	At2g42310/At3g57785-1 (plant specific complex I su	complex I	a) oxidative phosphorylation	mitochondria	17	836.35	835.35	836.36	835.36	1	-10.11	8.8	5350	36	2	106 - 114	K.LATAGDSSD.-
157	AT2G42310.1	At2g42310/At3g57785-1 (plant specific complex I su	complex I	a) oxidative phosphorylation	mitochondria	33	567.79	1133.56	567.79	1133.58	2	-15.21	11.2	3521	22	2	97 - 105	K.ALERLEMEK.L	Oxidation: 7
157	AT2G42310.1	At2g42310/At3g57785-1 (plant specific complex I su	complex I	a) oxidative phosphorylation	mitochondria	37	741.83	1481.64	741.84	1481.66	2	-8.58	12	5053	86	3	101 - 114	R.LEMEKLATAGDSSD.-	Oxidation: 3
235	AT2G42310.1	At2g42310/At3g57785-1 (plant specific complex I su	complex I	a) oxidative phosphorylation	mitochondria	47	567.79	1133.56	567.79	1133.58	2	-12.69	11.19041667	8337	20	2	97 - 105	K.ALERLEMEK.L	Oxidation: 7
235	AT2G42310.1	At2g42310/At3g57785-1 (plant specific complex I su	complex I	a) oxidative phosphorylation	mitochondria	3	455.73	909.45	455.74	909.47	2	-13.15	8.10485833	50092	32	5	49 - 57	R.TPPAPGQSR.K
235	AT2G42310.1	At2g42310/At3g57785-1 (plant specific complex I su	complex I	a) oxidative phosphorylation	mitochondria	39	436.55	1306.62	436.55	1306.64	3	-14.33	10.29596667	14297	38	2	32 - 42	R.WATPGHEERPK.G
235	AT2G42310.1	At2g42310/At3g57785-1 (plant specific complex I su	complex I	a) oxidative phosphorylation	mitochondria	5	455.73	909.45	455.74	909.47	2	-14.24	8.1858	37990	40	5	49 - 57	R.TPPAPGQSR.K
235	AT2G42310.1	At2g42310/At3g57785-1 (plant specific complex I su	complex I	a) oxidative phosphorylation	mitochondria	1	455.73	909.45	455.74	909.47	2	-14.46	8.02394167	3969	32	5	49 - 57	R.TPPAPGQSR.K
235	AT2G42310.1	At2g42310/At3g57785-1 (plant specific complex I su	complex I	a) oxidative phosphorylation	mitochondria	45	567.79	1133.56	567.79	1133.58	2	-13.22	11.12318333	4017	30	2	97 - 105	K.ALERLEMEK.L	Oxidation: 7
235	AT2G42310.1	At2g42310/At3g57785-1 (plant specific complex I su	complex I	a) oxidative phosphorylation	mitochondria	72	402.17	802.33	402.18	802.34	2	-11.64	12.09281667	6204	25	1	43 - 48	K.GYFMNR.T	Oxidation: 4
235	AT2G42310.1	At2g42310/At3g57785-1 (plant specific complex I su	complex I	a) oxidative phosphorylation	mitochondria	4	455.73	909.45	455.74	909.47	2	-14.46	8.14535	47821	30	5	49 - 57	R.TPPAPGQSR.K
235	AT2G42310.1	At2g42310/At3g57785-1 (plant specific complex I su	complex I	a) oxidative phosphorylation	mitochondria	68	741.83	1481.64	741.84	1481.66	2	-10.18	11.95804167	3966	70	1	101 - 114	R.LEMEKLATAGDSSD.-	Oxidation: 3
235	AT2G42310.1	At2g42310/At3g57785-1 (plant specific complex I su	complex I	a) oxidative phosphorylation	mitochondria	2	455.73	909.45	455.74	909.47	2	-14.46	8.0644	22313	37	5	49 - 57	R.TPPAPGQSR.K
235	AT2G42310.1	At2g42310/At3g57785-1 (plant specific complex I su	complex I	a) oxidative phosphorylation	mitochondria	38	436.55	1306.62	436.55	1306.64	3	-12.95	10.255475	15681	42	2	32 - 42	R.WATPGHEERPK.G
374	AT2G42310.1	At2g42310/At3g57785-1 (plant specific complex I su	complex I	a) oxidative phosphorylation	mitochondria	62	741.84	1481.66	741.84	1481.66	2	2.84	13.7	11341	60	3	101 - 114	R.LEMEKLATAGDSSD.-	Oxidation: 3
374	AT2G42310.1	At2g42310/At3g57785-1 (plant specific complex I su	complex I	a) oxidative phosphorylation	mitochondria	44	436.55	1306.64	436.55	1306.64	3	0.04	12	15548	39	3	32 - 42	R.WATPGHEERPK.G
374	AT2G42310.1	At2g42310/At3g57785-1 (plant specific complex I su	complex I	a) oxidative phosphorylation	mitochondria	91	559.80	1117.58	559.80	1117.58	2	2.09	14.9	10244	15	3	97 - 105	K.ALERLEMEK.L
374	AT2G42310.1	At2g42310/At3g57785-1 (plant specific complex I su	complex I	a) oxidative phosphorylation	mitochondria	60	741.84	1481.66	741.84	1481.66	2	3.30	13.6	6113	67	3	101 - 114	R.LEMEKLATAGDSSD.-	Oxidation: 3
374	AT2G42310.1	At2g42310/At3g57785-1 (plant specific complex I su	complex I	a) oxidative phosphorylation	mitochondria	45	654.33	1306.64	654.33	1306.64	2	0.04	12	11533	25	1	32 - 42	R.WATPGHEERPK.G
374	AT2G42310.1	At2g42310/At3g57785-1 (plant specific complex I su	complex I	a) oxidative phosphorylation	mitochondria	67	402.18	802.34	402.18	802.34	2	1.71	13.9	17234	19	3	43 - 48	K.GYFMNR.T	Oxidation: 4
374	AT2G42310.1	At2g42310/At3g57785-1 (plant specific complex I su	complex I	a) oxidative phosphorylation	mitochondria	64	402.18	802.34	402.18	802.34	2	1.66	13.8	8891	20	3	43 - 48	K.GYFMNR.T	Oxidation: 4
374	AT2G42310.1	At2g42310/At3g57785-1 (plant specific complex I su	complex I	a) oxidative phosphorylation	mitochondria	14	836.37	835.36	836.36	835.36	1	4.31	10	6072	32	3	106 - 114	K.LATAGDSSD.-
374	AT2G42310.1	At2g42310/At3g57785-1 (plant specific complex I su	complex I	a) oxidative phosphorylation	mitochondria	61	741.84	1481.66	741.84	1481.66	2	3.54	13.7	11871	70	3	101 - 114	R.LEMEKLATAGDSSD.-	Oxidation: 3
374	AT2G42310.1	At2g42310/At3g57785-1 (plant specific complex I su	complex I	a) oxidative phosphorylation	mitochondria	53	567.79	1133.58	567.79	1133.58	2	0.22	12.8	27572	33	2	97 - 105	K.ALERLEMEK.L	Oxidation: 7
374	AT2G42310.1	At2g42310/At3g57785-1 (plant specific complex I su	complex I	a) oxidative phosphorylation	mitochondria	42	436.56	1306.64	436.55	1306.64	3	1.41	11.9	5111	39	3	32 - 42	R.WATPGHEERPK.G
374	AT2G42310.1	At2g42310/At3g57785-1 (plant specific complex I su	complex I	a) oxidative phosphorylation	mitochondria	63	402.18	802.34	402.18	802.34	2	0.67	13.8	3808	19	3	43 - 48	K.GYFMNR.T	Oxidation: 4
374	AT2G42310.1	At2g42310/At3g57785-1 (plant specific complex I su	complex I	a) oxidative phosphorylation	mitochondria	51	567.79	1133.58	567.79	1133.58	2	0.11	12.8	5524	36	2	97 - 105	K.ALERLEMEK.L	Oxidation: 7
374	AT2G42310.1	At2g42310/At3g57785-1 (plant specific complex I su	complex I	a) oxidative phosphorylation	mitochondria	89	559.80	1117.58	559.80	1117.58	2	0.47	14.8	14465	30	3	97 - 105	K.ALERLEMEK.L
374	AT2G42310.1	At2g42310/At3g57785-1 (plant specific complex I su	complex I	a) oxidative phosphorylation	mitochondria	6	455.74	909.47	455.74	909.47	2	-1.23	9.8	22840	39	3	49 - 57	R.TPPAPGQSR.K
374	AT2G42310.1	At2g42310/At3g57785-1 (plant specific complex I su	complex I	a) oxidative phosphorylation	mitochondria	5	455.74	909.47	455.74	909.47	2	-1.03	9.7	7618	29	3	49 - 57	R.TPPAPGQSR.K
374	AT2G42310.1	At2g42310/At3g57785-1 (plant specific complex I su	complex I	a) oxidative phosphorylation	mitochondria	9	455.74	909.47	455.74	909.47	2	-0.07	9.9	32981	35	3	49 - 57	R.TPPAPGQSR.K
374	AT2G42310.1	At2g42310/At3g57785-1 (plant specific complex I su	complex I	a) oxidative phosphorylation	mitochondria	90	559.80	1117.58	559.80	1117.58	2	0.00	14.9	14294	24	3	97 - 105	K.ALERLEMEK.L
374	AT2G42310.1	At2g42310/At3g57785-1 (plant specific complex I su	complex I	a) oxidative phosphorylation	mitochondria	15	836.36	835.36	836.36	835.36	1	1.88	10.1	5589	28	3	106 - 114	K.LATAGDSSD.-
374	AT2G42310.1	At2g42310/At3g57785-1 (plant specific complex I su	complex I	a) oxidative phosphorylation	mitochondria	47	436.55	1306.64	436.55	1306.64	3	0.56	12	6795	34	3	32 - 42	R.WATPGHEERPK.G
374	AT2G42310.1	At2g42310/At3g57785-1 (plant specific complex I su	complex I	a) oxidative phosphorylation	mitochondria	13	836.37	835.36	836.36	835.36	1	5.36	10	4390	32	3	106 - 114	K.LATAGDSSD.-
433	AT2G42310.1	At2g42310/At3g57785-1 (plant specific complex I su	complex I	a) oxidative phosphorylation	mitochondria	8	436.56	1306.66	436.55	1306.64	3	10.23	11.9	4692	31	1	32 - 42	R.WATPGHEERPK.G
433	AT2G42310.1	At2g42310/At3g57785-1 (plant specific complex I su	complex I	a) oxidative phosphorylation	mitochondria	1	455.75	909.48	455.74	909.47	2	12.83	9.6	5245	25	1	49 - 57	R.TPPAPGQSR.K
1341	AT2G45060.1	At2g45060	uncharacterized	h) uncharacterized	mitochondria	311	740.87	1479.72	740.87	1479.73	2	-8.58	16.4	11700	38	2	59 - 72	K.TITETVDSTIDASK.A
1341	AT2G45060.1	At2g45060	uncharacterized	h) uncharacterized	mitochondria	328	632.33	1262.65	632.33	1262.65	2	-3.64	16.8	4014	72	2	186 - 196	R.VATVAEEEFIR.G
1341	AT2G45060.1	At2g45060	uncharacterized	h) uncharacterized	mitochondria	258	531.27	1060.52	531.27	1060.53	2	-12.89	15.2	26477	31	1	143 - 150	R.FVYYNTVR.M
1341	AT2G45060.1	At2g45060	uncharacterized	h) uncharacterized	mitochondria	363	649.32	1296.62	649.33	1296.64	2	-10.83	17.6	19799	65	1	151 - 161	R.MFVSEEALLSR.A	Oxidation: 1
1341	AT2G45060.1	At2g45060	uncharacterized	h) uncharacterized	mitochondria	329	632.33	1262.64	632.33	1262.65	2	-7.29	16.8	25115	54	2	186 - 196	R.VATVAEEEFIR.G
1341	AT2G45060.1	At2g45060	uncharacterized	h) uncharacterized	mitochondria	308	740.86	1479.72	740.87	1479.73	2	-10.41	16.3	16150	66	2	59 - 72	K.TITETVDSTIDASK.A
1341	AT2G45060.1	At2g45060	uncharacterized	h) uncharacterized	mitochondria	88	425.24	848.46	425.25	848.48	2	-12.86	11.4	110718	15	1	52 - 58	R.QALVYQK.T
1453	AT2G45060.1	At2g45060	uncharacterized	h) uncharacterized	mitochondria	223	531.27	1060.53	531.27	1060.53	2	-6.43	15.1	6137	32	2	143 - 150	R.FVYYNTVR.M
1453	AT2G45060.1	At2g45060	uncharacterized	h) uncharacterized	mitochondria	288	632.33	1262.64	632.33	1262.65	2	-5.47	16.7	7901	70	3	186 - 196	R.VATVAEEEFIR.G
1453	AT2G45060.1	At2g45060	uncharacterized	h) uncharacterized	mitochondria	120	777.83	1553.64	777.83	1553.65	2	-4.75	12.7	10270	51	1	2 - 16	M.AALGESSSSEMDNAK.S	Acetyl: 1
1453	AT2G45060.1	At2g45060	uncharacterized	h) uncharacterized	mitochondria	491	649.66	1945.97	649.67	1945.97	3	-2.05	23.3	7796	47	2	34 - 51	K.IATTTVENAASWIDDALR.Q
1453	AT2G45060.1	At2g45060	uncharacterized	h) uncharacterized	mitochondria	272	740.87	1479.72	740.87	1479.73	2	-4.01	16.3	3550	64	2	59 - 72	K.TITETVDSTIDASK.A
1453	AT2G45060.1	At2g45060	uncharacterized	h) uncharacterized	mitochondria	292	632.33	1262.65	632.33	1262.65	2	-1.22	16.8	16612	23	3	186 - 196	R.VATVAEEEFIR.G
1453	AT2G45060.1	At2g45060	uncharacterized	h) uncharacterized	mitochondria	66	425.24	848.47	425.25	848.48	2	-7.45	11.4	8125	25	2	52 - 58	R.QALVYQK.T
1453	AT2G45060.1	At2g45060	uncharacterized	h) uncharacterized	mitochondria	490	973.99	1945.97	973.99	1945.97	2	-1.20	23.3	7425	47	1	34 - 51	K.IATTTVENAASWIDDALR.Q
1453	AT2G45060.1	At2g45060	uncharacterized	h) uncharacterized	mitochondria	290	632.33	1262.65	632.33	1262.65	2	-1.91	16.7	9639	65	3	186 - 196	R.VATVAEEEFIR.G
1453	AT2G45060.1	At2g45060	uncharacterized	h) uncharacterized	mitochondria	318	649.32	1296.63	649.33	1296.64	2	-3.80	17.5	3354	56	3	151 - 161	R.MFVSEEALLSR.A	Oxidation: 1
1453	AT2G45060.1	At2g45060	uncharacterized	h) uncharacterized	mitochondria	319	649.32	1296.63	649.33	1296.64	2	-4.64	17.5	4959	66	3	151 - 161	R.MFVSEEALLSR.A	Oxidation: 1
1453	AT2G45060.1	At2g45060	uncharacterized	h) uncharacterized	mitochondria	489	649.66	1945.97	649.67	1945.97	3	-1.20	23.2	6787	69	2	34 - 51	K.IATTTVENAASWIDDALR.Q
1453	AT2G45060.1	At2g45060	uncharacterized	h) uncharacterized	mitochondria	270	740.87	1479.72	740.87	1479.73	2	-7.75	16.3	2168	68	2	59 - 72	K.TITETVDSTIDASK.A
1453	AT2G45060.1	At2g45060	uncharacterized	h) uncharacterized	mitochondria	322	649.32	1296.63	649.33	1296.64	2	-5.50	17.5	8585	80	3	151 - 161	R.MFVSEEALLSR.A	Oxidation: 1
1453	AT2G45060.1	At2g45060	uncharacterized	h) uncharacterized	mitochondria	226	531.27	1060.53	531.27	1060.53	2	-4.94	15.1	4597	43	2	143 - 150	R.FVYYNTVR.M
1453	AT2G45060.1	At2g45060	uncharacterized	h) uncharacterized	mitochondria	325	852.43	851.43	852.45	851.44	1	-14.97	17.6	7426	23	1	265 - 272	K.ISNYGISV.-
1453	AT2G45060.1	At2g45060	uncharacterized	h) uncharacterized	mitochondria	69	425.24	848.47	425.25	848.48	2	-6.34	11.5	5307	28	2	52 - 58	R.QALVYQK.T
1505	AT2G45060.1	At2g45060	uncharacterized	h) uncharacterized	mitochondria	278	649.31	1296.61	649.33	1296.64	2	-19.04	17.6	5872	51	1	151 - 161	R.MFVSEEALLSR.A	Oxidation: 1
1505	AT2G45060.1	At2g45060	uncharacterized	h) uncharacterized	mitochondria	241	632.32	1262.63	632.33	1262.65	2	-18.41	16.7	5692	85	2	186 - 196	R.VATVAEEEFIR.G
1505	AT2G45060.1	At2g45060	uncharacterized	h) uncharacterized	mitochondria	184	531.26	1060.52	531.27	1060.53	2	-17.93	15	34111	38	1	143 - 150	R.FVYYNTVR.M
1505	AT2G45060.1	At2g45060	uncharacterized	h) uncharacterized	mitochondria	244	632.32	1262.63	632.33	1262.65	2	-18.17	16.7	10268	62	2	186 - 196	R.VATVAEEEFIR.G
1505	AT2G45060.1	At2g45060	uncharacterized	h) uncharacterized	mitochondria	85	777.82	1553.63	777.83	1553.65	2	-16.06	12.6	12748	54	1	2 - 16	M.AALGESSSSEMDNAK.S	Acetyl: 1
1505	AT2G45060.1	At2g45060	uncharacterized	h) uncharacterized	mitochondria	225	740.86	1479.70	740.87	1479.73	2	-18.00	16.3	4084	58	1	59 - 72	K.TITETVDSTIDASK.A
1324	AT3G01130.1	AT3G01130.1 (homolog to also unknown At5g15320)	uncharacterised	h) uncharacterised	extracellular	175	885.98	1769.95	885.99	1769.97	2	-7.99	19.4	14621	17	2	2 - 19	M.APPPGLYSGTSTLALVAR.A
1324	AT3G01130.1	AT3G01130.1 (homolog to also unknown At5g15320)	uncharacterised	h) uncharacterised	extracellular	176	590.99	1769.95	591.00	1769.97	3	-7.99	19.4	14040	56	4	2 - 19	M.APPPGLYSGTSTLALVAR.A
1324	AT3G01130.1	AT3G01130.1 (homolog to also unknown At5g15320)	uncharacterised	h) uncharacterised	extracellular	184	712.39	1422.77	712.40	1422.79	2	-9.95	21.8	18168	100	4	20 - 33	R.ASAFGLGLIYGNIK.L
1324	AT3G01130.1	AT3G01130.1 (homolog to also unknown At5g15320)	uncharacterised	h) uncharacterised	extracellular	185	712.39	1422.77	712.40	1422.79	2	-10.71	21.8	13227	94	4	20 - 33	R.ASAFGLGLIYGNIK.L
1324	AT3G01130.1	AT3G01130.1 (homolog to also unknown At5g15320)	uncharacterised	h) uncharacterised	extracellular	173	885.98	1769.95	885.99	1769.97	2	-8.32	19.3	18024	18	2	2 - 19	M.APPPGLYSGTSTLALVAR.A
1324	AT3G01130.1	AT3G01130.1 (homolog to also unknown At5g15320)	uncharacterised	h) uncharacterised	extracellular	174	590.99	1769.95	591.00	1769.97	3	-8.31	19.3	14644	61	4	2 - 19	M.APPPGLYSGTSTLALVAR.A
1324	AT3G01130.1	AT3G01130.1 (homolog to also unknown At5g15320)	uncharacterised	h) uncharacterised	extracellular	183	712.39	1422.77	712.40	1422.79	2	-11.52	21.7	11719	79	4	20 - 33	R.ASAFGLGLIYGNIK.L
1324	AT3G01130.1	AT3G01130.1 (homolog to also unknown At5g15320)	uncharacterised	h) uncharacterised	extracellular	182	712.39	1422.77	712.40	1422.79	2	-9.53	21.7	5153	68	4	20 - 33	R.ASAFGLGLIYGNIK.L
1324	AT3G01130.1	AT3G01130.1 (homolog to also unknown At5g15320)	uncharacterised	h) uncharacterised	extracellular	177	590.99	1769.95	591.00	1769.97	3	-8.12	19.4	7266	50	4	2 - 19	M.APPPGLYSGTSTLALVAR.A
1324	AT3G01130.1	AT3G01130.1 (homolog to also unknown At5g15320)	uncharacterised	h) uncharacterised	extracellular	172	590.99	1769.96	591.00	1769.97	3	-6.53	19.3	5471	60	4	2 - 19	M.APPPGLYSGTSTLALVAR.A
1380	AT3G01130.1	AT3G01130.1 (homolog to also unknown At5g15320)	uncharacterised	h) uncharacterised	extracellular	263	475.27	1422.78	475.27	1422.79	3	-4.09	21.8	5862	43	2	20 - 33	R.ASAFGLGLIYGNIK.L
1380	AT3G01130.1	AT3G01130.1 (homolog to also unknown At5g15320)	uncharacterised	h) uncharacterised	extracellular	235	591.00	1769.96	591.00	1769.97	3	-2.15	19.5	27953	60	3	2 - 19	M.APPPGLYSGTSTLALVAR.A
1380	AT3G01130.1	AT3G01130.1 (homolog to also unknown At5g15320)	uncharacterised	h) uncharacterised	extracellular	231	885.99	1769.96	885.99	1769.97	2	-1.52	19.5	58752	38	2	2 - 19	M.APPPGLYSGTSTLALVAR.A
1380	AT3G01130.1	AT3G01130.1 (homolog to also unknown At5g15320)	uncharacterised	h) uncharacterised	extracellular	266	475.27	1422.78	475.27	1422.79	3	-3.75	21.9	17629	45	2	20 - 33	R.ASAFGLGLIYGNIK.L
1380	AT3G01130.1	AT3G01130.1 (homolog to also unknown At5g15320)	uncharacterised	h) uncharacterised	extracellular	234	885.99	1769.96	885.99	1769.97	2	-2.15	19.5	46946	37	2	2 - 19	M.APPPGLYSGTSTLALVAR.A
1380	AT3G01130.1	AT3G01130.1 (homolog to also unknown At5g15320)	uncharacterised	h) uncharacterised	extracellular	265	712.40	1422.78	712.40	1422.79	2	-3.76	21.9	110673	96	4	20 - 33	R.ASAFGLGLIYGNIK.L
1380	AT3G01130.1	AT3G01130.1 (homolog to also unknown At5g15320)	uncharacterised	h) uncharacterised	extracellular	232	591.00	1769.96	591.00	1769.97	3	-1.52	19.5	38802	70	3	2 - 19	M.APPPGLYSGTSTLALVAR.A
1380	AT3G01130.1	AT3G01130.1 (homolog to also unknown At5g15320)	uncharacterised	h) uncharacterised	extracellular	268	712.40	1422.78	712.40	1422.79	2	-4.36	21.9	44451	81	4	20 - 33	R.ASAFGLGLIYGNIK.L
1380	AT3G01130.1	AT3G01130.1 (homolog to also unknown At5g15320)	uncharacterised	h) uncharacterised	extracellular	230	591.00	1769.96	591.00	1769.97	3	-1.52	19.4	6609	76	3	2 - 19	M.APPPGLYSGTSTLALVAR.A
1380	AT3G01130.1	AT3G01130.1 (homolog to also unknown At5g15320)	uncharacterised	h) uncharacterised	extracellular	261	712.40	1422.78	712.40	1422.79	2	-7.22	21.8	6470	85	4	20 - 33	R.ASAFGLGLIYGNIK.L
1380	AT3G01130.1	AT3G01130.1 (homolog to also unknown At5g15320)	uncharacterised	h) uncharacterised	extracellular	262	712.40	1422.78	712.40	1422.79	2	-4.09	21.8	32567	78	4	20 - 33	R.ASAFGLGLIYGNIK.L
1438	AT3G01130.1	AT3G01130.1 (homolog to also unknown At5g15320)	uncharacterised	h) uncharacterised	extracellular	231	712.40	1422.78	712.40	1422.79	2	-2.75	21.7	19872	92	4	20 - 33	R.ASAFGLGLIYGNIK.L
1438	AT3G01130.1	AT3G01130.1 (homolog to also unknown At5g15320)	uncharacterised	h) uncharacterised	extracellular	233	712.40	1422.78	712.40	1422.79	2	-4.42	21.7	10393	54	4	20 - 33	R.ASAFGLGLIYGNIK.L
1438	AT3G01130.1	AT3G01130.1 (homolog to also unknown At5g15320)	uncharacterised	h) uncharacterised	extracellular	230	712.40	1422.78	712.40	1422.79	2	-4.32	21.6	15585	86	4	20 - 33	R.ASAFGLGLIYGNIK.L
1438	AT3G01130.1	AT3G01130.1 (homolog to also unknown At5g15320)	uncharacterised	h) uncharacterised	extracellular	210	590.99	1769.96	591.00	1769.97	3	-2.88	19.3	16221	68	3	2 - 19	M.APPPGLYSGTSTLALVAR.A
1438	AT3G01130.1	AT3G01130.1 (homolog to also unknown At5g15320)	uncharacterised	h) uncharacterised	extracellular	229	712.40	1422.78	712.40	1422.79	2	-5.39	21.6	7143	79	4	20 - 33	R.ASAFGLGLIYGNIK.L
1438	AT3G01130.1	AT3G01130.1 (homolog to also unknown At5g15320)	uncharacterised	h) uncharacterised	extracellular	214	590.99	1769.96	591.00	1769.97	3	-3.32	19.4	8713	49	3	2 - 19	M.APPPGLYSGTSTLALVAR.A
1438	AT3G01130.1	AT3G01130.1 (homolog to also unknown At5g15320)	uncharacterised	h) uncharacterised	extracellular	208	590.99	1769.96	591.00	1769.97	3	-3.22	19.2	5400	51	3	2 - 19	M.APPPGLYSGTSTLALVAR.A
1377	AT3G07568.1	At3g07568	uncharacterized	h) uncharacterized	NEW mitochondria	147	967.44	1932.86	967.44	1932.87	2	-6.55	15.9	4663	63	2	50 - 68	R.VSGLESGGYENPNPAQVES.-
1377	AT3G07568.1	At3g07568	uncharacterized	h) uncharacterized	NEW mitochondria	40	457.71	913.41	457.72	913.42	2	-8.73	12.7	7395	49	1	33 - 40	R.FAISSDMK.E	Oxidation: 7
1377	AT3G07568.1	At3g07568	uncharacterized	h) uncharacterized	NEW mitochondria	149	967.44	1932.86	967.44	1932.87	2	-3.85	16	4258	31	2	50 - 68	R.VSGLESGGYENPNPAQVES.-
1388	AT3G28700.1	AT3G28700	uncharacterised	h) uncharacterised	mitochondrion	294	527.31	1052.60	527.31	1052.60	2	0.04	16.8	3913	58	2	154 - 163	R.VNLVELGPGR.G
1388	AT3G28700.1	AT3G28700	uncharacterised	h) uncharacterised	mitochondrion	118	433.54	1297.60	433.54	1297.60	3	1.44	12.8	7594	32	1	266 - 276	K.MVDVGEDSKFR.F	Oxidation: 1
1388	AT3G28700.1	AT3G28700	uncharacterised	h) uncharacterised	mitochondrion	298	527.30	1052.59	527.31	1052.60	2	-3.35	16.9	39365	19	2	154 - 163	R.VNLVELGPGR.G
1388	AT3G28700.1	AT3G28700	uncharacterised	h) uncharacterised	mitochondrion	95	437.70	873.38	437.70	873.38	2	2.22	12.2	6041	20	1	108 - 114	K.AGFYMNR.D	Oxidation: 5
1450	AT3G47630.1	At3g47630	uncharacterized	h) uncharacterized	NEW mitochondria	344	558.32	1114.63	558.32	1114.63	2	-3.06	16.7	7103	30	1	231 - 241	R.SLVSSLPASVR.S
1450	AT3G47630.1	At3g47630	uncharacterized	h) uncharacterized	NEW mitochondria	574	719.71	2156.10	719.71	2156.09	3	0.96	21.9	6077	43	2	291 - 311	R.QAVSGFLAAGAINATMYLSQK.M	Oxidation: 16
1450	AT3G47630.1	At3g47630	uncharacterized	h) uncharacterized	NEW mitochondria	557	634.40	1266.78	634.40	1266.79	2	-6.08	21.5	16997	88	1	138 - 150	R.AAISAALLLLPSK.F
1450	AT3G47630.1	At3g47630	uncharacterized	h) uncharacterized	NEW mitochondria	131	437.25	872.49	437.26	872.50	2	-7.26	11.9	12726	40	2	64 - 71	R.LITNVADK.V
1450	AT3G47630.1	At3g47630	uncharacterized	h) uncharacterized	NEW mitochondria	575	719.71	2156.09	719.71	2156.09	3	-0.04	22	5055	45	2	291 - 311	R.QAVSGFLAAGAINATMYLSQK.M	Oxidation: 16
1450	AT3G47630.1	At3g47630	uncharacterized	h) uncharacterized	NEW mitochondria	128	437.25	872.49	437.26	872.50	2	-7.42	11.8	37659	50	2	64 - 71	R.LITNVADK.V
373	AT4G00585.1	At4g00585 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	9	475.87	1424.58	475.87	1424.58	3	0.02	10.1	14860	44	2	2 - 16	M.GGGDHGHGAEGGDFR.A
373	AT4G00585.1	At4g00585 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	43	502.57	1504.69	502.57	1504.69	3	2.01	12.7	6441	33	1	19 - 31	K.VWSMTGGPNCRPK.H	Oxidation: 4
373	AT4G00585.1	At4g00585 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	11	475.87	1424.58	475.87	1424.58	3	0.27	10.2	15659	34	2	2 - 16	M.GGGDHGHGAEGGDFR.A
1367	AT4G05590.1	At4g05590	uncharacterised	h) uncharacterised	mitochondrion	284	624.33	1246.65	624.33	1246.65	2	0.58	18.9	20696	58	2	18 - 27	K.TIHFWAPTFK.W
1367	AT4G05590.1	At4g05590	uncharacterised	h) uncharacterised	mitochondrion	149	444.58	1330.71	444.58	1330.71	3	-1.28	14.6	20003	48	4	6 - 17	K.LQALWNHPAGPK.T
1367	AT4G05590.1	At4g05590	uncharacterised	h) uncharacterised	mitochondrion	282	624.33	1246.65	624.33	1246.65	2	0.97	18.9	16710	58	2	18 - 27	K.TIHFWAPTFK.W
1367	AT4G05590.1	At4g05590	uncharacterised	h) uncharacterised	mitochondrion	283	416.56	1246.65	416.56	1246.65	3	0.59	18.9	173490	37	3	18 - 27	K.TIHFWAPTFK.W
1367	AT4G05590.1	At4g05590	uncharacterised	h) uncharacterised	mitochondrion	158	444.58	1330.71	444.58	1330.71	3	-1.22	14.8	8404	41	4	6 - 17	K.LQALWNHPAGPK.T
1367	AT4G05590.1	At4g05590	uncharacterised	h) uncharacterised	mitochondrion	155	666.36	1330.71	666.36	1330.71	2	-0.07	14.7	5005	34	2	6 - 17	K.LQALWNHPAGPK.T
1367	AT4G05590.1	At4g05590	uncharacterised	h) uncharacterised	mitochondrion	288	416.56	1246.65	416.56	1246.65	3	-0.37	19	7949	22	3	18 - 27	K.TIHFWAPTFK.W
1367	AT4G05590.1	At4g05590	uncharacterised	h) uncharacterised	mitochondrion	153	444.58	1330.71	444.58	1330.71	3	-0.07	14.7	6223	44	4	6 - 17	K.LQALWNHPAGPK.T
1367	AT4G05590.1	At4g05590	uncharacterised	h) uncharacterised	mitochondrion	150	444.58	1330.71	444.58	1330.71	3	0.09	14.7	3720	54	4	6 - 17	K.LQALWNHPAGPK.T
1367	AT4G05590.1	At4g05590	uncharacterised	h) uncharacterised	mitochondrion	73	454.76	907.50	454.76	907.50	2	-5.82	12.6	4587	54	2	63 - 70	R.YSTVITPK.N
1367	AT4G05590.1	At4g05590	uncharacterised	h) uncharacterised	mitochondrion	75	454.76	907.50	454.76	907.50	2	-5.78	12.6	19503	54	2	63 - 70	R.YSTVITPK.N
1367	AT4G05590.1	At4g05590	uncharacterised	h) uncharacterised	mitochondrion	280	416.56	1246.65	416.56	1246.65	3	0.97	18.9	4473	31	3	18 - 27	K.TIHFWAPTFK.W
1367	AT4G05590.1	At4g05590	uncharacterised	h) uncharacterised	mitochondrion	152	666.36	1330.71	666.36	1330.71	2	0.09	14.7	3711	46	2	6 - 17	K.LQALWNHPAGPK.T
1427	AT4G05590.1	At4g05590	uncharacterised	h) uncharacterised	mitochondrion	265	416.56	1246.65	416.56	1246.65	3	0.51	18.8	28595	43	3	18 - 27	K.TIHFWAPTFK.W
1427	AT4G05590.1	At4g05590	uncharacterised	h) uncharacterised	mitochondrion	270	624.33	1246.65	624.33	1246.65	2	-0.59	18.9	5964	35	2	18 - 27	K.TIHFWAPTFK.W
1427	AT4G05590.1	At4g05590	uncharacterised	h) uncharacterised	mitochondrion	140	666.37	1330.72	666.36	1330.71	2	2.42	14.6	29523	55	3	6 - 17	K.LQALWNHPAGPK.T
1427	AT4G05590.1	At4g05590	uncharacterised	h) uncharacterised	mitochondrion	60	454.76	907.50	454.76	907.50	2	-5.32	12.6	17043	44	2	63 - 70	R.YSTVITPK.N
1427	AT4G05590.1	At4g05590	uncharacterised	h) uncharacterised	mitochondrion	266	624.33	1246.65	624.33	1246.65	2	0.50	18.8	11336	55	2	18 - 27	K.TIHFWAPTFK.W
1427	AT4G05590.1	At4g05590	uncharacterised	h) uncharacterised	mitochondrion	135	444.58	1330.72	444.58	1330.71	3	2.67	14.5	16874	61	3	6 - 17	K.LQALWNHPAGPK.T
1427	AT4G05590.1	At4g05590	uncharacterised	h) uncharacterised	mitochondrion	136	666.37	1330.72	666.36	1330.71	2	2.67	14.5	82952	59	3	6 - 17	K.LQALWNHPAGPK.T
1427	AT4G05590.1	At4g05590	uncharacterised	h) uncharacterised	mitochondrion	134	444.58	1330.72	444.58	1330.71	3	6.63	14.5	66440	46	3	6 - 17	K.LQALWNHPAGPK.T
1427	AT4G05590.1	At4g05590	uncharacterised	h) uncharacterised	mitochondrion	138	444.58	1330.72	444.58	1330.71	3	2.43	14.6	63100	45	3	6 - 17	K.LQALWNHPAGPK.T
1427	AT4G05590.1	At4g05590	uncharacterised	h) uncharacterised	mitochondrion	62	454.76	907.50	454.76	907.50	2	-4.15	12.6	23932	54	2	63 - 70	R.YSTVITPK.N
1427	AT4G05590.1	At4g05590	uncharacterised	h) uncharacterised	mitochondrion	264	416.56	1246.65	416.56	1246.65	3	-2.78	18.8	7551	34	3	18 - 27	K.TIHFWAPTFK.W
1427	AT4G05590.1	At4g05590	uncharacterised	h) uncharacterised	mitochondrion	142	666.37	1330.72	666.36	1330.71	2	0.74	14.6	20338	34	3	6 - 17	K.LQALWNHPAGPK.T
1427	AT4G05590.1	At4g05590	uncharacterised	h) uncharacterised	mitochondrion	269	416.56	1246.65	416.56	1246.65	3	-0.59	18.9	5860	39	3	18 - 27	K.TIHFWAPTFK.W
156	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	75	535.95	1604.82	535.95	1604.83	3	-9.82	14.4	14267	39	3	11 - 24	K.AQYPVVDRNPAFTK.V
156	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	197	901.92	1801.82	901.92	1801.83	2	-7.48	19.8	12503	64	2	85 - 100	R.LMGFFPNDGEVASYQK.R
156	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	51	474.24	946.47	474.25	946.49	2	-13.56	12.8	17008	57	8	11 - 18	K.AQYPVVDR.N
156	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	53	474.24	946.47	474.25	946.49	2	-14.74	12.9	15312	44	8	11 - 18	K.AQYPVVDR.N
156	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	198	601.61	1801.82	601.62	1801.83	3	-7.47	19.8	4668	70	1	85 - 100	R.LMGFFPNDGEVASYQK.R
156	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	192	692.36	1382.71	692.37	1382.72	2	-7.78	19.5	45415	91	4	25 - 36	K.VVGNFSTLDYLR.F
156	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	176	606.95	1817.82	606.95	1817.83	3	-7.38	18.4	19773	81	2	85 - 100	R.LMGFFPNDGEVASYQK.R	Oxidation: 2
156	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	46	474.24	946.47	474.25	946.49	2	-14.64	12.6	4533	55	8	11 - 18	K.AQYPVVDR.N
156	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	129	597.28	1192.55	597.29	1192.56	2	-8.09	16.4	77862	70	3	1 - 10	-.MNTDITALEK.A	Acetyl: 1
156	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	194	692.36	1382.71	692.37	1382.72	2	-7.20	19.5	131675	97	4	25 - 36	K.VVGNFSTLDYLR.F
156	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	184	589.29	1176.56	589.29	1176.57	2	-6.12	18.9	4504	46	1	1 - 10	-.MNTDITALEK.A	Acetyl: 1
156	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	134	597.28	1192.55	597.29	1192.56	2	-8.76	16.5	16772	52	3	1 - 10	-.MNTDITALEK.A	Acetyl: 1
156	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	175	909.92	1817.82	909.92	1817.83	2	-7.38	18.4	31607	70	2	85 - 100	R.LMGFFPNDGEVASYQK.R	Oxidation: 2
156	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	204	746.76	2237.25	746.76	2237.27	3	-7.34	22.2	13200	38	3	37 - 58	R.FSTITGISVTVGYLSGIKPGIK.G
156	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	126	597.28	1192.55	597.29	1192.56	2	-8.33	16.3	6198	71	3	1 - 10	-.MNTDITALEK.A	Acetyl: 1
156	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	178	909.92	1817.82	909.92	1817.83	2	-7.68	18.4	25923	46	2	85 - 100	R.LMGFFPNDGEVASYQK.R	Oxidation: 2
156	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	50	474.24	946.47	474.25	946.49	2	-14.59	12.8	16570	69	8	11 - 18	K.AQYPVVDR.N
156	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	191	692.36	1382.70	692.37	1382.72	2	-13.00	19.4	3660	102	4	25 - 36	K.VVGNFSTLDYLR.F
156	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	203	746.76	2237.25	746.76	2237.27	3	-8.24	22.2	4282	42	3	37 - 58	R.FSTITGISVTVGYLSGIKPGIK.G
156	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	206	746.76	2237.25	746.76	2237.27	3	-6.53	22.3	6965	24	3	37 - 58	R.FSTITGISVTVGYLSGIKPGIK.G
156	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	179	606.95	1817.82	606.95	1817.83	3	-7.66	18.5	15437	72	2	85 - 100	R.LMGFFPNDGEVASYQK.R	Oxidation: 2
156	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	48	474.24	946.47	474.25	946.49	2	-14.11	12.7	10101	50	8	11 - 18	K.AQYPVVDR.N
156	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	47	474.24	946.47	474.25	946.49	2	-15.61	12.7	6947	47	8	11 - 18	K.AQYPVVDR.N
156	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	77	535.95	1604.81	535.95	1604.83	3	-10.16	14.5	43541	43	3	11 - 24	K.AQYPVVDRNPAFTK.V
156	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	152	658.98	1973.92	658.98	1973.93	3	-6.97	17.2	4242	52	2	85 - 101	R.LMGFFPNDGEVASYQKR.G	Oxidation: 2
156	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	80	535.95	1604.81	535.95	1604.83	3	-10.79	14.6	79383	35	3	11 - 24	K.AQYPVVDRNPAFTK.V
156	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	199	901.92	1801.82	901.92	1801.83	2	-6.90	19.9	10756	51	2	85 - 100	R.LMGFFPNDGEVASYQK.R
156	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	195	692.36	1382.71	692.37	1382.72	2	-7.57	19.6	71986	98	4	25 - 36	K.VVGNFSTLDYLR.F
156	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	153	658.98	1973.91	658.98	1973.93	3	-8.64	17.3	5042	32	2	85 - 101	R.LMGFFPNDGEVASYQKR.G	Oxidation: 2
156	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	49	474.24	946.47	474.25	946.49	2	-15.80	12.8	13679	50	8	11 - 18	K.AQYPVVDR.N
156	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	52	474.24	946.47	474.25	946.49	2	-14.91	12.9	19829	69	8	11 - 18	K.AQYPVVDR.N
235	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	137	535.94	1604.81	535.95	1604.83	3	-12.45	14.284425	47266	40	3	11 - 24	K.AQYPVVDRNPAFTK.V
235	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	244	909.91	1817.81	909.92	1817.83	2	-9.45	18.228375	34627	76	2	85 - 100	R.LMGFFPNDGEVASYQK.R	Oxidation: 2
235	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	279	901.92	1801.82	901.92	1801.83	2	-10.13	19.76553333	11689	34	2	85 - 100	R.LMGFFPNDGEVASYQK.R
235	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	140	535.94	1604.81	535.95	1604.83	3	-11.52	14.37854167	91225	39	3	11 - 24	K.AQYPVVDRNPAFTK.V
235	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	89	474.25	946.48	474.25	946.49	2	-10.95	12.65716667	17206	55	2	11 - 18	K.AQYPVVDR.N
235	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	190	597.28	1192.55	597.29	1192.56	2	-9.63	16.2768	55100	61	2	1 - 10	-.MNTDITALEK.A	Acetyl: 1
235	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	276	901.92	1801.82	901.92	1801.83	2	-10.35	19.67151667	9713	44	2	85 - 100	R.LMGFFPNDGEVASYQK.R
235	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	245	606.94	1817.81	606.95	1817.83	3	-9.43	18.24175833	27812	59	2	85 - 100	R.LMGFFPNDGEVASYQK.R	Oxidation: 2
235	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	280	601.61	1801.82	601.62	1801.83	3	-10.11	19.77891667	5347	48	2	85 - 100	R.LMGFFPNDGEVASYQK.R
235	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	270	461.91	1382.71	461.91	1382.72	3	-7.90	19.428625	4134	52	1	25 - 36	K.VVGNFSTLDYLR.F
235	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	87	474.25	946.48	474.25	946.49	2	-12.21	12.57653333	17523	44	2	11 - 18	K.AQYPVVDR.N
235	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	134	535.94	1604.81	535.95	1604.83	3	-12.82	14.19031667	18103	32	3	11 - 24	K.AQYPVVDRNPAFTK.V
235	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	215	658.98	1973.91	658.98	1973.93	3	-10.21	17.110575	5929	39	1	85 - 101	R.LMGFFPNDGEVASYQKR.G	Oxidation: 2
235	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	269	692.36	1382.71	692.37	1382.72	2	-7.92	19.41524167	112214	87	3	25 - 36	K.VVGNFSTLDYLR.F
235	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	271	692.36	1382.71	692.37	1382.72	2	-10.38	19.48246667	32748	66	3	25 - 36	K.VVGNFSTLDYLR.F
235	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	267	692.36	1382.71	692.37	1382.72	2	-8.64	19.34798333	59641	89	3	25 - 36	K.VVGNFSTLDYLR.F
235	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	248	606.95	1817.81	606.95	1817.83	3	-8.60	18.33578333	13454	37	2	85 - 100	R.LMGFFPNDGEVASYQK.R	Oxidation: 2
235	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	277	601.61	1801.82	601.62	1801.83	3	-10.28	19.6849	5806	66	2	85 - 100	R.LMGFFPNDGEVASYQK.R
235	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	187	597.28	1192.55	597.29	1192.56	2	-9.97	16.18279167	47403	69	2	1 - 10	-.MNTDITALEK.A	Acetyl: 1
235	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	247	909.91	1817.81	909.92	1817.83	2	-8.57	18.32239167	15452	27	2	85 - 100	R.LMGFFPNDGEVASYQK.R	Oxidation: 2
374	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	122	803.42	1604.84	803.42	1604.83	2	2.44	16.3	72377	44	3	11 - 24	K.AQYPVVDRNPAFTK.V
374	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	269	901.93	1801.84	901.92	1801.83	2	2.82	21.7	62094	100	3	85 - 100	R.LMGFFPNDGEVASYQK.R
374	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	270	601.62	1801.84	601.62	1801.83	3	2.82	21.7	9605	73	2	85 - 100	R.LMGFFPNDGEVASYQK.R
374	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	117	535.95	1604.84	535.95	1604.83	3	3.13	16.1	15560	38	3	11 - 24	K.AQYPVVDRNPAFTK.V
374	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	265	692.37	1382.73	692.37	1382.72	2	4.27	21.5	125287	76	8	25 - 36	K.VVGNFSTLDYLR.F
374	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	287	746.76	2237.27	746.76	2237.27	3	1.33	24.1	14223	59	2	37 - 58	R.FSTITGISVTVGYLSGIKPGIK.G
374	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	29	677.36	676.36	677.36	676.35	1	4.80	11.4	7168	38	3	19 - 24	R.NPAFTK.V
374	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	186	1193.58	1192.57	1193.57	1192.56	1	3.11	18.3	75887	22	2	1 - 10	-.MNTDITALEK.A	Acetyl: 1
374	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	246	589.29	1176.57	589.29	1176.57	2	3.74	20.8	12749	57	1	1 - 10	-.MNTDITALEK.A	Acetyl: 1
374	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	183	1193.57	1192.57	1193.57	1192.56	1	1.32	18.2	42977	70	2	1 - 10	-.MNTDITALEK.A	Acetyl: 1
374	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	259	692.37	1382.72	692.37	1382.72	2	2.64	21.3	9154	84	8	25 - 36	K.VVGNFSTLDYLR.F
374	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	286	746.77	2237.27	746.76	2237.27	3	3.01	24.1	5544	63	2	37 - 58	R.FSTITGISVTVGYLSGIKPGIK.G
374	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	121	535.95	1604.84	535.95	1604.83	3	2.44	16.3	167824	45	3	11 - 24	K.AQYPVVDRNPAFTK.V
374	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	185	597.29	1192.57	597.29	1192.56	2	3.11	18.3	97403	76	2	1 - 10	-.MNTDITALEK.A	Acetyl: 1
374	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	280	692.86	1383.71	692.37	1382.72	2	715.79	22.8	4960	43	8	25 - 36	K.VVGNFSTLDYLR.F
374	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	234	653.65	1957.94	653.65	1957.94	3	1.92	20.4	10783	24	2	85 - 101	R.LMGFFPNDGEVASYQKR.G
374	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	78	474.25	946.49	474.25	946.49	2	0.14	14.3	26961	60	4	11 - 18	K.AQYPVVDR.N
374	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	264	692.37	1382.73	692.37	1382.72	2	5.31	21.5	239147	83	8	25 - 36	K.VVGNFSTLDYLR.F
374	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	205	658.99	1973.93	658.98	1973.93	3	2.21	19	4927	58	3	85 - 101	R.LMGFFPNDGEVASYQKR.G	Oxidation: 2
374	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	74	474.25	946.49	474.25	946.49	2	-2.15	14.1	3937	46	4	11 - 18	K.AQYPVVDR.N
374	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	233	653.65	1957.94	653.65	1957.94	3	0.74	20.4	10723	52	2	85 - 101	R.LMGFFPNDGEVASYQKR.G
374	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	231	606.95	1817.84	606.95	1817.83	3	3.34	20.3	27351	50	2	85 - 100	R.LMGFFPNDGEVASYQK.R	Oxidation: 2
374	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	281	692.86	1383.71	692.37	1382.72	2	716.31	22.9	10113	30	8	25 - 36	K.VVGNFSTLDYLR.F
374	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	261	692.37	1382.73	692.37	1382.72	2	6.05	21.4	348189	88	8	25 - 36	K.VVGNFSTLDYLR.F
374	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	230	909.93	1817.84	909.92	1817.83	2	3.35	20.3	107685	91	3	85 - 100	R.LMGFFPNDGEVASYQK.R	Oxidation: 2
374	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	271	901.93	1801.84	901.92	1801.83	2	2.93	21.8	63690	65	3	85 - 100	R.LMGFFPNDGEVASYQK.R
374	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	227	909.92	1817.83	909.92	1817.83	2	2.85	20.2	81867	90	3	85 - 100	R.LMGFFPNDGEVASYQK.R	Oxidation: 2
374	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	237	692.37	1382.72	692.37	1382.72	2	1.14	20.5	6923	49	8	25 - 36	K.VVGNFSTLDYLR.F
374	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	182	597.29	1192.57	597.29	1192.56	2	1.32	18.2	66316	70	2	1 - 10	-.MNTDITALEK.A	Acetyl: 1
374	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	120	803.42	1604.84	803.42	1604.83	2	2.69	16.2	35072	49	3	11 - 24	K.AQYPVVDRNPAFTK.V
374	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	31	677.36	676.36	677.36	676.35	1	3.69	11.5	11448	43	3	19 - 24	R.NPAFTK.V
374	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	206	658.99	1973.94	658.98	1973.93	3	4.42	19	17792	62	3	85 - 101	R.LMGFFPNDGEVASYQKR.G	Oxidation: 2
374	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	86	474.25	946.49	474.25	946.49	2	0.69	14.5	20981	43	4	11 - 18	K.AQYPVVDR.N
374	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	240	909.92	1817.82	909.92	1817.83	2	-4.05	20.6	5392	30	3	85 - 100	R.LMGFFPNDGEVASYQK.R	Oxidation: 2
374	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	207	658.99	1973.94	658.98	1973.93	3	2.69	19	20273	38	3	85 - 101	R.LMGFFPNDGEVASYQKR.G	Oxidation: 2
374	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	229	606.95	1817.83	606.95	1817.83	3	2.85	20.2	21181	68	2	85 - 100	R.LMGFFPNDGEVASYQK.R	Oxidation: 2
374	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	34	677.36	676.36	677.36	676.35	1	2.70	11.6	8546	30	3	19 - 24	R.NPAFTK.V
374	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	235	692.37	1382.72	692.37	1382.72	2	-0.35	20.4	3866	41	8	25 - 36	K.VVGNFSTLDYLR.F
374	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	76	474.25	946.49	474.25	946.49	2	-1.06	14.2	12542	54	4	11 - 18	K.AQYPVVDR.N
374	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	125	803.43	1604.84	803.42	1604.83	2	2.72	16.4	79246	35	3	11 - 24	K.AQYPVVDRNPAFTK.V
374	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	268	901.93	1801.84	901.92	1801.83	2	2.50	21.6	4462	95	3	85 - 100	R.LMGFFPNDGEVASYQK.R
374	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	119	535.95	1604.84	535.95	1604.83	3	2.68	16.2	70581	31	3	11 - 24	K.AQYPVVDRNPAFTK.V
374	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	272	601.62	1801.84	601.62	1801.83	3	2.92	21.8	9837	77	2	85 - 100	R.LMGFFPNDGEVASYQK.R
433	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	137	692.38	1382.74	692.37	1382.72	2	16.40	21.3	6869	60	4	25 - 36	K.VVGNFSTLDYLR.F
433	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	16	474.26	946.50	474.25	946.49	2	11.66	14.1	7479	37	4	11 - 18	K.AQYPVVDR.N
433	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	126	606.96	1817.86	606.95	1817.83	3	16.01	20.2	4434	46	1	85 - 100	R.LMGFFPNDGEVASYQK.R	Oxidation: 2
433	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	122	909.94	1817.86	909.92	1817.83	2	14.77	20.1	8565	20	2	85 - 100	R.LMGFFPNDGEVASYQK.R	Oxidation: 2
433	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	18	474.26	946.50	474.25	946.49	2	10.77	14.1	9153	19	4	11 - 18	K.AQYPVVDR.N
433	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	19	474.26	946.50	474.25	946.49	2	9.17	14.2	9710	32	4	11 - 18	K.AQYPVVDR.N
433	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	142	901.94	1801.87	901.92	1801.83	2	17.09	21.6	3595	47	2	85 - 100	R.LMGFFPNDGEVASYQK.R
433	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	52	535.96	1604.85	535.95	1604.83	3	13.28	16.2	33728	27	3	11 - 24	K.AQYPVVDRNPAFTK.V
433	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	94	597.30	1192.58	597.29	1192.56	2	13.52	18	19069	78	2	1 - 10	-.MNTDITALEK.A	Acetyl: 1
433	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	17	474.26	946.50	474.25	946.49	2	9.57	14.1	8621	30	4	11 - 18	K.AQYPVVDR.N
433	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	47	535.96	1604.85	535.95	1604.83	3	13.35	16.1	14864	28	3	11 - 24	K.AQYPVVDRNPAFTK.V
433	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	125	909.94	1817.86	909.92	1817.83	2	16.03	20.2	14256	33	2	85 - 100	R.LMGFFPNDGEVASYQK.R	Oxidation: 2
433	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	138	692.38	1382.74	692.37	1382.72	2	16.69	21.3	28774	102	4	25 - 36	K.VVGNFSTLDYLR.F
433	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	50	535.96	1604.85	535.95	1604.83	3	12.98	16.2	33007	28	3	11 - 24	K.AQYPVVDRNPAFTK.V
433	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	97	597.30	1192.58	597.29	1192.56	2	13.05	18.1	9105	57	2	1 - 10	-.MNTDITALEK.A	Acetyl: 1
433	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	139	692.38	1382.74	692.37	1382.72	2	16.55	21.3	49972	78	4	25 - 36	K.VVGNFSTLDYLR.F
433	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	143	901.94	1801.87	901.92	1801.83	2	17.69	21.6	5975	41	2	85 - 100	R.LMGFFPNDGEVASYQK.R
433	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	141	692.38	1382.74	692.37	1382.72	2	14.99	21.4	26932	65	4	25 - 36	K.VVGNFSTLDYLR.F
494	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	75	597.28	1192.55	597.29	1192.56	2	-11.63	18.2	4262	43	1	1 - 10	-.MNTDITALEK.A	Acetyl: 1
494	AT4G16450.1	At4g16450 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	112	692.36	1382.71	692.37	1382.72	2	-9.57	21.4	4373	23	1	25 - 36	K.VVGNFSTLDYLR.F
164	AT4G20150.1	At4g20150 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	27	480.19	958.36	480.19	958.37	2	-11.80	11.9	27619	36	4	75 - 81	R.YFDEDRD.-
164	AT4G20150.1	At4g20150 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	26	480.19	958.36	480.19	958.37	2	-11.53	11.8	6147	36	4	75 - 81	R.YFDEDRD.-
164	AT4G20150.1	At4g20150 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	80	645.85	1289.68	645.85	1289.69	2	-10.64	14.8	13969	48	1	56 - 66	K.LKEDLDVMLAK.A	Oxidation: 8
164	AT4G20150.1	At4g20150 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	29	480.18	958.35	480.19	958.37	2	-12.88	12	28169	33	4	75 - 81	R.YFDEDRD.-
164	AT4G20150.1	At4g20150 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	28	480.18	958.35	480.19	958.37	2	-13.30	11.9	43197	37	4	75 - 81	R.YFDEDRD.-
240	AT4G20150.1	At4g20150 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	67	480.18	958.35	480.19	958.37	2	-14.57	11.95958333	32139	39	2	75 - 81	R.YFDEDRD.-
240	AT4G20150.1	At4g20150 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	130	645.84	1289.67	645.85	1289.69	2	-12.73	14.711475	5797	34	2	56 - 66	K.LKEDLDVMLAK.A	Oxidation: 8
240	AT4G20150.1	At4g20150 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	131	430.90	1289.67	430.90	1289.69	3	-12.70	14.72485833	5853	20	1	56 - 66	K.LKEDLDVMLAK.A	Oxidation: 8
240	AT4G20150.1	At4g20150 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	178	637.85	1273.68	637.85	1273.70	2	-13.90	16.39288333	6196	35	1	56 - 66	K.LKEDLDVMLAK.A
240	AT4G20150.1	At4g20150 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	68	480.18	958.35	480.19	958.37	2	-14.36	12.00005	41009	37	2	75 - 81	R.YFDEDRD.-
240	AT4G20150.1	At4g20150 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	134	645.85	1289.68	645.85	1289.69	2	-10.72	14.81885	7455	32	2	56 - 66	K.LKEDLDVMLAK.A	Oxidation: 8
379	AT4G20150.1	At4g20150 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	324	799.41	2395.20	799.42	2395.22	3	-9.43	24.9	8607	16	3	2 - 24	M.PISATMVGALLGLGTQMYSNALR.K	Oxidation: 6
379	AT4G20150.1	At4g20150 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	142	430.90	1289.68	430.90	1289.69	3	-8.08	16.8	12781	40	2	56 - 66	K.LKEDLDVMLAK.A	Oxidation: 8
379	AT4G20150.1	At4g20150 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	293	763.73	2288.17	763.74	2288.19	3	-10.00	23.2	6479	75	2	31 - 51	R.HPWEHVVGMGLGAVFANQLVK.W
379	AT4G20150.1	At4g20150 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	273	769.06	2304.16	769.07	2304.18	3	-10.25	22	40379	94	2	31 - 51	R.HPWEHVVGMGLGAVFANQLVK.W	Oxidation: 9
379	AT4G20150.1	At4g20150 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	192	637.85	1273.69	637.85	1273.70	2	-6.93	18.4	30130	61	1	56 - 66	K.LKEDLDVMLAK.A
379	AT4G20150.1	At4g20150 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	268	746.13	2980.49	746.14	2980.52	4	-11.06	21.8	2740	16	1	26 - 51	K.LPYMRHPWEHVVGMGLGAVFANQLVK.W	Oxidation: 4
379	AT4G20150.1	At4g20150 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	47	412.22	822.43	412.23	822.44	2	-12.41	12.7	10123	25	2	25 - 30	R.KLPYMR.H	Oxidation: 5
379	AT4G20150.1	At4g20150 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	296	763.73	2288.17	763.74	2288.19	3	-9.47	23.3	10548	72	2	31 - 51	R.HPWEHVVGMGLGAVFANQLVK.W
379	AT4G20150.1	At4g20150 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	276	769.06	2304.16	769.07	2304.18	3	-10.13	22.1	38735	55	2	31 - 51	R.HPWEHVVGMGLGAVFANQLVK.W	Oxidation: 9
379	AT4G20150.1	At4g20150 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	86	404.23	806.44	404.23	806.45	2	-11.69	14.7	6944	35	1	25 - 30	R.KLPYMR.H
379	AT4G20150.1	At4g20150 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	274	577.05	2304.16	577.05	2304.18	4	-10.25	22	34428	68	2	31 - 51	R.HPWEHVVGMGLGAVFANQLVK.W	Oxidation: 9
379	AT4G20150.1	At4g20150 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	317	799.41	2395.20	799.42	2395.22	3	-10.55	24.7	6676	37	3	2 - 24	M.PISATMVGALLGLGTQMYSNALR.K	Oxidation: 6
379	AT4G20150.1	At4g20150 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	140	645.85	1289.68	645.85	1289.69	2	-8.08	16.8	36924	68	2	56 - 66	K.LKEDLDVMLAK.A	Oxidation: 8
379	AT4G20150.1	At4g20150 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	314	799.41	2395.20	799.42	2395.22	3	-10.57	24.6	12882	91	3	2 - 24	M.PISATMVGALLGLGTQMYSNALR.K	Oxidation: 6
379	AT4G20150.1	At4g20150 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	60	480.19	958.36	480.19	958.37	2	-6.74	13.5	5131	36	3	75 - 81	R.YFDEDRD.-
379	AT4G20150.1	At4g20150 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	139	430.90	1289.68	430.90	1289.69	3	-8.41	16.7	20853	51	2	56 - 66	K.LKEDLDVMLAK.A	Oxidation: 8
379	AT4G20150.1	At4g20150 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	46	412.22	822.43	412.23	822.44	2	-12.48	12.6	8515	20	2	25 - 30	R.KLPYMR.H	Oxidation: 5
379	AT4G20150.1	At4g20150 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	64	480.19	958.36	480.19	958.37	2	-7.99	13.7	91619	35	3	75 - 81	R.YFDEDRD.-
379	AT4G20150.1	At4g20150 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	61	480.19	958.36	480.19	958.37	2	-8.76	13.6	35775	29	3	75 - 81	R.YFDEDRD.-
379	AT4G20150.1	At4g20150 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	277	577.05	2304.16	577.05	2304.18	4	-10.12	22.1	29752	40	2	31 - 51	R.HPWEHVVGMGLGAVFANQLVK.W	Oxidation: 9
379	AT4G20150.1	At4g20150 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	137	645.85	1289.68	645.85	1289.69	2	-8.41	16.7	56835	77	2	56 - 66	K.LKEDLDVMLAK.A	Oxidation: 8
379	AT4G20150.1	At4g20150 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	295	573.05	2288.17	573.05	2288.19	4	-10.00	23.2	2743	39	1	31 - 51	R.HPWEHVVGMGLGAVFANQLVK.W
440	AT4G20150.1	At4g20150 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	75	645.85	1289.68	645.85	1289.69	2	-7.77	16.6	20377	42	2	56 - 66	K.LKEDLDVMLAK.A	Oxidation: 8
440	AT4G20150.1	At4g20150 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	12	480.19	958.36	480.19	958.37	2	-6.32	13.2	22646	39	5	75 - 81	R.YFDEDRD.-
440	AT4G20150.1	At4g20150 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	14	480.19	958.36	480.19	958.37	2	-8.16	13.3	22106	33	5	75 - 81	R.YFDEDRD.-
440	AT4G20150.1	At4g20150 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	73	645.85	1289.68	645.85	1289.69	2	-8.77	16.5	11646	46	2	56 - 66	K.LKEDLDVMLAK.A	Oxidation: 8
440	AT4G20150.1	At4g20150 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	72	430.90	1289.68	430.90	1289.69	3	-8.76	16.5	14225	24	2	56 - 66	K.LKEDLDVMLAK.A	Oxidation: 8
440	AT4G20150.1	At4g20150 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	10	480.19	958.36	480.19	958.37	2	-7.97	13.1	3999	32	5	75 - 81	R.YFDEDRD.-
440	AT4G20150.1	At4g20150 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	11	480.19	958.36	480.19	958.37	2	-4.28	13.2	12847	39	5	75 - 81	R.YFDEDRD.-
440	AT4G20150.1	At4g20150 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	13	480.19	958.36	480.19	958.37	2	-8.47	13.3	27959	40	5	75 - 81	R.YFDEDRD.-
440	AT4G20150.1	At4g20150 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	76	430.90	1289.68	430.90	1289.69	3	-7.76	16.6	18974	17	2	56 - 66	K.LKEDLDVMLAK.A	Oxidation: 8
506	AT4G20150.1	At4g20150 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	4	480.19	958.37	480.19	958.37	2	-0.72	13.2	8766	39	5	75 - 81	R.YFDEDRD.-
506	AT4G20150.1	At4g20150 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	6	480.19	958.37	480.19	958.37	2	-0.66	13.3	12840	32	5	75 - 81	R.YFDEDRD.-
506	AT4G20150.1	At4g20150 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	5	480.19	958.37	480.19	958.37	2	0.86	13.3	15561	39	5	75 - 81	R.YFDEDRD.-
506	AT4G20150.1	At4g20150 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	7	480.19	958.37	480.19	958.37	2	1.63	13.4	9434	32	5	75 - 81	R.YFDEDRD.-
506	AT4G20150.1	At4g20150 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	57	645.85	1289.69	645.85	1289.69	2	-0.22	16.5	4695	32	1	56 - 66	K.LKEDLDVMLAK.A	Oxidation: 8
506	AT4G20150.1	At4g20150 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	3	480.19	958.37	480.19	958.37	2	2.86	13.2	3468	32	5	75 - 81	R.YFDEDRD.-
506	AT4G20150.1	At4g20150 (plant specific complex I subunit)	complex I	a) oxidative phosphorylation	mitochondria	58	430.91	1289.69	430.90	1289.69	3	3.03	16.6	23754	21	1	56 - 66	K.LKEDLDVMLAK.A	Oxidation: 8
1313	AT4G22310.1	At4g22310	uncharacterised	h) uncharacterised	mitochondrion	212	444.57	1330.69	444.58	1330.71	3	-15.86	14.8	5439	51	2	6 - 17	K.LQAIWNHPAGPK.T
1313	AT4G22310.1	At4g22310	uncharacterised	h) uncharacterised	mitochondrion	363	416.55	1246.64	416.56	1246.65	3	-11.78	19.1	46755	38	2	18 - 27	K.TIHFWAPTFK.W
1313	AT4G22310.1	At4g22310	uncharacterised	h) uncharacterised	mitochondrion	85	484.24	966.47	484.25	966.48	2	-17.08	11.9	87209	47	3	63 - 70	R.YSMVINPK.N	Oxidation: 3
1313	AT4G22310.1	At4g22310	uncharacterised	h) uncharacterised	mitochondrion	367	416.55	1246.63	416.56	1246.65	3	-13.12	19.1	19566	28	2	18 - 27	K.TIHFWAPTFK.W
1313	AT4G22310.1	At4g22310	uncharacterised	h) uncharacterised	mitochondrion	209	476.24	950.47	476.25	950.49	2	-17.02	14.8	4826	48	2	63 - 70	R.YSMVINPK.N
1313	AT4G22310.1	At4g22310	uncharacterised	h) uncharacterised	mitochondrion	150	745.32	1488.62	745.33	1488.64	2	-10.36	13.4	4627	34	1	95 - 108	K.HDYATEAEPAVASE.-
1313	AT4G22310.1	At4g22310	uncharacterised	h) uncharacterised	mitochondrion	365	624.32	1246.64	624.33	1246.65	2	-11.78	19.1	15916	47	1	18 - 27	K.TIHFWAPTFK.W
1313	AT4G22310.1	At4g22310	uncharacterised	h) uncharacterised	mitochondrion	415	619.66	1855.96	619.67	1855.98	3	-13.90	22.2	22715	39	2	28 - 44	K.WGISIANIADFAKPPEK.L
1313	AT4G22310.1	At4g22310	uncharacterised	h) uncharacterised	mitochondrion	88	484.24	966.47	484.25	966.48	2	-15.41	12	31017	54	3	63 - 70	R.YSMVINPK.N	Oxidation: 3
1313	AT4G22310.1	At4g22310	uncharacterised	h) uncharacterised	mitochondrion	205	476.24	950.47	476.25	950.49	2	-17.19	14.7	8965	54	2	63 - 70	R.YSMVINPK.N
1313	AT4G22310.1	At4g22310	uncharacterised	h) uncharacterised	mitochondrion	215	444.57	1330.69	444.58	1330.71	3	-14.76	14.9	7789	38	2	6 - 17	K.LQAIWNHPAGPK.T
1313	AT4G22310.1	At4g22310	uncharacterised	h) uncharacterised	mitochondrion	91	484.24	966.47	484.25	966.48	2	-16.82	12.1	10504	39	3	63 - 70	R.YSMVINPK.N	Oxidation: 3
1313	AT4G22310.1	At4g22310	uncharacterised	h) uncharacterised	mitochondrion	416	619.66	1855.95	619.67	1855.98	3	-15.94	22.2	20415	40	2	28 - 44	K.WGISIANIADFAKPPEK.L
1367	AT4G22310.1	At4g22310	uncharacterised	h) uncharacterised	mitochondrion	38	484.25	966.48	484.25	966.48	2	-5.46	11.6	3945	51	3	63 - 70	R.YSMVINPK.N	Oxidation: 3
1367	AT4G22310.1	At4g22310	uncharacterised	h) uncharacterised	mitochondrion	145	476.25	950.49	476.25	950.49	2	-3.71	14.5	3836	54	5	63 - 70	R.YSMVINPK.N
1367	AT4G22310.1	At4g22310	uncharacterised	h) uncharacterised	mitochondrion	158	444.58	1330.71	444.58	1330.71	3	-1.22	14.8	8404	41	4	6 - 17	K.LQAIWNHPAGPK.T
1367	AT4G22310.1	At4g22310	uncharacterised	h) uncharacterised	mitochondrion	147	476.25	950.49	476.25	950.49	2	-1.50	14.6	17745	49	5	63 - 70	R.YSMVINPK.N
1367	AT4G22310.1	At4g22310	uncharacterised	h) uncharacterised	mitochondrion	142	476.25	950.49	476.25	950.49	2	-2.20	14.4	4298	54	5	63 - 70	R.YSMVINPK.N
1367	AT4G22310.1	At4g22310	uncharacterised	h) uncharacterised	mitochondrion	283	416.56	1246.65	416.56	1246.65	3	0.59	18.9	173490	37	3	18 - 27	K.TIHFWAPTFK.W
1367	AT4G22310.1	At4g22310	uncharacterised	h) uncharacterised	mitochondrion	68	577.61	1729.82	577.61	1729.82	3	0.93	12.5	11710	48	3	93 - 108	K.IKHDYATEAEPAVASE.-
1367	AT4G22310.1	At4g22310	uncharacterised	h) uncharacterised	mitochondrion	280	416.56	1246.65	416.56	1246.65	3	0.97	18.9	4473	31	3	18 - 27	K.TIHFWAPTFK.W
1367	AT4G22310.1	At4g22310	uncharacterised	h) uncharacterised	mitochondrion	40	484.25	966.48	484.25	966.48	2	-1.56	11.7	4115	53	3	63 - 70	R.YSMVINPK.N	Oxidation: 3
1367	AT4G22310.1	At4g22310	uncharacterised	h) uncharacterised	mitochondrion	152	666.36	1330.71	666.36	1330.71	2	0.09	14.7	3711	46	2	6 - 17	K.LQAIWNHPAGPK.T
1367	AT4G22310.1	At4g22310	uncharacterised	h) uncharacterised	mitochondrion	42	484.25	966.48	484.25	966.48	2	-2.71	11.7	22475	41	3	63 - 70	R.YSMVINPK.N	Oxidation: 3
1367	AT4G22310.1	At4g22310	uncharacterised	h) uncharacterised	mitochondrion	282	624.33	1246.65	624.33	1246.65	2	0.97	18.9	16710	58	2	18 - 27	K.TIHFWAPTFK.W
1367	AT4G22310.1	At4g22310	uncharacterised	h) uncharacterised	mitochondrion	317	693.70	2078.06	693.69	2078.06	3	0.79	20.4	7766	74	1	45 - 62	K.LSYPQQIAVTCTGVIWSR.Y	Carbamidomethyl: 11
1367	AT4G22310.1	At4g22310	uncharacterised	h) uncharacterised	mitochondrion	328	619.67	1855.98	619.67	1855.98	3	-0.30	21.9	12362	40	3	28 - 44	K.WGISIANIADFAKPPEK.L
1367	AT4G22310.1	At4g22310	uncharacterised	h) uncharacterised	mitochondrion	330	929.00	1855.99	929.00	1855.98	2	1.73	22	75057	28	1	28 - 44	K.WGISIANIADFAKPPEK.L
1367	AT4G22310.1	At4g22310	uncharacterised	h) uncharacterised	mitochondrion	315	1040.04	2078.06	1040.04	2078.06	2	0.47	20.4	6773	52	2	45 - 62	K.LSYPQQIAVTCTGVIWSR.Y	Carbamidomethyl: 11
1367	AT4G22310.1	At4g22310	uncharacterised	h) uncharacterised	mitochondrion	69	577.61	1729.82	577.61	1729.82	3	1.78	12.5	6069	59	3	93 - 108	K.IKHDYATEAEPAVASE.-
1367	AT4G22310.1	At4g22310	uncharacterised	h) uncharacterised	mitochondrion	141	476.25	950.49	476.25	950.49	2	-2.36	14.4	15144	35	5	63 - 70	R.YSMVINPK.N
1367	AT4G22310.1	At4g22310	uncharacterised	h) uncharacterised	mitochondrion	94	745.33	1488.64	745.33	1488.64	2	2.67	13.2	4227	56	3	95 - 108	K.HDYATEAEPAVASE.-
1367	AT4G22310.1	At4g22310	uncharacterised	h) uncharacterised	mitochondrion	316	1040.04	2078.06	1040.04	2078.06	2	0.78	20.4	5367	24	2	45 - 62	K.LSYPQQIAVTCTGVIWSR.Y	Carbamidomethyl: 11
1367	AT4G22310.1	At4g22310	uncharacterised	h) uncharacterised	mitochondrion	149	444.58	1330.71	444.58	1330.71	3	-1.28	14.6	20003	48	4	6 - 17	K.LQAIWNHPAGPK.T
1367	AT4G22310.1	At4g22310	uncharacterised	h) uncharacterised	mitochondrion	288	416.56	1246.65	416.56	1246.65	3	-0.37	19	7949	22	3	18 - 27	K.TIHFWAPTFK.W
1367	AT4G22310.1	At4g22310	uncharacterised	h) uncharacterised	mitochondrion	150	444.58	1330.71	444.58	1330.71	3	0.09	14.7	3720	54	4	6 - 17	K.LQAIWNHPAGPK.T
1367	AT4G22310.1	At4g22310	uncharacterised	h) uncharacterised	mitochondrion	143	476.25	950.49	476.25	950.49	2	-2.47	14.5	16615	44	5	63 - 70	R.YSMVINPK.N
1367	AT4G22310.1	At4g22310	uncharacterised	h) uncharacterised	mitochondrion	153	444.58	1330.71	444.58	1330.71	3	-0.07	14.7	6223	44	4	6 - 17	K.LQAIWNHPAGPK.T
1367	AT4G22310.1	At4g22310	uncharacterised	h) uncharacterised	mitochondrion	72	577.61	1729.82	577.61	1729.82	3	1.20	12.6	6618	53	3	93 - 108	K.IKHDYATEAEPAVASE.-
1367	AT4G22310.1	At4g22310	uncharacterised	h) uncharacterised	mitochondrion	284	624.33	1246.65	624.33	1246.65	2	0.58	18.9	20696	58	2	18 - 27	K.TIHFWAPTFK.W
1367	AT4G22310.1	At4g22310	uncharacterised	h) uncharacterised	mitochondrion	327	619.67	1855.98	619.67	1855.98	3	0.51	21.9	12873	24	3	28 - 44	K.WGISIANIADFAKPPEK.L
1367	AT4G22310.1	At4g22310	uncharacterised	h) uncharacterised	mitochondrion	329	619.67	1855.98	619.67	1855.98	3	-0.96	22	9180	50	3	28 - 44	K.WGISIANIADFAKPPEK.L
1367	AT4G22310.1	At4g22310	uncharacterised	h) uncharacterised	mitochondrion	92	745.33	1488.64	745.33	1488.64	2	1.54	13.1	28085	61	3	95 - 108	K.HDYATEAEPAVASE.-
1367	AT4G22310.1	At4g22310	uncharacterised	h) uncharacterised	mitochondrion	91	745.33	1488.64	745.33	1488.64	2	1.14	13.1	5266	61	3	95 - 108	K.HDYATEAEPAVASE.-
1367	AT4G22310.1	At4g22310	uncharacterised	h) uncharacterised	mitochondrion	155	666.36	1330.71	666.36	1330.71	2	-0.07	14.7	5005	34	2	6 - 17	K.LQAIWNHPAGPK.T
1427	AT4G22310.1	At4g22310	uncharacterised	h) uncharacterised	mitochondrion	79	745.33	1488.64	745.33	1488.64	2	2.84	13.1	4911	64	3	95 - 108	K.HDYATEAEPAVASE.-
1427	AT4G22310.1	At4g22310	uncharacterised	h) uncharacterised	mitochondrion	140	666.37	1330.72	666.36	1330.71	2	2.42	14.6	29523	55	3	6 - 17	K.LQAIWNHPAGPK.T
1427	AT4G22310.1	At4g22310	uncharacterised	h) uncharacterised	mitochondrion	27	484.25	966.48	484.25	966.48	2	-0.67	11.6	10045	52	3	63 - 70	R.YSMVINPK.N	Oxidation: 3
1427	AT4G22310.1	At4g22310	uncharacterised	h) uncharacterised	mitochondrion	300	619.67	1855.99	619.67	1855.98	3	1.28	21.8	10914	42	4	28 - 44	K.WGISIANIADFAKPPEK.L
1427	AT4G22310.1	At4g22310	uncharacterised	h) uncharacterised	mitochondrion	131	476.25	950.49	476.25	950.49	2	-0.64	14.4	9666	54	3	63 - 70	R.YSMVINPK.N
1427	AT4G22310.1	At4g22310	uncharacterised	h) uncharacterised	mitochondrion	142	666.37	1330.72	666.36	1330.71	2	0.74	14.6	20338	34	3	6 - 17	K.LQAIWNHPAGPK.T
1427	AT4G22310.1	At4g22310	uncharacterised	h) uncharacterised	mitochondrion	266	624.33	1246.65	624.33	1246.65	2	0.50	18.8	11336	55	2	18 - 27	K.TIHFWAPTFK.W
1427	AT4G22310.1	At4g22310	uncharacterised	h) uncharacterised	mitochondrion	26	484.25	966.48	484.25	966.48	2	-0.65	11.5	4678	37	3	63 - 70	R.YSMVINPK.N	Oxidation: 3
1427	AT4G22310.1	At4g22310	uncharacterised	h) uncharacterised	mitochondrion	59	577.61	1729.82	577.61	1729.82	3	1.60	12.6	20636	65	3	93 - 108	K.IKHDYATEAEPAVASE.-
1427	AT4G22310.1	At4g22310	uncharacterised	h) uncharacterised	mitochondrion	270	624.33	1246.65	624.33	1246.65	2	-0.59	18.9	5964	35	2	18 - 27	K.TIHFWAPTFK.W
1427	AT4G22310.1	At4g22310	uncharacterised	h) uncharacterised	mitochondrion	135	444.58	1330.72	444.58	1330.71	3	2.67	14.5	16874	61	3	6 - 17	K.LQAIWNHPAGPK.T
1427	AT4G22310.1	At4g22310	uncharacterised	h) uncharacterised	mitochondrion	305	619.67	1855.98	619.67	1855.98	3	-0.07	22	6230	41	4	28 - 44	K.WGISIANIADFAKPPEK.L
1427	AT4G22310.1	At4g22310	uncharacterised	h) uncharacterised	mitochondrion	136	666.37	1330.72	666.36	1330.71	2	2.67	14.5	82952	59	3	6 - 17	K.LQAIWNHPAGPK.T
1427	AT4G22310.1	At4g22310	uncharacterised	h) uncharacterised	mitochondrion	128	476.25	950.49	476.25	950.49	2	2.47	14.3	8135	39	3	63 - 70	R.YSMVINPK.N
1427	AT4G22310.1	At4g22310	uncharacterised	h) uncharacterised	mitochondrion	34	967.49	966.48	967.49	966.48	1	-0.49	11.7	2997	26	1	63 - 70	R.YSMVINPK.N	Oxidation: 3
1427	AT4G22310.1	At4g22310	uncharacterised	h) uncharacterised	mitochondrion	264	416.56	1246.65	416.56	1246.65	3	-2.78	18.8	7551	34	3	18 - 27	K.TIHFWAPTFK.W
1427	AT4G22310.1	At4g22310	uncharacterised	h) uncharacterised	mitochondrion	134	444.58	1330.72	444.58	1330.71	3	6.63	14.5	66440	46	3	6 - 17	K.LQAIWNHPAGPK.T
1427	AT4G22310.1	At4g22310	uncharacterised	h) uncharacterised	mitochondrion	56	577.61	1729.82	577.61	1729.82	3	1.69	12.5	4123	39	3	93 - 108	K.IKHDYATEAEPAVASE.-
1427	AT4G22310.1	At4g22310	uncharacterised	h) uncharacterised	mitochondrion	129	476.25	950.49	476.25	950.49	2	-1.73	14.3	4036	54	3	63 - 70	R.YSMVINPK.N
1427	AT4G22310.1	At4g22310	uncharacterised	h) uncharacterised	mitochondrion	28	484.25	966.48	484.25	966.48	2	-0.48	11.6	14248	43	3	63 - 70	R.YSMVINPK.N	Oxidation: 3
1427	AT4G22310.1	At4g22310	uncharacterised	h) uncharacterised	mitochondrion	81	497.22	1488.64	497.22	1488.64	3	2.84	13.1	20957	35	1	95 - 108	K.HDYATEAEPAVASE.-
1427	AT4G22310.1	At4g22310	uncharacterised	h) uncharacterised	mitochondrion	302	619.67	1855.98	619.67	1855.98	3	-0.91	21.9	14458	54	4	28 - 44	K.WGISIANIADFAKPPEK.L
1427	AT4G22310.1	At4g22310	uncharacterised	h) uncharacterised	mitochondrion	301	619.67	1855.98	619.67	1855.98	3	-0.65	21.8	7106	36	4	28 - 44	K.WGISIANIADFAKPPEK.L
1427	AT4G22310.1	At4g22310	uncharacterised	h) uncharacterised	mitochondrion	303	929.00	1855.98	929.00	1855.98	2	-0.91	21.9	4931	30	1	28 - 44	K.WGISIANIADFAKPPEK.L
1427	AT4G22310.1	At4g22310	uncharacterised	h) uncharacterised	mitochondrion	55	577.61	1729.82	577.61	1729.82	3	2.00	12.5	926	39	3	93 - 108	K.IKHDYATEAEPAVASE.-
1427	AT4G22310.1	At4g22310	uncharacterised	h) uncharacterised	mitochondrion	138	444.58	1330.72	444.58	1330.71	3	2.43	14.6	63100	45	3	6 - 17	K.LQAIWNHPAGPK.T
1427	AT4G22310.1	At4g22310	uncharacterised	h) uncharacterised	mitochondrion	269	416.56	1246.65	416.56	1246.65	3	-0.59	18.9	5860	39	3	18 - 27	K.TIHFWAPTFK.W
1427	AT4G22310.1	At4g22310	uncharacterised	h) uncharacterised	mitochondrion	265	416.56	1246.65	416.56	1246.65	3	0.51	18.8	28595	43	3	18 - 27	K.TIHFWAPTFK.W
1427	AT4G22310.1	At4g22310	uncharacterised	h) uncharacterised	mitochondrion	77	745.33	1488.64	745.33	1488.64	2	3.35	13.1	16831	56	3	95 - 108	K.HDYATEAEPAVASE.-
1427	AT4G22310.1	At4g22310	uncharacterised	h) uncharacterised	mitochondrion	82	745.33	1488.64	745.33	1488.64	2	3.50	13.2	10490	60	3	95 - 108	K.HDYATEAEPAVASE.-
1475	AT4G22310.1	At4g22310	uncharacterised	h) uncharacterised	mitochondrion	45	484.24	966.47	484.25	966.48	2	-11.28	11.7	9531	47	2	63 - 70	R.YSMVINPK.N	Oxidation: 3
1475	AT4G22310.1	At4g22310	uncharacterised	h) uncharacterised	mitochondrion	43	484.24	966.47	484.25	966.48	2	-10.74	11.6	4792	37	2	63 - 70	R.YSMVINPK.N	Oxidation: 3
1475	AT4G22310.1	At4g22310	uncharacterised	h) uncharacterised	mitochondrion	149	444.58	1330.70	444.58	1330.71	3	-7.22	14.5	3375	36	1	6 - 17	K.LQAIWNHPAGPK.T
1342	AT4G26410.1	At4g26410	uncharacterized	h) uncharacterized	NEW mitochondria	283	526.28	1050.55	526.29	1050.56	2	-10.96	15.1	31907	55	1	102 - 110	K.VTDELIYAK.E
1342	AT4G26410.1	At4g26410	uncharacterized	h) uncharacterized	NEW mitochondria	356	553.76	1105.50	553.76	1105.51	2	-6.88	16.8	3561	32	1	93 - 101	K.TYENAFFSK.V
1402	AT4G26410.1	At4g26410	uncharacterized	h) uncharacterized	NEW mitochondria	225	526.28	1050.54	526.29	1050.56	2	-19.32	15.2	40473	60	2	102 - 110	K.VTDELIYAK.E
1402	AT4G26410.1	At4g26410	uncharacterized	h) uncharacterized	NEW mitochondria	222	526.28	1050.54	526.29	1050.56	2	-17.97	15.1	32124	47	2	102 - 110	K.VTDELIYAK.E
1402	AT4G26410.1	At4g26410	uncharacterized	h) uncharacterized	NEW mitochondria	45	442.22	1323.64	442.22	1323.65	3	-10.78	11	38223	30	1	68 - 78	R.SLRENSTSQFR.S
1454	AT4G26410.1	At4g26410	uncharacterized	h) uncharacterized	NEW mitochondria	495	554.29	1659.86	554.29	1659.86	3	-2.78	20	29642	29	2	79 - 92	R.SIQDFIPHALTQYK.T
1454	AT4G26410.1	At4g26410	uncharacterized	h) uncharacterized	NEW mitochondria	271	526.28	1050.55	526.29	1050.56	2	-6.35	14.9	36954	59	3	102 - 110	K.VTDELIYAK.E
1454	AT4G26410.1	At4g26410	uncharacterized	h) uncharacterized	NEW mitochondria	250	488.27	1461.79	488.27	1461.80	3	-7.62	14.5	43471	25	1	231 - 243	K.LRAEVASMTSLLR.Q	Oxidation: 8
1454	AT4G26410.1	At4g26410	uncharacterized	h) uncharacterized	NEW mitochondria	275	1051.56	1050.55	1051.57	1050.56	1	-4.68	15	10905	32	1	102 - 110	K.VTDELIYAK.E
1454	AT4G26410.1	At4g26410	uncharacterized	h) uncharacterized	NEW mitochondria	276	526.28	1050.55	526.29	1050.56	2	-5.76	15.1	5013	55	3	102 - 110	K.VTDELIYAK.E
1454	AT4G26410.1	At4g26410	uncharacterized	h) uncharacterized	NEW mitochondria	273	526.28	1050.55	526.29	1050.56	2	-4.67	15	18460	59	3	102 - 110	K.VTDELIYAK.E
1454	AT4G26410.1	At4g26410	uncharacterized	h) uncharacterized	NEW mitochondria	494	554.29	1659.85	554.29	1659.86	3	-4.44	19.9	49068	36	2	79 - 92	R.SIQDFIPHALTQYK.T
1454	AT4G26410.1	At4g26410	uncharacterized	h) uncharacterized	NEW mitochondria	346	553.76	1105.50	553.76	1105.51	2	-4.46	16.6	59343	65	1	93 - 101	K.TYENAFFSK.V
1454	AT4G26410.1	At4g26410	uncharacterized	h) uncharacterized	NEW mitochondria	322	613.80	1225.59	613.81	1225.60	2	-4.48	16.1	97753	38	2	143 - 152	R.FQSEEAQFLK.A
1454	AT4G26410.1	At4g26410	uncharacterized	h) uncharacterized	NEW mitochondria	325	613.80	1225.59	613.81	1225.60	2	-4.95	16.1	60088	18	2	143 - 152	R.FQSEEAQFLK.A
1454	AT4G26410.1	At4g26410	uncharacterized	h) uncharacterized	NEW mitochondria	245	597.31	1192.61	597.31	1192.61	2	-4.06	14.3	14345	55	1	233 - 243	R.AEVASMTSLLR.Q	Oxidation: 6
1454	AT4G26410.1	At4g26410	uncharacterized	h) uncharacterized	NEW mitochondria	496	830.94	1659.86	830.94	1659.86	2	-2.79	20	277836	22	1	79 - 92	R.SIQDFIPHALTQYK.T
1454	AT4G26410.1	At4g26410	uncharacterized	h) uncharacterized	NEW mitochondria	200	520.24	1557.71	520.25	1557.72	3	-6.02	13.3	3190	26	1	188 - 201	R.GLSELMNSGNDIHR.L	Oxidation: 6
1505	AT4G26410.1	At4g26410	uncharacterized	h) uncharacterized	NEW mitochondria	187	526.28	1050.54	526.29	1050.56	2	-19.53	15.1	26756	48	2	102 - 110	K.VTDELIYAK.E
1505	AT4G26410.1	At4g26410	uncharacterized	h) uncharacterized	NEW mitochondria	183	526.28	1050.54	526.29	1050.56	2	-18.75	15	8291	59	2	102 - 110	K.VTDELIYAK.E
1505	AT4G26410.1	At4g26410	uncharacterized	h) uncharacterized	NEW mitochondria	60	568.61	1702.81	568.62	1702.84	3	-17.44	11.9	14656	27	1	156 - 169	K.HVQELNMSVDLMKK.E	Oxidation: 7
1159	AT4G39690.1	At4g39690, mitofilin related	uncharacterized	h) uncharacterized	mitochondria	243	651.36	1300.70	651.35	1300.69	2	13.40	15.4	9184	68	1	600 - 612	K.LAEAAATLEEGVK.G
1159	AT4G39690.1	At4g39690, mitofilin related	uncharacterized	h) uncharacterized	mitochondria	452	700.91	1399.80	700.90	1399.79	2	5.38	20.6	38366	70	2	477 - 490	K.LALGALALDDTLSK.G
1159	AT4G39690.1	At4g39690, mitofilin related	uncharacterized	h) uncharacterized	mitochondria	451	700.91	1399.81	700.90	1399.79	2	9.43	20.6	4452	56	2	477 - 490	K.LALGALALDDTLSK.G
1334	AT4G39690.1	At4g39690, mitofilin related	uncharacterized	h) uncharacterized	mitochondria	128	490.25	978.50	490.26	978.51	2	-10.44	11.9	8401	37	1	430 - 438	K.AEMISTIAK.E	Oxidation: 3
1334	AT4G39690.1	At4g39690, mitofilin related	uncharacterized	h) uncharacterized	mitochondria	478	700.90	1399.78	700.90	1399.79	2	-10.20	19.8	20633	58	1	477 - 490	K.LALGALALDDTLSK.G
1334	AT4G39690.1	At4g39690, mitofilin related	uncharacterized	h) uncharacterized	mitochondria	284	523.26	1044.50	523.26	1044.51	2	-6.46	15.4	4209	35	1	456 - 464	K.ALSMAFYAR.S	Oxidation: 4
846	AT5G13610.1	At5g13610	uncharacterised	h) uncharacterised	plastid	160	580.82	1159.62	580.82	1159.63	2	-11.66	18	3818	41	1	365 - 373	R.FLQEILQNR.K
846	AT5G13610.1	At5g13610	uncharacterised	h) uncharacterised	plastid	165	588.82	1175.62	588.82	1175.63	2	-7.46	18.1	7969	36	2	244 - 253	R.LQFLNTDGIR.T
846	AT5G13610.1	At5g13610	uncharacterised	h) uncharacterised	plastid	54	492.26	982.51	492.27	982.52	2	-9.82	14.4	5388	25	1	152 - 159	R.MTNYVVLK.F	Oxidation: 1
846	AT5G13610.1	At5g13610	uncharacterised	h) uncharacterised	plastid	162	588.82	1175.62	588.82	1175.63	2	-5.44	18	4097	59	2	244 - 253	R.LQFLNTDGIR.T
1325	AT5G15320.1	At5g15320 (homolog to also unknown AT3G01130)	uncharacterised	h) uncharacterised	extracellular	214	901.99	1801.97	902.00	1801.99	2	-10.68	20.1	3639	29	2	2 - 19	M.TLPPGLYSGTSSLALVAR.A
1325	AT5G15320.1	At5g15320 (homolog to also unknown AT3G01130)	uncharacterised	h) uncharacterised	extracellular	217	601.67	1801.98	601.67	1801.99	3	-9.50	20.1	3728	86	1	2 - 19	M.TLPPGLYSGTSSLALVAR.A
1325	AT5G15320.1	At5g15320 (homolog to also unknown AT3G01130)	uncharacterised	h) uncharacterised	extracellular	206	722.36	1442.71	722.37	1442.72	2	-11.99	19.6	5755	79	2	20 - 33	R.ASAFGLGLVYGNMK.L	Oxidation: 13
1325	AT5G15320.1	At5g15320 (homolog to also unknown AT3G01130)	uncharacterised	h) uncharacterised	extracellular	216	902.00	1801.98	902.00	1801.99	2	-9.50	20.1	5801	30	2	2 - 19	M.TLPPGLYSGTSSLALVAR.A
1325	AT5G15320.1	At5g15320 (homolog to also unknown AT3G01130)	uncharacterised	h) uncharacterised	extracellular	207	722.36	1442.71	722.37	1442.72	2	-10.76	19.6	8653	69	2	20 - 33	R.ASAFGLGLVYGNMK.L	Oxidation: 13
1382	AT5G15320.1	At5g15320 (homolog to also unknown AT3G01130)	uncharacterised	h) uncharacterised	extracellular	227	481.91	1442.72	481.91	1442.72	3	-5.25	19.6	4390	47	1	20 - 33	R.ASAFGLGLVYGNMK.L	Oxidation: 13
1382	AT5G15320.1	At5g15320 (homolog to also unknown AT3G01130)	uncharacterised	h) uncharacterised	extracellular	224	722.36	1442.72	722.37	1442.72	2	-5.15	19.5	8918	81	3	20 - 33	R.ASAFGLGLVYGNMK.L	Oxidation: 13
1382	AT5G15320.1	At5g15320 (homolog to also unknown AT3G01130)	uncharacterised	h) uncharacterised	extracellular	243	601.67	1801.98	601.67	1801.99	3	-5.71	20.1	22984	39	3	2 - 19	M.TLPPGLYSGTSSLALVAR.A
1382	AT5G15320.1	At5g15320 (homolog to also unknown AT3G01130)	uncharacterised	h) uncharacterised	extracellular	247	714.37	1426.72	714.37	1426.73	2	-8.01	20.7	4000	61	3	20 - 33	R.ASAFGLGLVYGNMK.L
1382	AT5G15320.1	At5g15320 (homolog to also unknown AT3G01130)	uncharacterised	h) uncharacterised	extracellular	237	902.00	1801.98	902.00	1801.99	2	-5.38	20	3691	38	3	2 - 19	M.TLPPGLYSGTSSLALVAR.A
1382	AT5G15320.1	At5g15320 (homolog to also unknown AT3G01130)	uncharacterised	h) uncharacterised	extracellular	238	601.67	1801.98	601.67	1801.99	3	-5.38	20	3247	75	3	2 - 19	M.TLPPGLYSGTSSLALVAR.A
1382	AT5G15320.1	At5g15320 (homolog to also unknown AT3G01130)	uncharacterised	h) uncharacterised	extracellular	248	714.37	1426.72	714.37	1426.73	2	-8.21	20.8	5335	46	3	20 - 33	R.ASAFGLGLVYGNMK.L
1382	AT5G15320.1	At5g15320 (homolog to also unknown AT3G01130)	uncharacterised	h) uncharacterised	extracellular	242	902.00	1801.98	902.00	1801.99	2	-5.64	20.1	24127	24	3	2 - 19	M.TLPPGLYSGTSSLALVAR.A
1382	AT5G15320.1	At5g15320 (homolog to also unknown AT3G01130)	uncharacterised	h) uncharacterised	extracellular	229	722.36	1442.72	722.37	1442.72	2	-5.14	19.6	33177	94	3	20 - 33	R.ASAFGLGLVYGNMK.L	Oxidation: 13
1382	AT5G15320.1	At5g15320 (homolog to also unknown AT3G01130)	uncharacterised	h) uncharacterised	extracellular	249	714.36	1426.71	714.37	1426.73	2	-9.91	20.8	5059	48	3	20 - 33	R.ASAFGLGLVYGNMK.L
1382	AT5G15320.1	At5g15320 (homolog to also unknown AT3G01130)	uncharacterised	h) uncharacterised	extracellular	226	722.36	1442.72	722.37	1442.72	2	-5.25	19.6	35891	85	3	20 - 33	R.ASAFGLGLVYGNMK.L	Oxidation: 13
1382	AT5G15320.1	At5g15320 (homolog to also unknown AT3G01130)	uncharacterised	h) uncharacterised	extracellular	240	601.67	1801.98	601.67	1801.99	3	-5.86	20.1	16052	53	3	2 - 19	M.TLPPGLYSGTSSLALVAR.A
1382	AT5G15320.1	At5g15320 (homolog to also unknown AT3G01130)	uncharacterised	h) uncharacterised	extracellular	239	902.00	1801.98	902.00	1801.99	2	-5.86	20.1	18398	37	3	2 - 19	M.TLPPGLYSGTSSLALVAR.A
1439	AT5G15320.1	At5g15320 (homolog to also unknown AT3G01130)	uncharacterised	h) uncharacterised	extracellular	215	601.67	1802.00	601.67	1801.99	3	1.44	19.8	3955	42	3	2 - 19	M.TLPPGLYSGTSSLALVAR.A
1439	AT5G15320.1	At5g15320 (homolog to also unknown AT3G01130)	uncharacterised	h) uncharacterised	extracellular	218	601.67	1801.99	601.67	1801.99	3	-0.82	19.9	10591	36	3	2 - 19	M.TLPPGLYSGTSSLALVAR.A
1439	AT5G15320.1	At5g15320 (homolog to also unknown AT3G01130)	uncharacterised	h) uncharacterised	extracellular	208	722.37	1442.72	722.37	1442.72	2	-0.55	19.3	20410	99	3	20 - 33	R.ASAFGLGLVYGNMK.L	Oxidation: 13
1439	AT5G15320.1	At5g15320 (homolog to also unknown AT3G01130)	uncharacterised	h) uncharacterised	extracellular	206	722.37	1442.72	722.37	1442.72	2	-1.20	19.2	7351	75	3	20 - 33	R.ASAFGLGLVYGNMK.L	Oxidation: 13
1439	AT5G15320.1	At5g15320 (homolog to also unknown AT3G01130)	uncharacterised	h) uncharacterised	extracellular	216	601.67	1801.99	601.67	1801.99	3	-3.04	19.8	8493	48	3	2 - 19	M.TLPPGLYSGTSSLALVAR.A
1439	AT5G15320.1	At5g15320 (homolog to also unknown AT3G01130)	uncharacterised	h) uncharacterised	extracellular	207	722.37	1442.72	722.37	1442.72	2	-2.49	19.3	16269	77	3	20 - 33	R.ASAFGLGLVYGNMK.L	Oxidation: 13
1351	AT5G17620.1	At5g17620	uncharacterised	h) uncharacterised	cytosol	285	436.56	1306.65	436.22	1305.64	3	767.87	15.6	11661	20	2	1 - 11	-.MAAKQMEEIQK.K
1351	AT5G17620.1	At5g17620	uncharacterised	h) uncharacterised	cytosol	51	453.73	905.45	453.22	904.43	2	1126.28	10.2	18931	17	1	5 - 11	K.QMEEIQK.K
1351	AT5G17620.1	At5g17620	uncharacterised	h) uncharacterised	cytosol	286	436.56	1306.66	436.22	1305.64	3	777.66	15.6	10528	20	2	1 - 11	-.MAAKQMEEIQK.K
1431	AT5G17620.1	At5g17620	uncharacterised	h) uncharacterised	cytosol	209	436.56	1306.66	436.22	1305.64	3	775.14	15.6	11380	19	1	1 - 11	-.MAAKQMEEIQK.K
1431	AT5G17620.1	At5g17620	uncharacterised	h) uncharacterised	cytosol	17	453.73	905.45	453.22	904.43	2	1125.68	10.3	12909	18	1	5 - 11	K.QMEEIQK.K
1463	AT5G17620.1	At5g17620	uncharacterised	h) uncharacterised	cytosol	245	436.56	1306.66	436.22	1305.64	3	774.64	15.5	4327	18	1	1 - 11	-.MAAKQMEEIQK.K
1463	AT5G17620.1	At5g17620	uncharacterised	h) uncharacterised	cytosol	34	453.73	905.45	453.22	904.43	2	1122.00	10.3	38730	18	2	5 - 11	K.QMEEIQK.K
1463	AT5G17620.1	At5g17620	uncharacterised	h) uncharacterised	cytosol	36	453.73	905.45	453.22	904.43	2	1124.56	10.3	81895	18	2	5 - 11	K.QMEEIQK.K
1312	AT5G20090.1	At5g20090	uncharacterized	h) uncharacterized	mitochondria	254	659.85	1317.69	659.86	1317.71	2	-11.82	18.6	4100	91	5	6 - 17	R.FQAFLNSPIGPK.T
1312	AT5G20090.1	At5g20090	uncharacterized	h) uncharacterized	mitochondria	257	659.85	1317.69	659.86	1317.71	2	-11.70	18.7	27155	63	5	6 - 17	R.FQAFLNSPIGPK.T
1312	AT5G20090.1	At5g20090	uncharacterized	h) uncharacterized	mitochondria	220	525.76	1049.50	525.76	1049.51	2	-14.46	17	5374	28	2	63 - 70	R.FAWMVQPR.N	Oxidation: 4
1312	AT5G20090.1	At5g20090	uncharacterized	h) uncharacterized	mitochondria	255	659.85	1317.69	659.86	1317.71	2	-11.36	18.6	11669	64	5	6 - 17	R.FQAFLNSPIGPK.T
1312	AT5G20090.1	At5g20090	uncharacterized	h) uncharacterized	mitochondria	258	659.85	1317.69	659.86	1317.71	2	-12.04	18.7	19177	65	5	6 - 17	R.FQAFLNSPIGPK.T
1312	AT5G20090.1	At5g20090	uncharacterized	h) uncharacterized	mitochondria	23	427.22	852.42	427.22	852.43	2	-13.32	10.3	9965	38	2	95 - 102	R.AQGYLSSK.K
1312	AT5G20090.1	At5g20090	uncharacterized	h) uncharacterized	mitochondria	20	427.22	852.42	427.22	852.43	2	-14.26	10.2	13703	32	2	95 - 102	R.AQGYLSSK.K
1312	AT5G20090.1	At5g20090	uncharacterized	h) uncharacterized	mitochondria	256	659.85	1317.69	659.86	1317.71	2	-11.27	18.7	22519	68	5	6 - 17	R.FQAFLNSPIGPK.T
1312	AT5G20090.1	At5g20090	uncharacterized	h) uncharacterized	mitochondria	219	525.77	1049.52	525.76	1049.51	2	3.63	16.9	4473	27	2	63 - 70	R.FAWMVQPR.N	Oxidation: 4
1366	AT5G20090.1	At5g20090	uncharacterized	h) uncharacterized	mitochondria	303	831.76	2492.25	831.76	2492.25	3	1.02	20.1	75184	69	3	71 - 91	R.NYLLLACHASNETVQLYQLSR.W	Carbamidomethyl: 7
1366	AT5G20090.1	At5g20090	uncharacterized	h) uncharacterized	mitochondria	258	659.86	1317.70	659.86	1317.71	2	-3.36	18.7	10012	62	3	6 - 17	R.FQAFLNSPIGPK.T
1366	AT5G20090.1	At5g20090	uncharacterized	h) uncharacterized	mitochondria	265	517.76	1033.51	517.77	1033.52	2	-3.23	18.8	4315	53	3	63 - 70	R.FAWMVQPR.N
1366	AT5G20090.1	At5g20090	uncharacterized	h) uncharacterized	mitochondria	221	525.76	1049.51	525.76	1049.51	2	1.12	17	6507	31	2	63 - 70	R.FAWMVQPR.N	Oxidation: 4
1366	AT5G20090.1	At5g20090	uncharacterized	h) uncharacterized	mitochondria	261	440.24	1317.71	440.24	1317.71	3	-0.02	18.7	18915	45	2	6 - 17	R.FQAFLNSPIGPK.T
1366	AT5G20090.1	At5g20090	uncharacterized	h) uncharacterized	mitochondria	8	427.22	852.43	427.22	852.43	2	-5.79	10.2	73357	18	3	95 - 102	R.AQGYLSSK.K
1366	AT5G20090.1	At5g20090	uncharacterized	h) uncharacterized	mitochondria	306	831.76	2492.25	831.76	2492.25	3	2.03	20.2	12246	82	3	71 - 91	R.NYLLLACHASNETVQLYQLSR.W	Carbamidomethyl: 7
1366	AT5G20090.1	At5g20090	uncharacterized	h) uncharacterized	mitochondria	263	440.24	1317.71	440.24	1317.71	3	-0.45	18.8	4004	50	2	6 - 17	R.FQAFLNSPIGPK.T
1366	AT5G20090.1	At5g20090	uncharacterized	h) uncharacterized	mitochondria	10	427.22	852.43	427.22	852.43	2	-3.87	10.3	11908	47	3	95 - 102	R.AQGYLSSK.K
1366	AT5G20090.1	At5g20090	uncharacterized	h) uncharacterized	mitochondria	266	517.76	1033.51	517.77	1033.52	2	-4.32	18.9	8640	47	3	63 - 70	R.FAWMVQPR.N
1366	AT5G20090.1	At5g20090	uncharacterized	h) uncharacterized	mitochondria	262	517.76	1033.51	517.77	1033.52	2	-4.53	18.8	4427	49	3	63 - 70	R.FAWMVQPR.N
1366	AT5G20090.1	At5g20090	uncharacterized	h) uncharacterized	mitochondria	260	659.86	1317.71	659.86	1317.71	2	-0.01	18.7	12089	77	3	6 - 17	R.FQAFLNSPIGPK.T
1366	AT5G20090.1	At5g20090	uncharacterized	h) uncharacterized	mitochondria	304	831.76	2492.26	831.76	2492.25	3	3.47	20.1	16902	64	3	71 - 91	R.NYLLLACHASNETVQLYQLSR.W	Carbamidomethyl: 7
1366	AT5G20090.1	At5g20090	uncharacterized	h) uncharacterized	mitochondria	259	659.86	1317.71	659.86	1317.71	2	-1.95	18.7	5069	62	3	6 - 17	R.FQAFLNSPIGPK.T
1366	AT5G20090.1	At5g20090	uncharacterized	h) uncharacterized	mitochondria	12	853.44	852.43	853.44	852.43	1	-2.32	10.3	4870	19	2	95 - 102	R.AQGYLSSK.K
1366	AT5G20090.1	At5g20090	uncharacterized	h) uncharacterized	mitochondria	9	427.22	852.43	427.22	852.43	2	-4.99	10.2	5131	42	3	95 - 102	R.AQGYLSSK.K
1366	AT5G20090.1	At5g20090	uncharacterized	h) uncharacterized	mitochondria	225	525.76	1049.51	525.76	1049.51	2	0.13	17.1	6596	36	2	63 - 70	R.FAWMVQPR.N	Oxidation: 4
1366	AT5G20090.1	At5g20090	uncharacterized	h) uncharacterized	mitochondria	11	853.44	852.43	853.44	852.43	1	-4.46	10.3	10714	42	2	95 - 102	R.AQGYLSSK.K
1427	AT5G20090.1	At5g20090	uncharacterized	h) uncharacterized	mitochondria	215	525.76	1049.51	525.76	1049.51	2	-2.57	16.8	7487	53	3	63 - 70	R.FAWMVQPR.N	Oxidation: 4
1427	AT5G20090.1	At5g20090	uncharacterized	h) uncharacterized	mitochondria	255	659.86	1317.71	659.86	1317.71	2	-0.59	18.6	18241	72	3	6 - 17	R.FQAFLNSPIGPK.T
1427	AT5G20090.1	At5g20090	uncharacterized	h) uncharacterized	mitochondria	259	440.24	1317.71	440.24	1317.71	3	-0.65	18.7	12464	63	2	6 - 17	R.FQAFLNSPIGPK.T
1427	AT5G20090.1	At5g20090	uncharacterized	h) uncharacterized	mitochondria	15	427.22	852.43	427.22	852.43	2	-1.06	10.4	7448	47	4	95 - 102	R.AQGYLSSK.K
1427	AT5G20090.1	At5g20090	uncharacterized	h) uncharacterized	mitochondria	13	427.22	852.43	427.22	852.43	2	-1.25	10.3	23872	32	4	95 - 102	R.AQGYLSSK.K
1427	AT5G20090.1	At5g20090	uncharacterized	h) uncharacterized	mitochondria	221	525.76	1049.51	525.76	1049.51	2	-2.65	17	21515	57	3	63 - 70	R.FAWMVQPR.N	Oxidation: 4
1427	AT5G20090.1	At5g20090	uncharacterized	h) uncharacterized	mitochondria	254	659.86	1317.70	659.86	1317.71	2	-3.10	18.5	4127	59	3	6 - 17	R.FQAFLNSPIGPK.T
1427	AT5G20090.1	At5g20090	uncharacterized	h) uncharacterized	mitochondria	218	525.76	1049.51	525.76	1049.51	2	-3.05	16.9	14379	42	3	63 - 70	R.FAWMVQPR.N	Oxidation: 4
1427	AT5G20090.1	At5g20090	uncharacterized	h) uncharacterized	mitochondria	260	517.76	1033.51	517.77	1033.52	2	-4.55	18.7	8531	48	2	63 - 70	R.FAWMVQPR.N
1427	AT5G20090.1	At5g20090	uncharacterized	h) uncharacterized	mitochondria	14	427.22	852.43	427.22	852.43	2	-0.24	10.3	5597	47	4	95 - 102	R.AQGYLSSK.K
1427	AT5G20090.1	At5g20090	uncharacterized	h) uncharacterized	mitochondria	257	440.24	1317.71	440.24	1317.71	3	-1.13	18.6	17072	53	2	6 - 17	R.FQAFLNSPIGPK.T
1427	AT5G20090.1	At5g20090	uncharacterized	h) uncharacterized	mitochondria	263	517.76	1033.51	517.77	1033.52	2	-2.96	18.8	23323	46	2	63 - 70	R.FAWMVQPR.N
1427	AT5G20090.1	At5g20090	uncharacterized	h) uncharacterized	mitochondria	16	427.22	852.43	427.22	852.43	2	-1.32	10.4	6962	42	4	95 - 102	R.AQGYLSSK.K
1427	AT5G20090.1	At5g20090	uncharacterized	h) uncharacterized	mitochondria	256	659.86	1317.71	659.86	1317.71	2	-1.13	18.6	10436	78	3	6 - 17	R.FQAFLNSPIGPK.T
237	AT5G53030.1	At5g53030	uncharacterized	h) uncharacterized	cytosol	64	672.40	671.39	672.40	671.40	1	-9.22	14.2691	63879	15	1	111 - 116	R.SLSLPR.S
237	AT5G53030.1	At5g53030	uncharacterized	h) uncharacterized	cytosol	71	435.77	869.52	435.76	869.51	2	12.79	14.47050833	7722	34	3	110 - 116	R.RSLSLPR.S	Acetyl: 1
237	AT5G53030.1	At5g53030	uncharacterized	h) uncharacterized	cytosol	75	435.77	869.52	435.76	869.51	2	11.64	14.63176667	107062	18	3	110 - 116	R.RSLSLPR.S	Acetyl: 1
237	AT5G53030.1	At5g53030	uncharacterized	h) uncharacterized	cytosol	73	435.77	869.52	435.76	869.51	2	11.64	14.55114167	30235	28	3	110 - 116	R.RSLSLPR.S	Acetyl: 1
309	AT5G53030.1	At5g53030	uncharacterized	h) uncharacterized	cytosol	43	435.77	869.52	435.76	869.51	2	14.47	16.4	159028	21	4	110 - 116	R.RSLSLPR.S	Acetyl: 1
309	AT5G53030.1	At5g53030	uncharacterized	h) uncharacterized	cytosol	46	435.77	869.52	435.76	869.51	2	14.86	16.5	121522	18	4	110 - 116	R.RSLSLPR.S	Acetyl: 1
309	AT5G53030.1	At5g53030	uncharacterized	h) uncharacterized	cytosol	28	672.40	671.39	672.40	671.40	1	-10.28	15.8	19533	20	1	111 - 116	R.SLSLPR.S
309	AT5G53030.1	At5g53030	uncharacterized	h) uncharacterized	cytosol	41	435.77	869.52	435.76	869.51	2	11.23	16.3	80745	23	4	110 - 116	R.RSLSLPR.S	Acetyl: 1
309	AT5G53030.1	At5g53030	uncharacterized	h) uncharacterized	cytosol	39	435.77	869.52	435.76	869.51	2	11.53	16.2	21014	36	4	110 - 116	R.RSLSLPR.S	Acetyl: 1
475	AT5G53030.1	At5g53030	uncharacterized	h) uncharacterized	cytosol	67	435.77	869.52	435.76	869.51	2	17.38	16.2	156701	20	1	110 - 116	R.RSLSLPR.S	Acetyl: 1
475	AT5G53030.1	At5g53030	uncharacterized	h) uncharacterized	cytosol	53	672.40	671.39	672.40	671.40	1	-6.16	15.7	25823	15	1	111 - 116	R.SLSLPR.S
744	AT5G53030.1	At5g53030	uncharacterized	h) uncharacterized	cytosol	68	672.40	671.40	672.40	671.40	1	1.55	14.1	43183	19	1	111 - 116	R.SLSLPR.S
744	AT5G53030.1	At5g53030	uncharacterized	h) uncharacterized	cytosol	79	435.77	869.52	435.76	869.51	2	18.30	14.5	34892	24	1	110 - 116	R.RSLSLPR.S	Acetyl: 1
1323	AT5G53030.1	At5g53030	uncharacterized	h) uncharacterized	cytosol	59	672.39	671.39	672.40	671.40	1	-13.76	14.1	5088	19	1	111 - 116	R.SLSLPR.S
1323	AT5G53030.1	At5g53030	uncharacterized	h) uncharacterized	cytosol	75	435.77	869.52	435.76	869.51	2	16.87	14.5	244562	17	1	110 - 116	R.RSLSLPR.S	Acetyl: 1
1321	AT5G53650.1	At5g53650	uncharacterized	h) uncharacterized	plasma membrane	6	599.31	1196.61	599.31	1196.61	2	-7.73	8.4	4987	21	1	33 - 43	K.VAHESISQQAK.S
1321	AT5G53650.1	At5g53650	uncharacterized	h) uncharacterized	plasma membrane	2	399.88	1196.61	399.88	1196.61	3	-7.49	8.3	18076	16	3	33 - 43	K.VAHESISQQAK.S
1321	AT5G53650.1	At5g53650	uncharacterized	h) uncharacterized	plasma membrane	204	459.76	917.51	459.77	917.52	2	-10.93	15.1	27750	48	3	53 - 60	R.ISTLESLR.Q
1321	AT5G53650.1	At5g53650	uncharacterized	h) uncharacterized	plasma membrane	1	399.88	1196.61	399.88	1196.61	3	-6.24	8.3	4899	20	3	33 - 43	K.VAHESISQQAK.S
1321	AT5G53650.1	At5g53650	uncharacterized	h) uncharacterized	plasma membrane	201	459.76	917.51	459.77	917.52	2	-11.58	15	34648	48	3	53 - 60	R.ISTLESLR.Q
1321	AT5G53650.1	At5g53650	uncharacterized	h) uncharacterized	plasma membrane	200	459.76	917.51	459.77	917.52	2	-14.30	14.9	5037	49	3	53 - 60	R.ISTLESLR.Q
1321	AT5G53650.1	At5g53650	uncharacterized	h) uncharacterized	plasma membrane	4	399.88	1196.61	399.88	1196.61	3	-7.72	8.4	27356	45	3	33 - 43	K.VAHESISQQAK.S
1376	AT5G53650.1	At5g53650	uncharacterized	h) uncharacterized	plasma membrane	9	399.88	1196.61	399.88	1196.61	3	-6.69	8.5	22786	55	2	33 - 43	K.VAHESISQQAK.S
1376	AT5G53650.1	At5g53650	uncharacterized	h) uncharacterized	plasma membrane	12	599.31	1196.61	599.31	1196.61	2	-7.59	8.6	31836	29	2	33 - 43	K.VAHESISQQAK.S
1376	AT5G53650.1	At5g53650	uncharacterized	h) uncharacterized	plasma membrane	244	459.76	917.51	459.77	917.52	2	-10.15	15.2	14568	34	3	53 - 60	R.ISTLESLR.Q
1376	AT5G53650.1	At5g53650	uncharacterized	h) uncharacterized	plasma membrane	11	599.31	1196.61	599.31	1196.61	2	-7.81	8.6	51576	27	2	33 - 43	K.VAHESISQQAK.S
1376	AT5G53650.1	At5g53650	uncharacterized	h) uncharacterized	plasma membrane	245	459.76	917.51	459.77	917.52	2	-9.95	15.2	78924	48	3	53 - 60	R.ISTLESLR.Q
1376	AT5G53650.1	At5g53650	uncharacterized	h) uncharacterized	plasma membrane	248	459.76	917.51	459.77	917.52	2	-8.80	15.3	12646	30	3	53 - 60	R.ISTLESLR.Q
1376	AT5G53650.1	At5g53650	uncharacterized	h) uncharacterized	plasma membrane	10	399.88	1196.61	399.88	1196.61	3	-7.79	8.6	152001	52	2	33 - 43	K.VAHESISQQAK.S
1434	AT5G53650.1	At5g53650	uncharacterized	h) uncharacterized	plasma membrane	76	652.30	1302.58	652.30	1302.59	2	-8.24	13.7	8311	53	2	61 - 72	R.QSEAPQLAETTE.-
1434	AT5G53650.1	At5g53650	uncharacterized	h) uncharacterized	plasma membrane	126	459.76	917.50	459.77	917.52	2	-15.39	14.9	5217	47	3	53 - 60	R.ISTLESLR.Q
1434	AT5G53650.1	At5g53650	uncharacterized	h) uncharacterized	plasma membrane	3	399.88	1196.60	399.88	1196.61	3	-8.52	8.4	23890	47	2	33 - 43	K.VAHESISQQAK.S
1434	AT5G53650.1	At5g53650	uncharacterized	h) uncharacterized	plasma membrane	130	459.76	917.51	459.77	917.52	2	-11.58	15	21988	47	3	53 - 60	R.ISTLESLR.Q
1434	AT5G53650.1	At5g53650	uncharacterized	h) uncharacterized	plasma membrane	127	459.76	917.51	459.77	917.52	2	-11.32	15	26640	48	3	53 - 60	R.ISTLESLR.Q
1434	AT5G53650.1	At5g53650	uncharacterized	h) uncharacterized	plasma membrane	79	652.30	1302.58	652.30	1302.59	2	-9.67	13.8	7843	37	2	61 - 72	R.QSEAPQLAETTE.-
1434	AT5G53650.1	At5g53650	uncharacterized	h) uncharacterized	plasma membrane	2	399.88	1196.61	399.88	1196.61	3	-7.87	8.4	15653	46	2	33 - 43	K.VAHESISQQAK.S
1341	AT5G55610.1	At5g55610	uncharacterized	h) uncharacterized	NEW mitochondria	49	439.74	877.46	439.74	877.47	2	-10.81	10.3	7926	34	4	108 - 115	R.ALAMTTVR.S	Oxidation: 4
1341	AT5G55610.1	At5g55610	uncharacterized	h) uncharacterized	NEW mitochondria	47	439.74	877.46	439.74	877.47	2	-11.75	10.3	13918	52	4	108 - 115	R.ALAMTTVR.S	Oxidation: 4
1341	AT5G55610.1	At5g55610	uncharacterized	h) uncharacterized	NEW mitochondria	266	518.79	1035.56	518.79	1035.57	2	-12.86	15.4	7835	66	2	177 - 185	R.LALSYVSQR.M
1341	AT5G55610.1	At5g55610	uncharacterized	h) uncharacterized	NEW mitochondria	44	439.74	877.46	439.74	877.47	2	-11.77	10.2	4867	52	4	108 - 115	R.ALAMTTVR.S	Oxidation: 4
1341	AT5G55610.1	At5g55610	uncharacterized	h) uncharacterized	NEW mitochondria	23	453.74	905.47	453.75	905.48	2	-10.08	9.6	4014	42	3	164 - 171	R.ETTVVTTR.R
1341	AT5G55610.1	At5g55610	uncharacterized	h) uncharacterized	NEW mitochondria	12	402.73	803.44	402.73	803.45	2	-9.92	9.3	6501	35	2	215 - 221	K.VSQTTLR.G
1341	AT5G55610.1	At5g55610	uncharacterized	h) uncharacterized	NEW mitochondria	10	402.73	803.44	402.73	803.45	2	-12.60	9.3	8236	30	2	215 - 221	K.VSQTTLR.G
1341	AT5G55610.1	At5g55610	uncharacterized	h) uncharacterized	NEW mitochondria	21	453.74	905.47	453.75	905.48	2	-11.62	9.5	12898	54	3	164 - 171	R.ETTVVTTR.R
1341	AT5G55610.1	At5g55610	uncharacterized	h) uncharacterized	NEW mitochondria	237	474.26	946.51	474.27	946.52	2	-15.08	14.7	27808	30	2	82 - 89	R.QPLAYISR.S
1341	AT5G55610.1	At5g55610	uncharacterized	h) uncharacterized	NEW mitochondria	93	468.23	934.44	468.23	934.45	2	-12.38	11.5	13603	52	2	74 - 81	K.MSADVLQR.Q	Oxidation: 1
1341	AT5G55610.1	At5g55610	uncharacterized	h) uncharacterized	NEW mitochondria	19	453.74	905.47	453.75	905.48	2	-10.47	9.5	3397	54	3	164 - 171	R.ETTVVTTR.R
1341	AT5G55610.1	At5g55610	uncharacterized	h) uncharacterized	NEW mitochondria	233	474.26	946.51	474.27	946.52	2	-16.10	14.6	409094	54	2	82 - 89	R.QPLAYISR.S
1341	AT5G55610.1	At5g55610	uncharacterized	h) uncharacterized	NEW mitochondria	90	468.23	934.44	468.23	934.45	2	-13.76	11.4	6641	54	2	74 - 81	K.MSADVLQR.Q	Oxidation: 1
1341	AT5G55610.1	At5g55610	uncharacterized	h) uncharacterized	NEW mitochondria	43	439.73	877.45	439.74	877.47	2	-18.82	10.2	8346	44	4	108 - 115	R.ALAMTTVR.S	Oxidation: 4
1341	AT5G55610.1	At5g55610	uncharacterized	h) uncharacterized	NEW mitochondria	268	518.79	1035.56	518.79	1035.57	2	-12.46	15.4	7183	60	2	177 - 185	R.LALSYVSQR.M
1401	AT5G55610.1	At5g55610	uncharacterized	h) uncharacterized	NEW mitochondria	231	474.26	946.51	474.27	946.52	2	-18.06	15	74281	54	1	82 - 89	R.QPLAYISR.S
1401	AT5G55610.1	At5g55610	uncharacterized	h) uncharacterized	NEW mitochondria	99	443.24	884.46	443.24	884.47	2	-18.04	12	641091	39	1	193 - 200	K.DVPQSALR.K
1401	AT5G55610.1	At5g55610	uncharacterized	h) uncharacterized	NEW mitochondria	256	518.78	1035.55	518.79	1035.57	2	-17.51	15.6	13962	60	2	177 - 185	R.LALSYVSQR.M
1401	AT5G55610.1	At5g55610	uncharacterized	h) uncharacterized	NEW mitochondria	47	439.73	877.45	439.74	877.47	2	-17.48	10.6	9776	52	3	108 - 115	R.ALAMTTVR.S	Oxidation: 4
1401	AT5G55610.1	At5g55610	uncharacterized	h) uncharacterized	NEW mitochondria	12	402.72	803.43	402.73	803.45	2	-19.03	9.6	4115	36	1	215 - 221	K.VSQTTLR.G
1401	AT5G55610.1	At5g55610	uncharacterized	h) uncharacterized	NEW mitochondria	259	518.78	1035.55	518.79	1035.57	2	-18.45	15.7	9179	55	2	177 - 185	R.LALSYVSQR.M
1401	AT5G55610.1	At5g55610	uncharacterized	h) uncharacterized	NEW mitochondria	188	710.32	709.32	710.34	709.33	1	-17.79	14	52862	26	1	324 - 329	K.TLQADY.-
1401	AT5G55610.1	At5g55610	uncharacterized	h) uncharacterized	NEW mitochondria	80	468.23	934.44	468.23	934.45	2	-17.16	11.6	3897	54	3	74 - 81	K.MSADVLQR.Q	Oxidation: 1
1401	AT5G55610.1	At5g55610	uncharacterized	h) uncharacterized	NEW mitochondria	85	468.23	934.44	468.23	934.45	2	-19.59	11.7	6642	61	3	74 - 81	K.MSADVLQR.Q	Oxidation: 1
1401	AT5G55610.1	At5g55610	uncharacterized	h) uncharacterized	NEW mitochondria	82	468.23	934.44	468.23	934.45	2	-18.18	11.6	4459	63	3	74 - 81	K.MSADVLQR.Q	Oxidation: 1
1401	AT5G55610.1	At5g55610	uncharacterized	h) uncharacterized	NEW mitochondria	17	453.74	905.47	453.75	905.48	2	-16.89	9.7	7884	54	2	164 - 171	R.ETTVVTTR.R
1401	AT5G55610.1	At5g55610	uncharacterized	h) uncharacterized	NEW mitochondria	44	439.73	877.45	439.74	877.47	2	-18.70	10.5	8263	52	3	108 - 115	R.ALAMTTVR.S	Oxidation: 4
1401	AT5G55610.1	At5g55610	uncharacterized	h) uncharacterized	NEW mitochondria	20	453.74	905.47	453.75	905.48	2	-17.61	9.8	7291	55	2	164 - 171	R.ETTVVTTR.R
1401	AT5G55610.1	At5g55610	uncharacterized	h) uncharacterized	NEW mitochondria	41	439.73	877.45	439.74	877.47	2	-18.02	10.4	18565	42	3	108 - 115	R.ALAMTTVR.S	Oxidation: 4
1453	AT5G55610.1	At5g55610	uncharacterized	h) uncharacterized	NEW mitochondria	70	468.23	934.45	468.23	934.45	2	-6.07	11.5	4275	51	3	74 - 81	K.MSADVLQR.Q	Oxidation: 1
1453	AT5G55610.1	At5g55610	uncharacterized	h) uncharacterized	NEW mitochondria	238	518.79	1035.57	518.79	1035.57	2	-5.96	15.4	9096	56	2	177 - 185	R.LALSYVSQR.M
1453	AT5G55610.1	At5g55610	uncharacterized	h) uncharacterized	NEW mitochondria	72	468.23	934.45	468.23	934.45	2	-5.67	11.5	10658	47	3	74 - 81	K.MSADVLQR.Q	Oxidation: 1
1453	AT5G55610.1	At5g55610	uncharacterized	h) uncharacterized	NEW mitochondria	13	453.75	905.48	453.75	905.48	2	-4.50	9.5	3354	55	4	164 - 171	R.ETTVVTTR.R
1453	AT5G55610.1	At5g55610	uncharacterized	h) uncharacterized	NEW mitochondria	30	439.74	877.46	439.74	877.47	2	-7.40	10.2	13731	45	4	108 - 115	R.ALAMTTVR.S	Oxidation: 4
1453	AT5G55610.1	At5g55610	uncharacterized	h) uncharacterized	NEW mitochondria	209	474.27	946.52	474.27	946.52	2	-7.75	14.7	18064	39	2	82 - 89	R.QPLAYISR.S
1453	AT5G55610.1	At5g55610	uncharacterized	h) uncharacterized	NEW mitochondria	14	453.75	905.48	453.75	905.48	2	-5.47	9.5	4959	54	4	164 - 171	R.ETTVVTTR.R
1453	AT5G55610.1	At5g55610	uncharacterized	h) uncharacterized	NEW mitochondria	37	439.74	877.46	439.74	877.47	2	-6.42	10.3	6108	43	4	108 - 115	R.ALAMTTVR.S	Oxidation: 4
1453	AT5G55610.1	At5g55610	uncharacterized	h) uncharacterized	NEW mitochondria	12	453.75	905.48	453.75	905.48	2	-4.90	9.5	3603	42	4	164 - 171	R.ETTVVTTR.R
1453	AT5G55610.1	At5g55610	uncharacterized	h) uncharacterized	NEW mitochondria	68	468.23	934.45	468.23	934.45	2	-8.47	11.4	9316	54	3	74 - 81	K.MSADVLQR.Q	Oxidation: 1
1453	AT5G55610.1	At5g55610	uncharacterized	h) uncharacterized	NEW mitochondria	208	474.27	946.52	474.27	946.52	2	-6.25	14.7	98911	54	2	82 - 89	R.QPLAYISR.S
1453	AT5G55610.1	At5g55610	uncharacterized	h) uncharacterized	NEW mitochondria	6	402.73	803.44	402.73	803.45	2	-7.24	9.3	9857	42	2	215 - 221	K.VSQTTLR.G
1453	AT5G55610.1	At5g55610	uncharacterized	h) uncharacterized	NEW mitochondria	235	518.79	1035.56	518.79	1035.57	2	-6.58	15.3	6092	75	2	177 - 185	R.LALSYVSQR.M
1453	AT5G55610.1	At5g55610	uncharacterized	h) uncharacterized	NEW mitochondria	15	453.75	905.48	453.75	905.48	2	-5.62	9.6	10041	42	4	164 - 171	R.ETTVVTTR.R
1453	AT5G55610.1	At5g55610	uncharacterized	h) uncharacterized	NEW mitochondria	409	533.28	1064.55	533.29	1064.57	2	-10.51	19.7	8744	48	1	99 - 107	K.PVLSAFEFR.A
1453	AT5G55610.1	At5g55610	uncharacterized	h) uncharacterized	NEW mitochondria	7	402.73	803.45	402.73	803.45	2	-3.64	9.4	3793	43	2	215 - 221	K.VSQTTLR.G
1453	AT5G55610.1	At5g55610	uncharacterized	h) uncharacterized	NEW mitochondria	34	439.74	877.46	439.74	877.47	2	-8.02	10.3	3944	51	4	108 - 115	R.ALAMTTVR.S	Oxidation: 4
1453	AT5G55610.1	At5g55610	uncharacterized	h) uncharacterized	NEW mitochondria	31	439.74	877.46	439.74	877.47	2	-9.22	10.2	29266	49	4	108 - 115	R.ALAMTTVR.S	Oxidation: 4
1453	AT5G55610.1	At5g55610	uncharacterized	h) uncharacterized	NEW mitochondria	82	443.24	884.46	443.24	884.47	2	-7.53	11.8	6345	35	1	193 - 200	K.DVPQSALR.K
989	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	388	778.96	1555.91	778.95	1555.89	2	17.43	22.2	4550	24	1	386 - 399	K.LYEVVPPVLTELGK.V
989	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	321	602.83	1203.65	602.82	1203.63	2	14.98	19.9	4200	49	1	425 - 434	R.YYTVLFGVSR.S
989	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	142	534.34	1066.66	534.33	1066.65	2	13.54	15	11151	39	1	447 - 456	R.ALGLALERPK.S
1108	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	121	584.34	1166.67	584.34	1166.66	2	13.66	14.5	18464	21	1	347 - 357	K.VIPGYGHGVLR.N
1108	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	170	431.59	1291.76	431.59	1291.74	3	17.15	16	20454	15	1	216 - 226	R.VPVVAAYVYRR.M
1108	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	252	778.96	1555.91	778.95	1555.89	2	13.24	22.3	7096	35	3	386 - 399	K.LYEVVPPVLTELGK.V
1108	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	235	602.83	1203.64	602.82	1203.63	2	10.91	19.9	12430	47	3	425 - 434	R.YYTVLFGVSR.S
1108	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	251	778.96	1555.91	778.95	1555.89	2	13.66	22.2	6498	30	3	386 - 399	K.LYEVVPPVLTELGK.V
1108	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	146	534.34	1066.66	534.33	1066.65	2	13.97	15.2	22134	47	2	447 - 456	R.ALGLALERPK.S
1108	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	144	534.34	1066.66	534.33	1066.65	2	13.30	15.1	19332	55	2	447 - 456	R.ALGLALERPK.S
1108	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	207	568.83	1135.65	568.83	1135.64	2	13.67	17.5	14001	50	3	216 - 225	R.VPVVAAYVYR.R
1108	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	250	778.96	1555.91	778.95	1555.89	2	13.52	22.2	5284	32	3	386 - 399	K.LYEVVPPVLTELGK.V
1108	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	99	516.27	1030.53	516.26	1030.51	2	13.98	14	11695	38	3	102 - 110	R.GLSIPECQK.V	Carbamidomethyl: 7
1108	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	205	568.83	1135.65	568.83	1135.64	2	10.26	17.4	4713	54	3	216 - 225	R.VPVVAAYVYR.R
1108	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	242	754.92	1507.83	754.91	1507.80	2	15.08	20.5	8129	18	1	373 - 385	K.HLPDDPLFQLVSK.L
1108	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	102	516.27	1030.53	516.26	1030.51	2	16.93	14.1	27230	37	3	102 - 110	R.GLSIPECQK.V	Carbamidomethyl: 7
1108	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	104	516.27	1030.53	516.26	1030.51	2	16.34	14.1	18467	20	3	102 - 110	R.GLSIPECQK.V	Carbamidomethyl: 7
1108	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	244	724.38	1446.75	724.37	1446.73	2	13.72	20.6	5165	60	1	435 - 446	R.SLGICSQLIWDR.A	Carbamidomethyl: 5
1108	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	239	714.69	2141.06	714.68	2141.03	3	17.44	20.3	3442	58	1	199 - 215	K.SKFWEPTYEDCLNLIAR.V	Carbamidomethyl: 11
1108	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	92	607.35	606.35	607.34	606.34	1	13.17	13.8	8135	21	1	368 - 372	R.EFALK.H
1108	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	128	442.76	1767.00	442.75	1766.98	4	13.70	14.7	5153	22	1	341 - 357	K.TLNSGKVIPGYGHGVLR.N
1108	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	236	602.83	1203.64	602.82	1203.63	2	12.71	20	20194	54	3	425 - 434	R.YYTVLFGVSR.S
1108	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	206	568.83	1135.65	568.83	1135.64	2	12.77	17.4	9488	64	3	216 - 225	R.VPVVAAYVYR.R
1108	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	234	602.83	1203.64	602.82	1203.63	2	11.16	19.9	4542	32	3	425 - 434	R.YYTVLFGVSR.S
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	296	431.59	1291.75	431.59	1291.74	3	8.97	15.9	12378	31	2	216 - 226	R.VPVVAAYVYRR.M
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	77	452.25	902.48	452.24	902.47	2	10.26	10.8	21820	49	3	139 - 146	K.EQVEALSK.D
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	504	573.64	1717.91	573.64	1717.89	3	11.56	20.8	11227	45	1	65 - 80	K.VQLGNITVDMVIGGMR.G	Oxidation: 10
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	220	584.34	1166.67	584.34	1166.66	2	11.28	14.2	63193	50	2	347 - 357	K.VIPGYGHGVLR.N
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	468	602.83	1203.64	602.82	1203.63	2	13.04	19.8	9544	55	3	425 - 434	R.YYTVLFGVSR.S
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	494	724.38	1446.75	724.37	1446.73	2	14.96	20.4	3819	40	3	435 - 446	R.SLGICSQLIWDR.A	Carbamidomethyl: 5
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	370	573.03	2288.07	573.02	2288.04	4	12.77	17.6	15412	35	1	239 - 258	K.SLDYGANFSHMLGFDDEKVK.E	Oxidation: 11
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	229	724.38	723.37	724.37	723.36	1	14.26	14.4	58533	18	2	336 - 340	K.EYVWK.T
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	481	714.69	2141.06	714.68	2141.03	3	15.30	20.2	23679	82	3	199 - 215	K.SKFWEPTYEDCLNLIAR.V	Carbamidomethyl: 11
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	350	568.83	1135.65	568.83	1135.64	2	9.39	17.2	19064	70	3	216 - 225	R.VPVVAAYVYR.R
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	464	602.83	1203.65	602.82	1203.63	2	14.43	19.7	5533	63	3	425 - 434	R.YYTVLFGVSR.S
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	193	607.35	606.34	607.34	606.34	1	10.59	13.6	6934	21	3	368 - 372	R.EFALK.H
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	348	568.83	1135.65	568.83	1135.64	2	8.37	17.1	3740	65	3	216 - 225	R.VPVVAAYVYR.R
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	204	516.27	1030.52	516.26	1030.51	2	11.35	13.9	7118	41	3	102 - 110	R.GLSIPECQK.V	Carbamidomethyl: 7
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	405	640.83	2559.30	640.82	2559.26	4	16.05	18.4	49243	44	1	402 - 424	K.NPWPNVDAHSGVLLNHYGLTEAR.Y
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	530	642.98	1925.93	642.97	1925.90	3	14.00	21.6	22354	85	2	201 - 215	K.FWEPTYEDCLNLIAR.V	Carbamidomethyl: 9
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	547	778.96	1555.91	778.95	1555.89	2	14.10	22	13588	44	6	386 - 399	K.LYEVVPPVLTELGK.V
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	252	534.34	1066.66	534.33	1066.65	2	10.49	14.9	26722	62	3	447 - 456	R.ALGLALERPK.S
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	479	714.69	2141.06	714.68	2141.03	3	15.01	20.1	7937	51	3	199 - 215	K.SKFWEPTYEDCLNLIAR.V	Carbamidomethyl: 11
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	512	859.96	1717.91	859.95	1717.89	2	15.17	21.1	52661	113	6	65 - 80	K.VQLGNITVDMVIGGMR.G	Oxidation: 15
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	510	859.96	1717.91	859.95	1717.89	2	13.81	21.1	73393	95	6	65 - 80	K.VQLGNITVDMVIGGMR.G	Oxidation: 15
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	504	573.64	1717.91	573.64	1717.89	3	11.56	20.8	11227	16	1	65 - 80	K.VQLGNITVDMVIGGMR.G	Oxidation: 15
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	512	859.96	1717.91	859.95	1717.89	2	15.17	21.1	52661	48	6	65 - 80	K.VQLGNITVDMVIGGMR.G	Oxidation: 10
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	563	851.96	1701.91	851.95	1701.89	2	13.12	22.7	12942	63	2	65 - 80	K.VQLGNITVDMVIGGMR.G
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	549	778.96	1555.91	778.95	1555.89	2	14.56	22.1	5377	54	6	386 - 399	K.LYEVVPPVLTELGK.V
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	545	778.96	1555.91	778.95	1555.89	2	14.83	22	76900	56	6	386 - 399	K.LYEVVPPVLTELGK.V
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	223	584.34	1166.67	584.34	1166.66	2	9.62	14.3	16186	47	2	347 - 357	K.VIPGYGHGVLR.N
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	490	754.92	1507.83	754.91	1507.80	2	14.89	20.4	19708	53	3	373 - 385	K.HLPDDPLFQLVSK.L
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	462	1204.65	1203.65	1204.64	1203.63	1	14.78	19.7	3496	18	1	425 - 434	R.YYTVLFGVSR.S
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	75	903.49	902.48	903.48	902.47	1	11.45	10.7	24239	42	2	139 - 146	K.EQVEALSK.D
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	505	859.96	1717.91	859.95	1717.89	2	12.08	20.9	9775	65	6	65 - 80	K.VQLGNITVDMVIGGMR.G	Oxidation: 10
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	564	851.96	1701.91	851.95	1701.89	2	12.87	22.7	6650	84	2	65 - 80	K.VQLGNITVDMVIGGMR.G
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	78	903.49	902.48	903.48	902.47	1	10.27	10.8	73319	40	2	139 - 146	K.EQVEALSK.D
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	226	617.31	1848.91	617.30	1848.88	3	14.97	14.3	81803	28	1	320 - 335	K.SVVEECGEDISKEQLK.E	Carbamidomethyl: 6
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	71	452.25	902.48	452.24	902.47	2	9.44	10.6	8417	49	3	139 - 146	K.EQVEALSK.D
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	246	534.34	1066.66	534.33	1066.65	2	10.32	14.8	35776	57	3	447 - 456	R.ALGLALERPK.S
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	503	859.96	1717.91	859.95	1717.89	2	11.57	20.8	28303	58	6	65 - 80	K.VQLGNITVDMVIGGMR.G	Oxidation: 15
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	342	792.42	1582.82	792.40	1582.80	2	15.10	17	16467	55	3	42 - 54	K.SQLQELIPEQQDR.L
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	480	1071.54	2141.06	1071.52	2141.03	2	15.02	20.1	6302	22	1	199 - 215	K.SKFWEPTYEDCLNLIAR.V	Carbamidomethyl: 11
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	444	867.96	1733.91	867.95	1733.88	2	16.99	19.3	10347	61	2	65 - 80	K.VQLGNITVDMVIGGMR.G	Oxidation: 10
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	532	642.98	1925.92	642.97	1925.90	3	13.58	21.6	4474	77	2	201 - 215	K.FWEPTYEDCLNLIAR.V	Carbamidomethyl: 9
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	557	1057.78	4227.10	1057.76	4227.03	4	17.28	22.3	14612	38	3	152 - 190	R.AAVPDYVYNAIDALPSTAHPMTQFASGVMALQVQSEFQK.A	Oxidation: 21
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	560	1057.78	4227.10	1057.76	4227.03	4	15.74	22.3	5494	24	3	152 - 190	R.AAVPDYVYNAIDALPSTAHPMTQFASGVMALQVQSEFQK.A	Oxidation: 21
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	539	778.96	1555.90	778.95	1555.89	2	11.08	21.8	41220	29	6	386 - 399	K.LYEVVPPVLTELGK.V
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	492	724.38	1446.75	724.37	1446.73	2	15.48	20.4	16431	66	3	435 - 446	R.SLGICSQLIWDR.A	Carbamidomethyl: 5
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	511	859.96	1717.91	859.95	1717.89	2	15.45	21.1	32465	54	6	65 - 80	K.VQLGNITVDMVIGGMR.G	Oxidation: 10
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	503	859.96	1717.91	859.95	1717.89	2	11.57	20.8	28303	82	6	65 - 80	K.VQLGNITVDMVIGGMR.G	Oxidation: 10
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	555	1057.78	4227.10	1057.76	4227.03	4	16.99	22.2	14666	42	3	152 - 190	R.AAVPDYVYNAIDALPSTAHPMTQFASGVMALQVQSEFQK.A	Oxidation: 21
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	487	754.92	1507.83	754.91	1507.80	2	14.52	20.3	115360	61	3	373 - 385	K.HLPDDPLFQLVSK.L
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	586	706.37	2116.08	706.36	2116.05	3	13.28	24.1	9085	50	2	81 - 99	R.GMTGLLWETSLLDPEEGIR.F
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	550	519.64	1555.91	519.64	1555.89	3	14.55	22.1	4727	75	3	386 - 399	K.LYEVVPPVLTELGK.V
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	377	697.62	2786.46	697.61	2786.43	4	13.33	17.8	8147	17	2	400 - 424	K.VKNPWPNVDAHSGVLLNHYGLTEAR.Y
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	150	438.92	1313.73	438.91	1313.72	3	8.62	12.7	9775	52	3	135 - 146	K.VPSKEQVEALSK.D
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	202	516.27	1030.52	516.26	1030.51	2	11.48	13.8	14612	41	3	102 - 110	R.GLSIPECQK.V	Carbamidomethyl: 7
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	491	503.62	1507.83	503.61	1507.80	3	14.90	20.4	28090	52	3	373 - 385	K.HLPDDPLFQLVSK.L
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	488	503.62	1507.83	503.61	1507.80	3	14.50	20.3	39564	60	3	373 - 385	K.HLPDDPLFQLVSK.L
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	489	724.38	1446.75	724.37	1446.73	2	13.59	20.3	25191	62	3	435 - 446	R.SLGICSQLIWDR.A	Carbamidomethyl: 5
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	293	431.59	1291.75	431.59	1291.74	3	8.51	15.9	10589	33	2	216 - 226	R.VPVVAAYVYRR.M
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	501	859.96	1717.91	859.95	1717.89	2	12.56	20.8	6153	55	6	65 - 80	K.VQLGNITVDMVIGGMR.G	Oxidation: 15
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	339	792.42	1582.82	792.40	1582.80	2	13.63	16.9	37904	70	3	42 - 54	K.SQLQELIPEQQDR.L
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	440	867.96	1733.91	867.95	1733.88	2	16.55	19.2	11573	99	2	65 - 80	K.VQLGNITVDMVIGGMR.G	Oxidation: 10
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	74	452.25	902.48	452.24	902.47	2	11.43	10.7	6303	49	3	139 - 146	K.EQVEALSK.D
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	441	578.98	1733.91	578.97	1733.88	3	16.53	19.2	18749	66	1	65 - 80	K.VQLGNITVDMVIGGMR.G	Oxidation: 10
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	531	963.97	1925.92	963.96	1925.90	2	13.59	21.6	11175	69	3	201 - 215	K.FWEPTYEDCLNLIAR.V	Carbamidomethyl: 9
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	249	534.34	1066.66	534.33	1066.65	2	11.82	14.9	16266	62	3	447 - 456	R.ALGLALERPK.S
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	583	1059.05	2116.08	1059.03	2116.05	2	12.14	24.1	13540	75	3	81 - 99	R.GMTGLLWETSLLDPEEGIR.F
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	584	706.37	2116.08	706.36	2116.05	3	12.13	24.1	58533	60	2	81 - 99	R.GMTGLLWETSLLDPEEGIR.F
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	486	714.69	2141.06	714.68	2141.03	3	15.17	20.2	32685	53	3	199 - 215	K.SKFWEPTYEDCLNLIAR.V	Carbamidomethyl: 11
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	196	607.35	606.34	607.34	606.34	1	10.77	13.7	12292	24	3	368 - 372	R.EFALK.H
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	345	792.42	1582.82	792.40	1582.80	2	13.63	17	4429	52	3	42 - 54	K.SQLQELIPEQQDR.L
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	147	438.92	1313.73	438.91	1313.72	3	6.57	12.6	5005	66	3	135 - 146	K.VPSKEQVEALSK.D
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	206	1031.53	1030.52	1031.52	1030.51	1	11.35	13.9	5875	21	1	102 - 110	R.GLSIPECQK.V	Carbamidomethyl: 7
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	485	503.61	1507.82	503.61	1507.80	3	11.43	20.2	40151	59	3	373 - 385	K.HLPDDPLFQLVSK.L
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	153	438.92	1313.73	438.91	1313.72	3	10.85	12.7	13180	61	3	135 - 146	K.VPSKEQVEALSK.D
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	347	568.83	1135.64	568.83	1135.64	2	3.14	17.1	7899	63	3	216 - 225	R.VPVVAAYVYR.R
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	534	963.97	1925.93	963.96	1925.90	2	15.35	21.7	6885	40	3	201 - 215	K.FWEPTYEDCLNLIAR.V	Carbamidomethyl: 9
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	484	754.92	1507.82	754.91	1507.80	2	11.44	20.2	170506	48	3	373 - 385	K.HLPDDPLFQLVSK.L
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	573	1067.04	2132.07	1067.03	2132.05	2	12.92	23.1	33405	82	3	81 - 99	R.GMTGLLWETSLLDPEEGIR.F	Oxidation: 2
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	375	558.30	2786.46	558.29	2786.43	5	12.40	17.7	23768	30	2	400 - 424	K.VKNPWPNVDAHSGVLLNHYGLTEAR.Y
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	571	1067.05	2132.08	1067.03	2132.05	2	13.88	23	11078	91	3	81 - 99	R.GMTGLLWETSLLDPEEGIR.F	Oxidation: 2
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	378	558.30	2786.46	558.29	2786.43	5	13.33	17.8	2724	22	2	400 - 424	K.VKNPWPNVDAHSGVLLNHYGLTEAR.Y
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	585	1059.05	2116.08	1059.03	2116.05	2	13.29	24.1	32749	79	3	81 - 99	R.GMTGLLWETSLLDPEEGIR.F
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	461	602.83	1203.65	602.82	1203.63	2	14.76	19.7	11478	54	3	425 - 434	R.YYTVLFGVSR.S
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	501	859.96	1717.91	859.95	1717.89	2	12.56	20.8	6153	72	6	65 - 80	K.VQLGNITVDMVIGGMR.G	Oxidation: 10
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	510	859.96	1717.91	859.95	1717.89	2	13.81	21.1	73393	58	6	65 - 80	K.VQLGNITVDMVIGGMR.G	Oxidation: 10
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	582	1059.05	2116.08	1059.03	2116.05	2	11.84	24	15368	73	3	81 - 99	R.GMTGLLWETSLLDPEEGIR.F
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	537	778.96	1555.90	778.95	1555.89	2	11.71	21.8	15342	19	6	386 - 399	K.LYEVVPPVLTELGK.V
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	189	607.35	606.34	607.34	606.34	1	9.04	13.5	12887	26	3	368 - 372	R.EFALK.H
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	535	778.96	1555.91	778.95	1555.89	2	12.17	21.7	6784	33	6	386 - 399	K.LYEVVPPVLTELGK.V
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	282	498.23	1491.67	498.22	1491.65	3	15.02	15.6	18745	52	1	457 - 468	K.SVTMDWLEAHCK.K	Oxidation: 4
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	207	516.27	1030.52	516.26	1030.51	2	11.15	13.9	4063	53	3	102 - 110	R.GLSIPECQK.V	Carbamidomethyl: 7
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	578	711.70	2132.07	711.69	2132.05	3	13.44	23.2	16186	66	2	81 - 99	R.GMTGLLWETSLLDPEEGIR.F	Oxidation: 2
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	529	963.97	1925.93	963.96	1925.90	2	14.01	21.6	15944	65	3	201 - 215	K.FWEPTYEDCLNLIAR.V	Carbamidomethyl: 9
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	32	467.22	932.42	466.72	931.42	2	1066.93	9.7	8623	24	1	230 - 238	K.NGDSIPSDK.S
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	546	519.64	1555.91	519.64	1555.89	3	14.81	22	14163	79	3	386 - 399	K.LYEVVPPVLTELGK.V
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	574	711.70	2132.07	711.69	2132.05	3	12.92	23.1	23330	81	2	81 - 99	R.GMTGLLWETSLLDPEEGIR.F	Oxidation: 2
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	505	859.96	1717.91	859.95	1717.89	2	12.08	20.9	9775	44	6	65 - 80	K.VQLGNITVDMVIGGMR.G	Oxidation: 15
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	227	724.38	723.37	724.37	723.36	1	14.26	14.4	15368	38	2	336 - 340	K.EYVWK.T
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	548	519.64	1555.91	519.64	1555.89	3	14.08	22	6934	60	3	386 - 399	K.LYEVVPPVLTELGK.V
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	576	1067.04	2132.07	1067.03	2132.05	2	13.44	23.2	11915	100	3	81 - 99	R.GMTGLLWETSLLDPEEGIR.F	Oxidation: 2
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	374	697.62	2786.46	697.61	2786.43	4	12.40	17.7	5269	17	2	400 - 424	K.VKNPWPNVDAHSGVLLNHYGLTEAR.Y
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	369	763.70	2288.07	763.69	2288.04	3	12.79	17.6	3893	16	1	239 - 258	K.SLDYGANFSHMLGFDDEKVK.E	Oxidation: 11
1162	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	511	859.96	1717.91	859.95	1717.89	2	15.45	21.1	32465	117	6	65 - 80	K.VQLGNITVDMVIGGMR.G	Oxidation: 15
1221	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	150	646.88	1291.74	646.88	1291.74	2	3.15	15.8	3837	25	1	216 - 226	R.VPVVAAYVYRR.M
1221	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	130	534.33	1066.65	534.33	1066.65	2	1.30	15	11055	43	2	447 - 456	R.ALGLALERPK.S
1221	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	128	534.33	1066.66	534.33	1066.65	2	5.04	14.9	6087	46	2	447 - 456	R.ALGLALERPK.S
1221	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	234	602.82	1203.63	602.82	1203.63	2	0.99	19.8	6384	49	3	425 - 434	R.YYTVLFGVSR.S
1221	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	199	568.83	1135.64	568.83	1135.64	2	3.94	17.3	6971	39	3	216 - 225	R.VPVVAAYVYR.R
1221	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	236	602.82	1203.63	602.82	1203.63	2	3.13	19.8	6200	52	3	425 - 434	R.YYTVLFGVSR.S
1221	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	151	431.59	1291.74	431.59	1291.74	3	1.91	15.9	18755	21	2	216 - 226	R.VPVVAAYVYRR.M
1221	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	232	602.82	1203.63	602.82	1203.63	2	2.02	19.8	4482	46	3	425 - 434	R.YYTVLFGVSR.S
1221	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	196	568.83	1135.64	568.83	1135.64	2	-0.57	17.3	6132	58	3	216 - 225	R.VPVVAAYVYR.R
1221	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	193	568.83	1135.64	568.83	1135.64	2	2.08	17.2	3876	41	3	216 - 225	R.VPVVAAYVYR.R
1221	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	149	431.59	1291.74	431.59	1291.74	3	2.16	15.8	10900	15	2	216 - 226	R.VPVVAAYVYRR.M
1221	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	83	516.27	1030.52	516.26	1030.51	2	7.34	13.8	5242	16	3	102 - 110	R.GLSIPECQK.V	Carbamidomethyl: 7
1221	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	89	516.27	1030.52	516.26	1030.51	2	5.71	13.9	7743	17	3	102 - 110	R.GLSIPECQK.V	Carbamidomethyl: 7
1221	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	86	516.26	1030.52	516.26	1030.51	2	3.19	13.8	11451	48	3	102 - 110	R.GLSIPECQK.V	Carbamidomethyl: 7
1390	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	500	778.95	1555.88	778.95	1555.89	2	-2.04	22.2	5749	22	1	386 - 399	K.LYEVVPPVLTELGK.V
1390	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	60	452.24	902.47	452.24	902.47	2	-1.15	11.2	23045	24	1	139 - 146	K.EQVEALSK.D
1390	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	329	568.83	1135.64	568.83	1135.64	2	-2.75	17.5	26696	48	1	216 - 225	R.VPVVAAYVYR.R
1390	AT2G44350.1	ATCS (ATP citrate synthase)	citrate synthase	c) pyruvate metabolism & TCA cycle	mitochondria	435	602.82	1203.63	602.82	1203.63	2	-2.32	20	34057	37	1	425 - 434	R.YYTVLFGVSR.S
496	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	2	476.72	951.42	476.72	951.43	2	-7.81	12.1	7549	32	4	38 - 45	R.GLDNYNEK.Y
496	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	5	523.24	1044.47	523.25	1044.48	2	-7.07	13.2	4494	28	2	24 - 32	K.STFSMETVK.T	Oxidation: 5
496	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	6	523.24	1044.47	523.25	1044.48	2	-7.03	13.3	7026	17	2	24 - 32	K.STFSMETVK.T	Oxidation: 5
496	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	3	476.72	951.42	476.72	951.43	2	-6.41	12.1	8816	39	4	38 - 45	R.GLDNYNEK.Y
496	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	61	510.29	1018.56	510.29	1018.57	2	-10.49	17.5	3940	16	1	15 - 23	K.VTELPGYIK.S
496	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	1	476.72	951.42	476.72	951.43	2	-5.92	12	4600	45	4	38 - 45	R.GLDNYNEK.Y
496	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	4	476.72	951.42	476.72	951.43	2	-6.89	12.2	7028	21	4	38 - 45	R.GLDNYNEK.Y
765	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	114	510.29	1018.56	510.29	1018.57	2	-8.97	15.9	36504	40	2	15 - 23	K.VTELPGYIK.S
765	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	22	476.72	951.42	476.72	951.43	2	-9.36	10.7	54665	31	3	38 - 45	R.GLDNYNEK.Y
765	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	19	476.72	951.42	476.72	951.43	2	-8.99	10.6	6501	35	3	38 - 45	R.GLDNYNEK.Y
765	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	9	461.75	921.49	461.76	921.50	2	-9.52	10.1	7390	33	2	5 - 11	R.RVYSEIR.G
765	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	31	523.24	1044.47	523.25	1044.48	2	-7.05	11.7	55440	56	3	24 - 32	K.STFSMETVK.T	Oxidation: 5
765	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	33	523.24	1044.47	523.25	1044.48	2	-7.18	11.7	74955	57	3	24 - 32	K.STFSMETVK.T	Oxidation: 5
765	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	11	461.76	921.50	461.76	921.50	2	-7.83	10.2	13321	24	2	5 - 11	R.RVYSEIR.G
765	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	77	515.25	1028.48	515.25	1028.48	2	-6.52	14.6	16450	34	1	24 - 32	K.STFSMETVK.T
765	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	20	476.72	951.42	476.72	951.43	2	-8.25	10.6	45319	41	3	38 - 45	R.GLDNYNEK.Y
765	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	69	574.34	1146.66	574.34	1146.66	2	-7.06	14.4	18227	26	2	14 - 23	K.KVTELPGYIK.S
765	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	30	523.24	1044.47	523.25	1044.48	2	-6.28	11.6	7765	21	3	24 - 32	K.STFSMETVK.T	Oxidation: 5
765	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	66	574.34	1146.66	574.34	1146.66	2	-7.66	14.3	34629	77	2	14 - 23	K.KVTELPGYIK.S
765	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	111	510.29	1018.56	510.29	1018.57	2	-9.18	15.8	57384	43	2	15 - 23	K.VTELPGYIK.S
823	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	56	1045.48	1044.47	1045.49	1044.48	1	-7.70	11.8	24133	40	2	24 - 32	K.STFSMETVK.T	Oxidation: 5
823	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	129	515.24	1028.47	515.25	1028.48	2	-11.47	14.7	19384	39	3	24 - 32	K.STFSMETVK.T
823	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	155	510.28	1018.55	510.29	1018.57	2	-18.25	15.7	3428	33	3	15 - 23	K.VTELPGYIK.S
823	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	112	574.33	1146.65	574.34	1146.66	2	-13.61	14.2	17875	45	3	14 - 23	K.KVTELPGYIK.S
823	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	130	515.24	1028.47	515.25	1028.48	2	-10.97	14.7	44848	50	3	24 - 32	K.STFSMETVK.T
823	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	25	476.72	951.42	476.72	951.43	2	-9.97	10.6	9425	33	3	38 - 45	R.GLDNYNEK.Y
823	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	217	682.68	2045.02	682.69	2045.04	3	-11.26	18.2	10107	22	2	15 - 32	K.VTELPGYIKSTFSMETVK.T	Oxidation: 14
823	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	159	1019.57	1018.56	1019.58	1018.57	1	-11.26	15.8	27822	32	3	15 - 23	K.VTELPGYIK.S
823	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	214	682.68	2045.01	682.69	2045.04	3	-12.69	18.2	3887	26	2	15 - 32	K.VTELPGYIKSTFSMETVK.T	Oxidation: 14
823	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	13	461.75	921.49	461.76	921.50	2	-13.65	10.2	4696	17	3	5 - 11	R.RVYSEIR.G
823	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	65	487.58	1459.71	487.58	1459.72	3	-9.98	12.2	20917	24	2	24 - 36	K.STFSMETVKTSVK.R	Oxidation: 5
823	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	64	487.58	1459.71	487.58	1459.72	3	-9.88	12.2	13093	28	2	24 - 36	K.STFSMETVKTSVK.R	Oxidation: 5
823	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	14	461.75	921.49	461.76	921.50	2	-11.42	10.2	20048	20	3	5 - 11	R.RVYSEIR.G
823	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	53	523.24	1044.47	523.25	1044.48	2	-9.34	11.7	69966	46	3	24 - 32	K.STFSMETVK.T	Oxidation: 5
823	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	55	523.24	1044.47	523.25	1044.48	2	-7.70	11.8	251146	50	3	24 - 32	K.STFSMETVK.T	Oxidation: 5
823	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	4	476.26	950.51	476.27	950.52	2	-11.66	9.4	32894	47	3	6 - 13	R.VYSEIRGK.K
823	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	118	574.33	1146.65	574.34	1146.66	2	-12.91	14.4	57047	53	3	14 - 23	K.KVTELPGYIK.S
823	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	1	476.26	950.51	476.27	950.52	2	-12.14	9.4	4016	37	3	6 - 13	R.VYSEIRGK.K
823	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	115	574.33	1146.65	574.34	1146.66	2	-12.91	14.3	69960	49	3	14 - 23	K.KVTELPGYIK.S
823	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	26	476.72	951.42	476.72	951.43	2	-10.50	10.7	58350	29	3	38 - 45	R.GLDNYNEK.Y
823	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	28	476.72	951.42	476.72	951.43	2	-9.07	10.7	224776	29	3	38 - 45	R.GLDNYNEK.Y
823	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	54	1045.48	1044.47	1045.49	1044.48	1	-9.34	11.7	4300	16	2	24 - 32	K.STFSMETVK.T	Oxidation: 5
823	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	158	1019.57	1018.56	1019.58	1018.57	1	-11.79	15.8	12625	48	3	15 - 23	K.VTELPGYIK.S
823	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	128	515.24	1028.47	515.25	1028.48	2	-10.85	14.7	5895	37	3	24 - 32	K.STFSMETVK.T
823	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	12	554.77	1107.52	554.77	1107.53	2	-11.91	9.9	13506	35	4	37 - 45	K.RGLDNYNEK.Y
823	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	9	554.77	1107.52	554.77	1107.53	2	-11.77	9.8	4645	38	4	37 - 45	K.RGLDNYNEK.Y
823	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	17	461.75	921.49	461.76	921.50	2	-12.79	10.3	38935	20	3	5 - 11	R.RVYSEIR.G
823	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	157	510.29	1018.56	510.29	1018.57	2	-11.79	15.8	108634	41	3	15 - 23	K.VTELPGYIK.S
823	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	10	554.77	1107.52	554.77	1107.53	2	-12.98	9.8	12140	31	4	37 - 45	K.RGLDNYNEK.Y
823	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	52	523.24	1044.47	523.25	1044.48	2	-9.99	11.7	12123	43	3	24 - 32	K.STFSMETVK.T	Oxidation: 5
823	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	29	952.43	951.42	952.44	951.43	1	-9.08	10.7	39245	42	3	38 - 45	R.GLDNYNEK.Y
823	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	156	510.29	1018.56	510.29	1018.57	2	-11.40	15.7	27809	45	3	15 - 23	K.VTELPGYIK.S
823	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	162	1019.57	1018.56	1019.58	1018.57	1	-10.96	15.9	18028	18	3	15 - 23	K.VTELPGYIK.S
823	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	30	952.43	951.42	952.44	951.43	1	-9.23	10.8	45543	34	3	38 - 45	R.GLDNYNEK.Y
823	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	132	1029.48	1028.47	1029.49	1028.48	1	-11.21	14.8	11655	16	2	24 - 32	K.STFSMETVK.T
823	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	131	1029.48	1028.47	1029.49	1028.48	1	-10.98	14.7	7180	20	2	24 - 32	K.STFSMETVK.T
823	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	11	554.77	1107.52	554.77	1107.53	2	-12.08	9.8	16401	35	4	37 - 45	K.RGLDNYNEK.Y
823	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	134	482.24	1443.71	482.25	1443.73	3	-12.65	14.8	3626	23	1	24 - 36	K.STFSMETVKTSVK.R
823	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	27	952.43	951.42	952.44	951.43	1	-10.50	10.7	4043	50	3	38 - 45	R.GLDNYNEK.Y
823	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	2	476.26	950.51	476.27	950.52	2	-11.17	9.4	14502	50	3	6 - 13	R.VYSEIRGK.K
871	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	58	523.24	1044.47	523.25	1044.48	2	-12.80	11.9	28395	34	4	24 - 32	K.STFSMETVK.T	Oxidation: 5
871	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	132	574.33	1146.65	574.34	1146.66	2	-10.56	14.3	15958	57	2	14 - 23	K.KVTELPGYIK.S
871	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	28	476.72	951.42	476.72	951.43	2	-11.82	10.8	54652	32	5	38 - 45	R.GLDNYNEK.Y
871	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	14	461.75	921.49	461.76	921.50	2	-14.45	10.3	12354	26	3	5 - 11	R.RVYSEIR.G
871	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	183	510.29	1018.56	510.29	1018.57	2	-11.26	15.8	74126	39	3	15 - 23	K.VTELPGYIK.S
871	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	51	523.24	1044.47	523.25	1044.48	2	-12.53	11.8	57054	51	4	24 - 32	K.STFSMETVK.T	Oxidation: 5
871	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	147	515.24	1028.47	515.25	1028.48	2	-12.25	14.7	4132	31	3	24 - 32	K.STFSMETVK.T
871	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	149	515.24	1028.47	515.25	1028.48	2	-9.76	14.8	28119	46	3	24 - 32	K.STFSMETVK.T
871	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	148	515.24	1028.47	515.25	1028.48	2	-11.04	14.8	16871	37	3	24 - 32	K.STFSMETVK.T
871	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	180	510.28	1018.56	510.29	1018.57	2	-14.49	15.8	9448	42	3	15 - 23	K.VTELPGYIK.S
871	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	50	523.24	1044.47	523.25	1044.48	2	-9.19	11.7	6411	37	4	24 - 32	K.STFSMETVK.T	Oxidation: 5
871	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	54	523.24	1044.47	523.25	1044.48	2	-12.13	11.8	80601	54	4	24 - 32	K.STFSMETVK.T	Oxidation: 5
871	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	136	574.33	1146.65	574.34	1146.66	2	-10.39	14.4	18121	44	2	14 - 23	K.KVTELPGYIK.S
871	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	23	476.72	951.42	476.72	951.43	2	-9.20	10.7	20019	30	5	38 - 45	R.GLDNYNEK.Y
871	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	12	461.75	921.49	461.76	921.50	2	-13.13	10.3	10882	22	3	5 - 11	R.RVYSEIR.G
871	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	186	510.29	1018.56	510.29	1018.57	2	-11.16	15.9	81840	37	3	15 - 23	K.VTELPGYIK.S
871	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	11	461.75	921.49	461.76	921.50	2	-12.68	10.3	4048	28	3	5 - 11	R.RVYSEIR.G
871	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	29	476.72	951.42	476.72	951.43	2	-12.22	10.9	30185	18	5	38 - 45	R.GLDNYNEK.Y
871	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	27	952.43	951.42	952.44	951.43	1	-12.20	10.8	5906	29	1	38 - 45	R.GLDNYNEK.Y
871	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	24	476.72	951.42	476.72	951.43	2	-10.33	10.7	47343	29	5	38 - 45	R.GLDNYNEK.Y
871	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	22	476.72	951.42	476.72	951.43	2	-8.48	10.7	7268	41	5	38 - 45	R.GLDNYNEK.Y
917	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	80	510.29	1018.57	510.29	1018.57	2	1.71	15.8	5525	32	2	15 - 23	K.VTELPGYIK.S
917	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	3	476.73	951.44	476.72	951.43	2	6.43	10.8	7113	41	2	38 - 45	R.GLDNYNEK.Y
917	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	7	523.25	1044.48	523.25	1044.48	2	1.55	11.8	8793	32	3	24 - 32	K.STFSMETVK.T	Oxidation: 5
917	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	8	523.25	1044.49	523.25	1044.48	2	5.80	11.9	6910	23	3	24 - 32	K.STFSMETVK.T	Oxidation: 5
917	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	82	510.29	1018.57	510.29	1018.57	2	-0.85	15.9	8262	30	2	15 - 23	K.VTELPGYIK.S
917	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	6	523.25	1044.48	523.25	1044.48	2	3.16	11.8	7452	25	3	24 - 32	K.STFSMETVK.T	Oxidation: 5
917	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	2	476.73	951.44	476.72	951.43	2	7.04	10.7	6214	22	2	38 - 45	R.GLDNYNEK.Y
1370	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	11	476.72	951.43	476.72	951.43	2	-4.06	10.9	7123	23	1	38 - 45	R.GLDNYNEK.Y
1370	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	28	523.24	1044.47	523.25	1044.48	2	-4.89	11.9	10918	29	1	24 - 32	K.STFSMETVK.T	Oxidation: 5
1478	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	19	476.72	951.42	476.72	951.43	2	-9.15	10.6	4681	19	1	38 - 45	R.GLDNYNEK.Y
1478	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	44	523.24	1044.47	523.25	1044.48	2	-8.21	11.6	7306	32	2	24 - 32	K.STFSMETVK.T	Oxidation: 5
1478	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	47	523.24	1044.47	523.25	1044.48	2	-6.78	11.6	10016	25	2	24 - 32	K.STFSMETVK.T	Oxidation: 5
1532	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	186	510.28	1018.55	510.29	1018.57	2	-16.63	15.7	15463	32	2	15 - 23	K.VTELPGYIK.S
1532	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	188	510.29	1018.56	510.29	1018.57	2	-14.16	15.8	17152	40	2	15 - 23	K.VTELPGYIK.S
1532	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	42	523.24	1044.47	523.25	1044.48	2	-13.14	11.8	3615	49	2	24 - 32	K.STFSMETVK.T	Oxidation: 5
1532	AT4G30010.1	ATP17 (plant specific)	complex V	a) oxidative phosphorylation	NEW mitochondria	39	523.24	1044.46	523.25	1044.48	2	-14.16	11.7	220934	45	2	24 - 32	K.STFSMETVK.T	Oxidation: 5
377	AT1G14450.1	B12-1	complex I	a) oxidative phosphorylation	NEW mitochondria	2	425.21	1272.60	425.21	1272.61	3	-7.39	8.9	8488	28	4	20 - 29	R.KHPMLSNQMR.H	Oxidation: 4
377	AT1G14450.1	B12-1	complex I	a) oxidative phosphorylation	NEW mitochondria	1	425.21	1272.61	425.21	1272.61	3	-1.04	8.9	5177	42	4	20 - 29	R.KHPMLSNQMR.H	Oxidation: 4
377	AT1G14450.1	B12-1	complex I	a) oxidative phosphorylation	NEW mitochondria	4	425.21	1272.60	425.21	1272.61	3	-6.36	9	9038	33	4	20 - 29	R.KHPMLSNQMR.H	Oxidation: 4
377	AT1G14450.1	B12-1	complex I	a) oxidative phosphorylation	NEW mitochondria	116	662.35	1322.69	662.36	1322.70	2	-3.64	17.4	41540	57	2	2 - 13	M.AKPLGTTGEFFR.R
377	AT1G14450.1	B12-1	complex I	a) oxidative phosphorylation	NEW mitochondria	117	441.91	1322.69	441.91	1322.70	3	-3.63	17.4	18549	52	2	2 - 13	M.AKPLGTTGEFFR.R
377	AT1G14450.1	B12-1	complex I	a) oxidative phosphorylation	NEW mitochondria	3	425.21	1272.60	425.21	1272.61	3	-6.62	9	11549	20	4	20 - 29	R.KHPMLSNQMR.H	Oxidation: 4
377	AT1G14450.1	B12-1	complex I	a) oxidative phosphorylation	NEW mitochondria	120	441.91	1322.69	441.91	1322.70	3	-3.13	17.5	10616	56	2	2 - 13	M.AKPLGTTGEFFR.R
377	AT1G14450.1	B12-1	complex I	a) oxidative phosphorylation	NEW mitochondria	119	662.35	1322.69	662.36	1322.70	2	-3.15	17.5	21725	47	2	2 - 13	M.AKPLGTTGEFFR.R
377	AT1G14450.1	B12-1	complex I	a) oxidative phosphorylation	NEW mitochondria	175	683.36	1364.71	683.36	1364.71	2	-1.73	19.9	4531	27	1	2 - 13	M.AKPLGTTGEFFR.R	Acetyl: 1
238	AT2G02510.1	B12-2	complex I	a) oxidative phosphorylation	mitochondria	122	662.35	1322.68	662.36	1322.70	2	-10.75	15.74796667	3720	36	1	2 - 13	M.AKPLGTTGEFFR.R
238	AT2G02510.1	B12-2	complex I	a) oxidative phosphorylation	mitochondria	5	439.54	1315.60	439.55	1315.62	3	-14.24	8.47131667	6086	29	2	55 - 66	K.LMAPSSQSSHQK.Q	Oxidation: 2
238	AT2G02510.1	B12-2	complex I	a) oxidative phosphorylation	mitochondria	3	439.54	1315.60	439.55	1315.62	3	-13.10	8.403975	3845	25	2	55 - 66	K.LMAPSSQSSHQK.Q	Oxidation: 2
238	AT2G02510.1	B12-2	complex I	a) oxidative phosphorylation	mitochondria	121	441.90	1322.68	441.91	1322.70	3	-10.87	15.734575	6366	68	2	2 - 13	M.AKPLGTTGEFFR.R
238	AT2G02510.1	B12-2	complex I	a) oxidative phosphorylation	mitochondria	125	441.90	1322.68	441.91	1322.70	3	-10.42	15.841975	10310	46	2	2 - 13	M.AKPLGTTGEFFR.R
133	AT5G52840.1	B13	complex I	a) oxidative phosphorylation	mitochondria	46	483.25	1928.97	483.26	1929.00	4	-14.39	13.8	16175	20	2	129 - 144	K.HVPQHRPGPLPEQFYK.T
133	AT5G52840.1	B13	complex I	a) oxidative phosphorylation	mitochondria	74	734.38	1466.75	734.39	1466.76	2	-10.60	14.6	6867	23	1	155 - 168	K.TEIPAATPSDPQLK.E
133	AT5G52840.1	B13	complex I	a) oxidative phosphorylation	mitochondria	26	511.92	1532.72	511.92	1532.75	3	-14.42	12.5	11023	54	2	43 - 55	K.EIQAVPEDEGYRK.A
133	AT5G52840.1	B13	complex I	a) oxidative phosphorylation	mitochondria	129	530.79	1059.57	530.80	1059.58	2	-14.77	17.4	25752	38	3	145 - 154	K.TLEGLIAESK.T
133	AT5G52840.1	B13	complex I	a) oxidative phosphorylation	mitochondria	21	405.20	808.39	405.21	808.41	2	-17.34	12.1	9715	65	2	56 - 62	K.AVESFTR.Q
133	AT5G52840.1	B13	complex I	a) oxidative phosphorylation	mitochondria	45	483.25	1928.97	483.26	1929.00	4	-17.56	13.7	2874	23	2	129 - 144	K.HVPQHRPGPLPEQFYK.T
133	AT5G52840.1	B13	complex I	a) oxidative phosphorylation	mitochondria	29	511.92	1532.72	511.92	1532.75	3	-14.52	12.6	8051	37	2	43 - 55	K.EIQAVPEDEGYRK.A
133	AT5G52840.1	B13	complex I	a) oxidative phosphorylation	mitochondria	153	511.29	1020.57	511.30	1020.59	2	-15.14	18.3	49024	55	2	31 - 39	R.AVLIDLYSK.T
133	AT5G52840.1	B13	complex I	a) oxidative phosphorylation	mitochondria	148	770.42	1538.83	770.43	1538.84	2	-10.53	18.2	10648	54	2	16 - 30	K.QTTGIVGLDVVPNAR.A
133	AT5G52840.1	B13	complex I	a) oxidative phosphorylation	mitochondria	127	530.79	1059.57	530.80	1059.58	2	-13.68	17.3	55826	52	3	145 - 154	K.TLEGLIAESK.T
133	AT5G52840.1	B13	complex I	a) oxidative phosphorylation	mitochondria	126	530.79	1059.56	530.80	1059.58	2	-19.35	17.2	4313	65	3	145 - 154	K.TLEGLIAESK.T
133	AT5G52840.1	B13	complex I	a) oxidative phosphorylation	mitochondria	154	1021.58	1020.57	1021.59	1020.59	1	-15.15	18.4	12752	26	1	31 - 39	R.AVLIDLYSK.T
133	AT5G52840.1	B13	complex I	a) oxidative phosphorylation	mitochondria	156	511.29	1020.57	511.30	1020.59	2	-13.75	18.4	16956	55	2	31 - 39	R.AVLIDLYSK.T
133	AT5G52840.1	B13	complex I	a) oxidative phosphorylation	mitochondria	150	770.42	1538.82	770.43	1538.84	2	-12.52	18.3	28081	77	2	16 - 30	K.QTTGIVGLDVVPNAR.A
133	AT5G52840.1	B13	complex I	a) oxidative phosphorylation	mitochondria	18	405.20	808.39	405.21	808.41	2	-17.21	12	12574	57	2	56 - 62	K.AVESFTR.Q
133	AT5G52840.1	B13	complex I	a) oxidative phosphorylation	mitochondria	82	798.90	1595.79	798.91	1595.80	2	-11.99	14.9	11054	51	1	155 - 169	K.TEIPAATPSDPQLKE.-
214	AT5G52840.1	B13	complex I	a) oxidative phosphorylation	mitochondria	62	483.25	1928.98	483.26	1929.00	4	-11.20	13.42819167	21304	28	2	129 - 144	K.HVPQHRPGPLPEQFYK.T
214	AT5G52840.1	B13	complex I	a) oxidative phosphorylation	mitochondria	98	798.90	1595.79	798.91	1595.80	2	-6.27	14.5976	9794	41	2	155 - 169	K.TEIPAATPSDPQLKE.-
214	AT5G52840.1	B13	complex I	a) oxidative phosphorylation	mitochondria	130	589.67	1765.99	589.68	1766.01	3	-10.72	16.625875	4258	39	2	14 - 30	K.VKQTTGIVGLDVVPNAR.A
214	AT5G52840.1	B13	complex I	a) oxidative phosphorylation	mitochondria	170	511.29	1020.57	511.30	1020.59	2	-10.85	18.1484	49138	59	2	31 - 39	R.AVLIDLYSK.T
214	AT5G52840.1	B13	complex I	a) oxidative phosphorylation	mitochondria	167	770.42	1538.83	770.43	1538.84	2	-6.24	18.05438333	22575	81	2	16 - 30	K.QTTGIVGLDVVPNAR.A
214	AT5G52840.1	B13	complex I	a) oxidative phosphorylation	mitochondria	32	405.21	808.40	405.21	808.41	2	-13.41	11.6987	15323	60	2	56 - 62	K.AVESFTR.Q
214	AT5G52840.1	B13	complex I	a) oxidative phosphorylation	mitochondria	45	511.92	1532.73	511.92	1532.75	3	-9.71	12.23803333	10758	37	2	43 - 55	K.EIQAVPEDEGYRK.A
214	AT5G52840.1	B13	complex I	a) oxidative phosphorylation	mitochondria	146	530.79	1059.57	530.80	1059.58	2	-11.82	17.21876667	19951	60	4	145 - 154	K.TLEGLIAESK.T
214	AT5G52840.1	B13	complex I	a) oxidative phosphorylation	mitochondria	145	530.79	1059.57	530.80	1059.58	2	-9.55	17.1783	35971	73	4	145 - 154	K.TLEGLIAESK.T
214	AT5G52840.1	B13	complex I	a) oxidative phosphorylation	mitochondria	65	483.25	1928.98	483.26	1929.00	4	-11.00	13.52220833	17416	26	2	129 - 144	K.HVPQHRPGPLPEQFYK.T
214	AT5G52840.1	B13	complex I	a) oxidative phosphorylation	mitochondria	143	530.79	1059.57	530.80	1059.58	2	-10.12	17.09738333	6989	74	4	145 - 154	K.TLEGLIAESK.T
214	AT5G52840.1	B13	complex I	a) oxidative phosphorylation	mitochondria	95	583.29	1746.86	583.30	1746.88	3	-10.15	14.47650833	5087	22	1	40 - 54	K.TLKEIQAVPEDEGYR.K
214	AT5G52840.1	B13	complex I	a) oxidative phosphorylation	mitochondria	132	589.67	1765.99	589.68	1766.01	3	-7.67	16.67973333	6348	42	2	14 - 30	K.VKQTTGIVGLDVVPNAR.A
214	AT5G52840.1	B13	complex I	a) oxidative phosphorylation	mitochondria	144	530.79	1059.57	530.80	1059.58	2	-9.74	17.13784167	27500	68	4	145 - 154	K.TLEGLIAESK.T
214	AT5G52840.1	B13	complex I	a) oxidative phosphorylation	mitochondria	44	511.92	1532.73	511.92	1532.75	3	-8.74	12.19756667	6904	34	2	43 - 55	K.EIQAVPEDEGYRK.A
214	AT5G52840.1	B13	complex I	a) oxidative phosphorylation	mitochondria	99	532.94	1595.79	532.94	1595.80	3	-6.25	14.61098333	5461	18	1	155 - 169	K.TEIPAATPSDPQLKE.-
214	AT5G52840.1	B13	complex I	a) oxidative phosphorylation	mitochondria	166	513.95	1538.83	513.95	1538.84	3	-7.38	18.00051667	3418	42	1	16 - 30	K.QTTGIVGLDVVPNAR.A
214	AT5G52840.1	B13	complex I	a) oxidative phosphorylation	mitochondria	173	511.29	1020.57	511.30	1020.59	2	-10.46	18.2424	25759	54	2	31 - 39	R.AVLIDLYSK.T
214	AT5G52840.1	B13	complex I	a) oxidative phosphorylation	mitochondria	91	734.38	1466.75	734.39	1466.76	2	-10.64	14.32833333	3605	44	1	155 - 168	K.TEIPAATPSDPQLK.E
214	AT5G52840.1	B13	complex I	a) oxidative phosphorylation	mitochondria	97	798.90	1595.80	798.91	1595.80	2	-5.65	14.54373333	3652	68	2	155 - 169	K.TEIPAATPSDPQLKE.-
214	AT5G52840.1	B13	complex I	a) oxidative phosphorylation	mitochondria	165	770.42	1538.83	770.43	1538.84	2	-7.40	17.98713333	13916	70	2	16 - 30	K.QTTGIVGLDVVPNAR.A
214	AT5G52840.1	B13	complex I	a) oxidative phosphorylation	mitochondria	35	405.21	808.40	405.21	808.41	2	-14.65	11.77931667	14503	58	2	56 - 62	K.AVESFTR.Q
281	AT5G52840.1	B13	complex I	a) oxidative phosphorylation	mitochondria	152	589.67	1765.98	589.68	1766.01	3	-12.75	17.08129167	4703	55	2	14 - 30	K.VKQTTGIVGLDVVPNAR.A
281	AT5G52840.1	B13	complex I	a) oxidative phosphorylation	mitochondria	156	589.67	1765.98	589.68	1766.01	3	-13.26	17.18869167	7936	26	2	14 - 30	K.VKQTTGIVGLDVVPNAR.A
281	AT5G52840.1	B13	complex I	a) oxidative phosphorylation	mitochondria	102	532.94	1595.78	532.94	1595.80	3	-12.26	15.08691667	4821	31	1	155 - 169	K.TEIPAATPSDPQLKE.-
281	AT5G52840.1	B13	complex I	a) oxidative phosphorylation	mitochondria	191	770.42	1538.82	770.43	1538.84	2	-13.89	18.38631667	15327	78	2	16 - 30	K.QTTGIVGLDVVPNAR.A
281	AT5G52840.1	B13	complex I	a) oxidative phosphorylation	mitochondria	94	734.38	1466.74	734.39	1466.76	2	-14.32	14.83165833	6169	41	1	155 - 168	K.TEIPAATPSDPQLK.E
281	AT5G52840.1	B13	complex I	a) oxidative phosphorylation	mitochondria	193	513.95	1538.82	513.95	1538.84	3	-14.00	18.41308333	3189	58	1	16 - 30	K.QTTGIVGLDVVPNAR.A
281	AT5G52840.1	B13	complex I	a) oxidative phosphorylation	mitochondria	103	798.90	1595.78	798.91	1595.80	2	-13.78	15.15416667	10647	33	2	155 - 169	K.TEIPAATPSDPQLKE.-
281	AT5G52840.1	B13	complex I	a) oxidative phosphorylation	mitochondria	100	798.90	1595.78	798.91	1595.80	2	-12.28	15.06014167	11894	57	2	155 - 169	K.TEIPAATPSDPQLKE.-
281	AT5G52840.1	B13	complex I	a) oxidative phosphorylation	mitochondria	195	770.42	1538.82	770.43	1538.84	2	-12.73	18.49369167	58106	64	2	16 - 30	K.QTTGIVGLDVVPNAR.A
354	AT5G52840.1	B13	complex I	a) oxidative phosphorylation	mitochondria	138	798.91	1595.80	798.91	1595.80	2	-4.13	16.4	34735	61	2	155 - 169	K.TEIPAATPSDPQLKE.-
354	AT5G52840.1	B13	complex I	a) oxidative phosphorylation	mitochondria	33	469.26	936.50	469.26	936.50	2	-7.07	11.9	9836	46	2	55 - 62	R.KAVESFTR.Q
354	AT5G52840.1	B13	complex I	a) oxidative phosphorylation	mitochondria	104	483.26	1928.99	483.26	1929.00	4	-5.02	15.3	56915	17	2	129 - 144	K.HVPQHRPGPLPEQFYK.T
354	AT5G52840.1	B13	complex I	a) oxidative phosphorylation	mitochondria	249	511.30	1020.58	511.30	1020.59	2	-7.12	20.2	38901	43	2	31 - 39	R.AVLIDLYSK.T
354	AT5G52840.1	B13	complex I	a) oxidative phosphorylation	mitochondria	241	770.42	1538.83	770.43	1538.84	2	-5.31	19.9	4847	117	2	16 - 30	K.QTTGIVGLDVVPNAR.A
354	AT5G52840.1	B13	complex I	a) oxidative phosphorylation	mitochondria	219	530.79	1059.57	530.80	1059.58	2	-6.84	19	57368	64	2	145 - 154	K.TLEGLIAESK.T
354	AT5G52840.1	B13	complex I	a) oxidative phosphorylation	mitochondria	112	703.33	1404.64	703.33	1404.65	2	-6.65	15.6	10836	41	2	43 - 54	K.EIQAVPEDEGYR.K
354	AT5G52840.1	B13	complex I	a) oxidative phosphorylation	mitochondria	70	767.38	1532.74	767.38	1532.75	2	-7.21	13.9	3940	39	1	43 - 55	K.EIQAVPEDEGYRK.A
354	AT5G52840.1	B13	complex I	a) oxidative phosphorylation	mitochondria	246	1021.59	1020.58	1021.59	1020.59	1	-7.39	20.1	50372	59	2	31 - 39	R.AVLIDLYSK.T
354	AT5G52840.1	B13	complex I	a) oxidative phosphorylation	mitochondria	111	703.33	1404.64	703.33	1404.65	2	-5.24	15.6	9749	43	2	43 - 54	K.EIQAVPEDEGYR.K
354	AT5G52840.1	B13	complex I	a) oxidative phosphorylation	mitochondria	72	511.92	1532.74	511.92	1532.75	3	-5.26	14	12809	41	2	43 - 55	K.EIQAVPEDEGYRK.A
354	AT5G52840.1	B13	complex I	a) oxidative phosphorylation	mitochondria	207	589.67	1765.99	589.68	1766.01	3	-6.45	18.6	14588	53	2	14 - 30	K.VKQTTGIVGLDVVPNAR.A
354	AT5G52840.1	B13	complex I	a) oxidative phosphorylation	mitochondria	141	798.91	1595.80	798.91	1595.80	2	-4.43	16.5	33924	47	2	155 - 169	K.TEIPAATPSDPQLKE.-
354	AT5G52840.1	B13	complex I	a) oxidative phosphorylation	mitochondria	31	469.26	936.50	469.26	936.50	2	-7.66	11.9	10479	50	2	55 - 62	R.KAVESFTR.Q
354	AT5G52840.1	B13	complex I	a) oxidative phosphorylation	mitochondria	103	644.00	1928.99	644.01	1929.00	3	-5.02	15.3	56010	21	1	129 - 144	K.HVPQHRPGPLPEQFYK.T
354	AT5G52840.1	B13	complex I	a) oxidative phosphorylation	mitochondria	63	809.41	808.40	809.42	808.41	1	-5.63	13.5	15865	19	1	56 - 62	K.AVESFTR.Q
354	AT5G52840.1	B13	complex I	a) oxidative phosphorylation	mitochondria	205	589.67	1766.00	589.68	1766.01	3	-5.41	18.5	7629	42	2	14 - 30	K.VKQTTGIVGLDVVPNAR.A
354	AT5G52840.1	B13	complex I	a) oxidative phosphorylation	mitochondria	131	734.39	1466.76	734.39	1466.76	2	-3.72	16.2	11009	45	2	155 - 168	K.TEIPAATPSDPQLK.E
354	AT5G52840.1	B13	complex I	a) oxidative phosphorylation	mitochondria	101	483.25	1928.99	483.26	1929.00	4	-6.26	15.2	8633	17	2	129 - 144	K.HVPQHRPGPLPEQFYK.T
354	AT5G52840.1	B13	complex I	a) oxidative phosphorylation	mitochondria	62	405.21	808.40	405.21	808.41	2	-5.61	13.5	17683	51	2	56 - 62	K.AVESFTR.Q
354	AT5G52840.1	B13	complex I	a) oxidative phosphorylation	mitochondria	69	511.92	1532.74	511.92	1532.75	3	-7.21	13.9	5068	40	2	43 - 55	K.EIQAVPEDEGYRK.A
354	AT5G52840.1	B13	complex I	a) oxidative phosphorylation	mitochondria	292	801.89	1601.76	801.89	1601.77	2	-6.53	22	5740	56	2	81 - 94	R.LGCGQVEELIEEAR.D	Carbamidomethyl: 3
354	AT5G52840.1	B13	complex I	a) oxidative phosphorylation	mitochondria	218	656.62	1966.85	656.63	1966.87	3	-6.64	18.9	6070	27	1	65 - 79	R.LNVCKEEEDWEMIEK.R	Oxidation: 12
354	AT5G52840.1	B13	complex I	a) oxidative phosphorylation	mitochondria	234	651.29	1950.86	651.30	1950.87	3	-5.47	19.6	5310	25	2	65 - 79	R.LNVCKEEEDWEMIEK.R	Carbamidomethyl: 4
354	AT5G52840.1	B13	complex I	a) oxidative phosphorylation	mitochondria	243	770.42	1538.83	770.43	1538.84	2	-4.96	20	98445	88	2	16 - 30	K.QTTGIVGLDVVPNAR.A
354	AT5G52840.1	B13	complex I	a) oxidative phosphorylation	mitochondria	134	734.38	1466.75	734.39	1466.76	2	-4.65	16.3	12206	29	2	155 - 168	K.TEIPAATPSDPQLK.E
354	AT5G52840.1	B13	complex I	a) oxidative phosphorylation	mitochondria	233	651.29	1950.86	651.30	1950.87	3	-5.11	19.6	3684	33	2	65 - 79	R.LNVCKEEEDWEMIEK.R	Carbamidomethyl: 4
354	AT5G52840.1	B13	complex I	a) oxidative phosphorylation	mitochondria	294	801.89	1601.76	801.89	1601.77	2	-6.47	22	8717	44	2	81 - 94	R.LGCGQVEELIEEAR.D	Carbamidomethyl: 3
354	AT5G52840.1	B13	complex I	a) oxidative phosphorylation	mitochondria	250	1021.59	1020.58	1021.59	1020.59	1	-7.13	20.2	21263	26	2	31 - 39	R.AVLIDLYSK.T
354	AT5G52840.1	B13	complex I	a) oxidative phosphorylation	mitochondria	245	511.30	1020.58	511.30	1020.59	2	-7.37	20.1	73984	67	2	31 - 39	R.AVLIDLYSK.T
354	AT5G52840.1	B13	complex I	a) oxidative phosphorylation	mitochondria	59	405.21	808.40	405.21	808.41	2	-5.12	13.4	11422	48	2	56 - 62	K.AVESFTR.Q
354	AT5G52840.1	B13	complex I	a) oxidative phosphorylation	mitochondria	222	530.79	1059.57	530.80	1059.58	2	-8.22	19.1	78171	69	2	145 - 154	K.TLEGLIAESK.T
1180	AT5G52840.1	B13	complex I	a) oxidative phosphorylation	mitochondria	180	770.44	1538.86	770.43	1538.84	2	13.13	18.4	5296	35	1	16 - 30	K.QTTGIVGLDVVPNAR.A
1180	AT5G52840.1	B13	complex I	a) oxidative phosphorylation	mitochondria	162	530.80	1059.59	530.80	1059.58	2	12.54	17.6	5356	45	1	145 - 154	K.TLEGLIAESK.T
1180	AT5G52840.1	B13	complex I	a) oxidative phosphorylation	mitochondria	183	511.31	1020.60	511.30	1020.59	2	13.28	18.5	8402	38	2	31 - 39	R.AVLIDLYSK.T
1180	AT5G52840.1	B13	complex I	a) oxidative phosphorylation	mitochondria	20	405.22	808.42	405.21	808.41	2	16.55	12	8833	43	1	56 - 62	K.AVESFTR.Q
1180	AT5G52840.1	B13	complex I	a) oxidative phosphorylation	mitochondria	185	511.31	1020.60	511.30	1020.59	2	11.46	18.6	9248	40	2	31 - 39	R.AVLIDLYSK.T
367	AT3G12260.1	B14	complex I	a) oxidative phosphorylation	mitochondria	245	415.71	829.41	415.71	829.41	2	0.23	22.2	10835	30	3	26 - 31	R.VFDFFR.A
367	AT3G12260.1	B14	complex I	a) oxidative phosphorylation	mitochondria	266	480.81	959.61	480.81	959.61	2	3.57	23.9	5882	32	2	74 - 81	K.VIDLLIFK.G
367	AT3G12260.1	B14	complex I	a) oxidative phosphorylation	mitochondria	267	480.81	959.61	480.81	959.61	2	4.59	24	13752	48	2	74 - 81	K.VIDLLIFK.G
367	AT3G12260.1	B14	complex I	a) oxidative phosphorylation	mitochondria	63	522.96	1565.86	522.96	1565.85	3	2.76	15.2	4448	29	1	9 - 23	R.KIGVPPNSANLTEAR.R
367	AT3G12260.1	B14	complex I	a) oxidative phosphorylation	mitochondria	274	797.09	2388.25	797.09	2388.24	3	4.88	24.5	3360	19	4	36 - 56	R.SIPTIMDIYNLQDVVAPSQLR.Y	Oxidation: 6
367	AT3G12260.1	B14	complex I	a) oxidative phosphorylation	mitochondria	146	458.28	914.54	458.27	914.53	2	4.34	17.9	12589	16	1	2 - 9	M.AAPFALRK.I	Acetyl: 1
367	AT3G12260.1	B14	complex I	a) oxidative phosphorylation	mitochondria	204	493.76	985.51	493.76	985.51	2	0.04	20.3	6390	15	1	25 - 31	R.RVFDFFR.A
367	AT3G12260.1	B14	complex I	a) oxidative phosphorylation	mitochondria	205	729.36	1456.70	729.35	1456.69	2	6.58	20.4	3982	18	1	82 - 94	K.GMEELTDIVDHAK.Q
367	AT3G12260.1	B14	complex I	a) oxidative phosphorylation	mitochondria	246	415.71	829.41	415.71	829.41	2	-1.67	22.2	17431	31	3	26 - 31	R.VFDFFR.A
367	AT3G12260.1	B14	complex I	a) oxidative phosphorylation	mitochondria	271	830.39	1658.77	830.39	1658.76	2	7.80	24.2	8506	45	2	121 - 133	K.TDFLKNFYTSNYF.-
367	AT3G12260.1	B14	complex I	a) oxidative phosphorylation	mitochondria	92	461.26	920.50	461.26	920.51	2	-3.58	16.1	7604	44	1	57 - 64	R.YAISAQIR.N
367	AT3G12260.1	B14	complex I	a) oxidative phosphorylation	mitochondria	275	797.09	2388.25	797.09	2388.24	3	6.09	24.5	6770	32	4	36 - 56	R.SIPTIMDIYNLQDVVAPSQLR.Y	Oxidation: 6
367	AT3G12260.1	B14	complex I	a) oxidative phosphorylation	mitochondria	270	830.39	1658.77	830.39	1658.76	2	4.40	24.2	3820	39	2	121 - 133	K.TDFLKNFYTSNYF.-
367	AT3G12260.1	B14	complex I	a) oxidative phosphorylation	mitochondria	102	648.59	2590.33	648.59	2590.33	4	1.02	16.5	5232	22	1	97 - 120	R.HHIIGQYVVGEGLVQNTGNKDQGK.T
367	AT3G12260.1	B14	complex I	a) oxidative phosphorylation	mitochondria	97	719.89	1437.76	719.89	1437.76	2	4.28	16.3	4559	25	2	10 - 23	K.IGVPPNSANLTEAR.R
367	AT3G12260.1	B14	complex I	a) oxidative phosphorylation	mitochondria	277	797.09	2388.25	797.09	2388.24	3	5.40	24.6	6408	32	4	36 - 56	R.SIPTIMDIYNLQDVVAPSQLR.Y	Oxidation: 6
367	AT3G12260.1	B14	complex I	a) oxidative phosphorylation	mitochondria	101	719.89	1437.77	719.89	1437.76	2	6.19	16.4	11314	31	2	10 - 23	K.IGVPPNSANLTEAR.R
367	AT3G12260.1	B14	complex I	a) oxidative phosphorylation	mitochondria	278	797.09	2388.25	797.09	2388.24	3	5.18	24.7	6527	21	4	36 - 56	R.SIPTIMDIYNLQDVVAPSQLR.Y	Oxidation: 6
367	AT3G12260.1	B14	complex I	a) oxidative phosphorylation	mitochondria	244	415.71	829.41	415.71	829.41	2	-2.58	22.2	3706	15	3	26 - 31	R.VFDFFR.A
367	AT3G12260.1	B14	complex I	a) oxidative phosphorylation	mitochondria	128	721.72	2162.13	721.72	2162.12	3	4.52	17.3	11934	53	1	97 - 116	R.HHIIGQYVVGEGLVQNTGNK.D
141	AT2G42210.1	B14.7	complex I	a) oxidative phosphorylation	mitochondria	50	674.32	1346.63	674.33	1346.65	2	-14.43	13.3	5514	23	1	145 - 154	R.EYYPYTVEKR.A
141	AT2G42210.1	B14.7	complex I	a) oxidative phosphorylation	mitochondria	88	596.28	1190.54	596.28	1190.55	2	-10.30	14.6	15159	36	2	145 - 153	R.EYYPYTVEK.R
141	AT2G42210.1	B14.7	complex I	a) oxidative phosphorylation	mitochondria	16	462.18	922.34	462.18	922.35	2	-15.39	10	18365	28	3	1 - 7	-.MDPAEMR.Y	Acetyl: 1
141	AT2G42210.1	B14.7	complex I	a) oxidative phosphorylation	mitochondria	176	476.79	951.57	476.80	951.59	2	-14.37	18	138766	42	3	49 - 57	R.NVALPGLIR.T
141	AT2G42210.1	B14.7	complex I	a) oxidative phosphorylation	mitochondria	13	462.18	922.34	462.18	922.35	2	-16.88	9.9	5613	44	3	1 - 7	-.MDPAEMR.Y	Acetyl: 1
141	AT2G42210.1	B14.7	complex I	a) oxidative phosphorylation	mitochondria	132	662.30	1322.59	662.31	1322.61	2	-11.82	15.9	8249	49	2	8 - 18	R.YLEEEDGPLMK.T
141	AT2G42210.1	B14.7	complex I	a) oxidative phosphorylation	mitochondria	174	952.58	951.57	952.59	951.59	1	-15.09	17.9	8132	26	1	49 - 57	R.NVALPGLIR.T
141	AT2G42210.1	B14.7	complex I	a) oxidative phosphorylation	mitochondria	128	662.30	1322.59	662.31	1322.61	2	-10.43	15.8	19218	68	2	8 - 18	R.YLEEEDGPLMK.T
141	AT2G42210.1	B14.7	complex I	a) oxidative phosphorylation	mitochondria	14	462.18	922.34	462.18	922.35	2	-14.48	9.9	11364	37	3	1 - 7	-.MDPAEMR.Y	Acetyl: 1
141	AT2G42210.1	B14.7	complex I	a) oxidative phosphorylation	mitochondria	48	449.88	1346.63	449.89	1346.65	3	-15.19	13.3	4370	52	2	145 - 154	R.EYYPYTVEKR.A
141	AT2G42210.1	B14.7	complex I	a) oxidative phosphorylation	mitochondria	79	670.30	1338.59	670.31	1338.60	2	-8.69	14.2	48396	68	2	8 - 18	R.YLEEEDGPLMK.T	Oxidation: 10
141	AT2G42210.1	B14.7	complex I	a) oxidative phosphorylation	mitochondria	173	476.79	951.57	476.80	951.59	2	-15.06	17.9	70623	50	3	49 - 57	R.NVALPGLIR.T
141	AT2G42210.1	B14.7	complex I	a) oxidative phosphorylation	mitochondria	172	476.79	951.57	476.80	951.59	2	-18.80	17.9	6777	26	3	49 - 57	R.NVALPGLIR.T
141	AT2G42210.1	B14.7	complex I	a) oxidative phosphorylation	mitochondria	91	596.28	1190.54	596.28	1190.55	2	-11.29	14.7	19243	27	2	145 - 153	R.EYYPYTVEK.R
141	AT2G42210.1	B14.7	complex I	a) oxidative phosphorylation	mitochondria	75	670.30	1338.59	670.31	1338.60	2	-9.52	14.1	44376	80	2	8 - 18	R.YLEEEDGPLMK.T	Oxidation: 10
141	AT2G42210.1	B14.7	complex I	a) oxidative phosphorylation	mitochondria	49	449.88	1346.63	449.89	1346.65	3	-14.41	13.3	7210	34	2	145 - 154	R.EYYPYTVEKR.A
221	AT2G42210.1	B14.7	complex I	a) oxidative phosphorylation	mitochondria	102	596.28	1190.54	596.28	1190.55	2	-8.64	14.76208333	7936	25	1	145 - 153	R.EYYPYTVEK.R
221	AT2G42210.1	B14.7	complex I	a) oxidative phosphorylation	mitochondria	16	462.18	922.34	462.18	922.35	2	-13.42	10.11268333	6773	42	3	1 - 7	-.MDPAEMR.Y	Acetyl: 1
221	AT2G42210.1	B14.7	complex I	a) oxidative phosphorylation	mitochondria	94	670.30	1338.59	670.31	1338.60	2	-6.93	14.46636667	12365	56	2	8 - 18	R.YLEEEDGPLMK.T	Oxidation: 10
221	AT2G42210.1	B14.7	complex I	a) oxidative phosphorylation	mitochondria	18	462.18	922.34	462.18	922.35	2	-11.91	10.16655	8036	31	3	1 - 7	-.MDPAEMR.Y	Acetyl: 1
221	AT2G42210.1	B14.7	complex I	a) oxidative phosphorylation	mitochondria	201	476.79	951.58	476.80	951.59	2	-11.85	18.15198333	78473	33	2	49 - 57	R.NVALPGLIR.T
221	AT2G42210.1	B14.7	complex I	a) oxidative phosphorylation	mitochondria	139	662.31	1322.60	662.31	1322.61	2	-6.17	15.95835	12532	59	1	8 - 18	R.YLEEEDGPLMK.T
221	AT2G42210.1	B14.7	complex I	a) oxidative phosphorylation	mitochondria	198	476.79	951.58	476.80	951.59	2	-11.85	18.07136667	28997	35	2	49 - 57	R.NVALPGLIR.T
221	AT2G42210.1	B14.7	complex I	a) oxidative phosphorylation	mitochondria	15	462.18	922.34	462.18	922.35	2	-9.74	10.072225	4927	22	3	1 - 7	-.MDPAEMR.Y	Acetyl: 1
221	AT2G42210.1	B14.7	complex I	a) oxidative phosphorylation	mitochondria	90	670.30	1338.59	670.31	1338.60	2	-6.93	14.358975	21813	79	2	8 - 18	R.YLEEEDGPLMK.T	Oxidation: 10
361	AT2G42210.1	B14.7	complex I	a) oxidative phosphorylation	mitochondria	224	952.59	951.58	952.59	951.59	1	-2.88	19.9	9149	39	1	49 - 57	R.NVALPGLIR.T
361	AT2G42210.1	B14.7	complex I	a) oxidative phosphorylation	mitochondria	87	674.33	1346.65	674.33	1346.65	2	-1.93	15.2	16950	26	3	145 - 154	R.EYYPYTVEKR.A
361	AT2G42210.1	B14.7	complex I	a) oxidative phosphorylation	mitochondria	165	662.31	1322.60	662.31	1322.61	2	-1.35	17.7	27085	60	2	8 - 18	R.YLEEEDGPLMK.T
361	AT2G42210.1	B14.7	complex I	a) oxidative phosphorylation	mitochondria	84	674.33	1346.65	674.33	1346.65	2	-2.25	15.1	13988	50	3	145 - 154	R.EYYPYTVEKR.A
361	AT2G42210.1	B14.7	complex I	a) oxidative phosphorylation	mitochondria	31	462.18	922.35	462.18	922.35	2	-2.17	11.7	6828	43	1	1 - 7	-.MDPAEMR.Y	Acetyl: 1
361	AT2G42210.1	B14.7	complex I	a) oxidative phosphorylation	mitochondria	229	476.80	951.58	476.80	951.59	2	-2.21	20	99255	58	3	49 - 57	R.NVALPGLIR.T
361	AT2G42210.1	B14.7	complex I	a) oxidative phosphorylation	mitochondria	83	674.33	1346.65	674.33	1346.65	2	-0.36	15	4460	32	3	145 - 154	R.EYYPYTVEKR.A
361	AT2G42210.1	B14.7	complex I	a) oxidative phosphorylation	mitochondria	194	748.65	2242.94	748.66	2242.94	3	-0.36	18.6	7381	36	2	1 - 18	-.MDPAEMRYLEEEDGPLMK.T	Acetyl: 1
361	AT2G42210.1	B14.7	complex I	a) oxidative phosphorylation	mitochondria	111	670.31	1338.60	670.31	1338.60	2	-1.30	16	113777	80	2	8 - 18	R.YLEEEDGPLMK.T	Oxidation: 10
361	AT2G42210.1	B14.7	complex I	a) oxidative phosphorylation	mitochondria	223	476.80	951.58	476.80	951.59	2	-2.88	19.9	53398	55	3	49 - 57	R.NVALPGLIR.T
361	AT2G42210.1	B14.7	complex I	a) oxidative phosphorylation	mitochondria	226	476.80	951.59	476.80	951.59	2	-0.84	20	246201	56	3	49 - 57	R.NVALPGLIR.T
361	AT2G42210.1	B14.7	complex I	a) oxidative phosphorylation	mitochondria	115	670.31	1338.60	670.31	1338.60	2	-0.18	16.1	62256	80	2	8 - 18	R.YLEEEDGPLMK.T	Oxidation: 10
361	AT2G42210.1	B14.7	complex I	a) oxidative phosphorylation	mitochondria	126	596.28	1190.55	596.28	1190.55	2	-1.13	16.4	28303	26	2	145 - 153	R.EYYPYTVEK.R
361	AT2G42210.1	B14.7	complex I	a) oxidative phosphorylation	mitochondria	197	748.65	2242.94	748.66	2242.94	3	-0.20	18.7	15043	36	2	1 - 18	-.MDPAEMRYLEEEDGPLMK.T	Acetyl: 1
361	AT2G42210.1	B14.7	complex I	a) oxidative phosphorylation	mitochondria	125	596.28	1190.55	596.28	1190.55	2	3.72	16.4	8689	45	2	145 - 153	R.EYYPYTVEK.R
361	AT2G42210.1	B14.7	complex I	a) oxidative phosphorylation	mitochondria	168	662.31	1322.60	662.31	1322.61	2	-1.29	17.8	41749	55	2	8 - 18	R.YLEEEDGPLMK.T
222	AT1G04630.1	B16.6-1 (GRIM-19)	complex I	a) oxidative phosphorylation	mitochondrion	214	627.31	1878.92	627.32	1878.93	3	-7.84	18.267725	8563	63	4	17 - 34	K.DMPLLQDGPPPGGFAPVR.Y	Oxidation: 2
222	AT1G04630.1	B16.6-1 (GRIM-19)	complex I	a) oxidative phosphorylation	mitochondrion	32	547.76	1093.50	547.76	1093.52	2	-10.21	11.1685	42947	66	4	120 - 129	K.VGENVYNSGR.W
222	AT1G04630.1	B16.6-1 (GRIM-19)	complex I	a) oxidative phosphorylation	mitochondrion	215	940.46	1878.92	940.47	1878.93	2	-7.85	18.28110833	4759	22	1	17 - 34	K.DMPLLQDGPPPGGFAPVR.Y	Oxidation: 2
222	AT1G04630.1	B16.6-1 (GRIM-19)	complex I	a) oxidative phosphorylation	mitochondrion	211	627.31	1878.92	627.32	1878.93	3	-6.56	18.1737	7543	75	4	17 - 34	K.DMPLLQDGPPPGGFAPVR.Y	Oxidation: 2
222	AT1G04630.1	B16.6-1 (GRIM-19)	complex I	a) oxidative phosphorylation	mitochondrion	216	627.31	1878.92	627.32	1878.93	3	-7.52	18.34833333	6910	56	4	17 - 34	K.DMPLLQDGPPPGGFAPVR.Y	Oxidation: 2
222	AT1G04630.1	B16.6-1 (GRIM-19)	complex I	a) oxidative phosphorylation	mitochondrion	238	648.31	1941.90	648.31	1941.92	3	-7.03	19.90541667	4217	18	1	104 - 119	K.YLEYEADVMKDVPGWK.V
222	AT1G04630.1	B16.6-1 (GRIM-19)	complex I	a) oxidative phosphorylation	mitochondrion	203	653.64	1957.90	653.64	1957.91	3	-8.11	17.91814167	10696	44	2	104 - 119	K.YLEYEADVMKDVPGWK.V	Oxidation: 9
222	AT1G04630.1	B16.6-1 (GRIM-19)	complex I	a) oxidative phosphorylation	mitochondrion	30	547.76	1093.51	547.76	1093.52	2	-9.30	11.08755833	6542	76	4	120 - 129	K.VGENVYNSGR.W
222	AT1G04630.1	B16.6-1 (GRIM-19)	complex I	a) oxidative phosphorylation	mitochondrion	106	638.79	1275.56	638.79	1275.57	2	-7.09	14.623525	4545	45	1	104 - 113	K.YLEYEADVMK.D	Oxidation: 9
222	AT1G04630.1	B16.6-1 (GRIM-19)	complex I	a) oxidative phosphorylation	mitochondrion	31	547.76	1093.50	547.76	1093.52	2	-9.85	11.12803333	32545	63	4	120 - 129	K.VGENVYNSGR.W
222	AT1G04630.1	B16.6-1 (GRIM-19)	complex I	a) oxidative phosphorylation	mitochondrion	205	653.64	1957.90	653.64	1957.91	3	-6.73	17.98536667	9254	31	2	104 - 119	K.YLEYEADVMKDVPGWK.V	Oxidation: 9
222	AT1G04630.1	B16.6-1 (GRIM-19)	complex I	a) oxidative phosphorylation	mitochondrion	33	547.76	1093.50	547.76	1093.52	2	-12.95	11.20895833	23301	66	4	120 - 129	K.VGENVYNSGR.W
222	AT1G04630.1	B16.6-1 (GRIM-19)	complex I	a) oxidative phosphorylation	mitochondrion	217	627.31	1878.92	627.32	1878.93	3	-7.04	18.38900833	6846	64	4	17 - 34	K.DMPLLQDGPPPGGFAPVR.Y	Oxidation: 2
363	AT1G04630.1	B16.6-1 (GRIM-19)	complex I	a) oxidative phosphorylation	mitochondrion	283	932.48	1862.94	932.47	1862.93	2	1.90	22.1	11457	60	3	17 - 34	K.DMPLLQDGPPPGGFAPVR.Y
363	AT1G04630.1	B16.6-1 (GRIM-19)	complex I	a) oxidative phosphorylation	mitochondrion	227	940.47	1878.93	940.47	1878.93	2	2.46	20.1	21052	98	4	17 - 34	K.DMPLLQDGPPPGGFAPVR.Y	Oxidation: 2
363	AT1G04630.1	B16.6-1 (GRIM-19)	complex I	a) oxidative phosphorylation	mitochondrion	52	548.26	1094.50	547.76	1093.52	2	901.91	13.2	20137	40	4	120 - 129	K.VGENVYNSGR.W
363	AT1G04630.1	B16.6-1 (GRIM-19)	complex I	a) oxidative phosphorylation	mitochondrion	298	827.91	1653.80	827.91	1653.80	2	2.84	22.7	10829	17	2	130 - 143	R.WMPPATGELRPDVW.-
363	AT1G04630.1	B16.6-1 (GRIM-19)	complex I	a) oxidative phosphorylation	mitochondrion	127	638.79	1275.57	638.79	1275.57	2	3.79	16.4	35248	62	2	104 - 113	K.YLEYEADVMK.D	Oxidation: 9
363	AT1G04630.1	B16.6-1 (GRIM-19)	complex I	a) oxidative phosphorylation	mitochondrion	232	940.48	1878.94	940.47	1878.93	2	3.30	20.2	80759	102	4	17 - 34	K.DMPLLQDGPPPGGFAPVR.Y	Oxidation: 2
363	AT1G04630.1	B16.6-1 (GRIM-19)	complex I	a) oxidative phosphorylation	mitochondrion	42	547.76	1093.52	547.76	1093.52	2	-0.21	12.6	12241	54	4	120 - 129	K.VGENVYNSGR.W
363	AT1G04630.1	B16.6-1 (GRIM-19)	complex I	a) oxidative phosphorylation	mitochondrion	287	932.48	1862.94	932.47	1862.93	2	1.99	22.2	15185	60	3	17 - 34	K.DMPLLQDGPPPGGFAPVR.Y
363	AT1G04630.1	B16.6-1 (GRIM-19)	complex I	a) oxidative phosphorylation	mitochondrion	125	638.79	1275.57	638.79	1275.57	2	3.54	16.3	25835	56	2	104 - 113	K.YLEYEADVMK.D	Oxidation: 9
363	AT1G04630.1	B16.6-1 (GRIM-19)	complex I	a) oxidative phosphorylation	mitochondrion	281	763.91	1525.80	763.91	1525.80	2	1.44	22	10049	43	2	84 - 96	R.TILPILQAEEDER.F
363	AT1G04630.1	B16.6-1 (GRIM-19)	complex I	a) oxidative phosphorylation	mitochondrion	214	653.65	1957.91	653.64	1957.91	3	0.22	19.7	4339	29	3	104 - 119	K.YLEYEADVMKDVPGWK.V	Oxidation: 9
363	AT1G04630.1	B16.6-1 (GRIM-19)	complex I	a) oxidative phosphorylation	mitochondrion	230	627.32	1878.94	627.32	1878.93	3	3.62	20.2	49732	79	3	17 - 34	K.DMPLLQDGPPPGGFAPVR.Y	Oxidation: 2
363	AT1G04630.1	B16.6-1 (GRIM-19)	complex I	a) oxidative phosphorylation	mitochondrion	233	627.32	1878.94	627.32	1878.93	3	3.29	20.3	57481	74	3	17 - 34	K.DMPLLQDGPPPGGFAPVR.Y	Oxidation: 2
363	AT1G04630.1	B16.6-1 (GRIM-19)	complex I	a) oxidative phosphorylation	mitochondrion	217	653.65	1957.92	653.64	1957.91	3	3.03	19.8	92482	69	3	104 - 119	K.YLEYEADVMKDVPGWK.V	Oxidation: 9
363	AT1G04630.1	B16.6-1 (GRIM-19)	complex I	a) oxidative phosphorylation	mitochondrion	272	648.32	1941.92	648.31	1941.92	3	2.53	21.7	18836	29	1	104 - 119	K.YLEYEADVMKDVPGWK.V
363	AT1G04630.1	B16.6-1 (GRIM-19)	complex I	a) oxidative phosphorylation	mitochondrion	68	462.25	922.49	462.25	922.49	2	-2.32	13.9	4880	26	2	97 - 103	R.FVSEWKK.Y
363	AT1G04630.1	B16.6-1 (GRIM-19)	complex I	a) oxidative phosphorylation	mitochondrion	215	653.65	1957.92	653.64	1957.91	3	1.98	19.7	18646	80	3	104 - 119	K.YLEYEADVMKDVPGWK.V	Oxidation: 9
363	AT1G04630.1	B16.6-1 (GRIM-19)	complex I	a) oxidative phosphorylation	mitochondrion	278	835.91	1669.80	835.90	1669.79	2	2.37	21.9	74008	45	2	130 - 143	R.WMPPATGELRPDVW.-	Oxidation: 2
363	AT1G04630.1	B16.6-1 (GRIM-19)	complex I	a) oxidative phosphorylation	mitochondrion	228	627.32	1878.93	627.32	1878.93	3	2.46	20.1	14435	87	3	17 - 34	K.DMPLLQDGPPPGGFAPVR.Y	Oxidation: 2
363	AT1G04630.1	B16.6-1 (GRIM-19)	complex I	a) oxidative phosphorylation	mitochondrion	184	630.80	1259.58	630.79	1259.57	2	3.64	18.3	13074	66	2	104 - 113	K.YLEYEADVMK.D
363	AT1G04630.1	B16.6-1 (GRIM-19)	complex I	a) oxidative phosphorylation	mitochondrion	187	630.80	1259.58	630.79	1259.57	2	2.63	18.4	18039	48	2	104 - 113	K.YLEYEADVMK.D
363	AT1G04630.1	B16.6-1 (GRIM-19)	complex I	a) oxidative phosphorylation	mitochondrion	280	835.91	1669.80	835.90	1669.79	2	3.04	22	98685	44	2	130 - 143	R.WMPPATGELRPDVW.-	Oxidation: 2
363	AT1G04630.1	B16.6-1 (GRIM-19)	complex I	a) oxidative phosphorylation	mitochondrion	279	763.91	1525.80	763.91	1525.80	2	2.13	21.9	3621	47	2	84 - 96	R.TILPILQAEEDER.F
363	AT1G04630.1	B16.6-1 (GRIM-19)	complex I	a) oxidative phosphorylation	mitochondrion	299	827.91	1653.80	827.91	1653.80	2	1.87	22.7	17275	20	2	130 - 143	R.WMPPATGELRPDVW.-
363	AT1G04630.1	B16.6-1 (GRIM-19)	complex I	a) oxidative phosphorylation	mitochondrion	222	940.47	1878.93	940.47	1878.93	2	0.63	19.9	5638	19	4	17 - 34	K.DMPLLQDGPPPGGFAPVR.Y	Oxidation: 2
363	AT1G04630.1	B16.6-1 (GRIM-19)	complex I	a) oxidative phosphorylation	mitochondrion	45	547.77	1093.52	547.76	1093.52	2	1.56	12.7	205566	65	4	120 - 129	K.VGENVYNSGR.W
363	AT1G04630.1	B16.6-1 (GRIM-19)	complex I	a) oxidative phosphorylation	mitochondrion	70	462.25	922.49	462.25	922.49	2	-0.40	14	20891	28	2	97 - 103	R.FVSEWKK.Y
363	AT1G04630.1	B16.6-1 (GRIM-19)	complex I	a) oxidative phosphorylation	mitochondrion	43	547.77	1093.52	547.76	1093.52	2	2.11	12.7	115126	67	4	120 - 129	K.VGENVYNSGR.W
363	AT1G04630.1	B16.6-1 (GRIM-19)	complex I	a) oxidative phosphorylation	mitochondrion	289	932.48	1862.94	932.47	1862.93	2	1.81	22.2	12380	65	3	17 - 34	K.DMPLLQDGPPPGGFAPVR.Y
363	AT1G04630.1	B16.6-1 (GRIM-19)	complex I	a) oxidative phosphorylation	mitochondrion	229	940.48	1878.94	940.47	1878.93	2	3.63	20.2	72511	108	4	17 - 34	K.DMPLLQDGPPPGGFAPVR.Y	Oxidation: 2
143	AT2G33220.1	B16.6-2	complex I	a) oxidative phosphorylation	mitochondria	176	551.63	1651.87	551.64	1651.89	3	-11.05	18.4	6674	41	2	83 - 96	R.RAILPILQAEEDER.F
143	AT2G33220.1	B16.6-2	complex I	a) oxidative phosphorylation	mitochondria	191	748.90	1495.78	748.90	1495.79	2	-6.85	20	4343	64	5	84 - 96	R.AILPILQAEEDER.F
143	AT2G33220.1	B16.6-2	complex I	a) oxidative phosphorylation	mitochondria	172	940.46	1878.91	940.47	1878.93	2	-9.04	18.2	26525	87	3	17 - 34	K.DMPLLQDGPPPGGFAPVR.Y	Oxidation: 2
143	AT2G33220.1	B16.6-2	complex I	a) oxidative phosphorylation	mitochondria	169	940.46	1878.91	940.47	1878.93	2	-8.79	18.1	28339	85	3	17 - 34	K.DMPLLQDGPPPGGFAPVR.Y	Oxidation: 2
143	AT2G33220.1	B16.6-2	complex I	a) oxidative phosphorylation	mitochondria	174	940.46	1878.91	940.47	1878.93	2	-8.80	18.2	19755	70	3	17 - 34	K.DMPLLQDGPPPGGFAPVR.Y	Oxidation: 2
143	AT2G33220.1	B16.6-2	complex I	a) oxidative phosphorylation	mitochondria	24	547.76	1093.50	547.76	1093.52	2	-10.61	11	82616	62	4	120 - 129	K.VGENVYNSGR.W
143	AT2G33220.1	B16.6-2	complex I	a) oxidative phosphorylation	mitochondria	78	638.79	1275.56	638.79	1275.57	2	-10.08	14.5	9117	48	2	104 - 113	K.YLEYEADVMK.D	Oxidation: 9
143	AT2G33220.1	B16.6-2	complex I	a) oxidative phosphorylation	mitochondria	80	638.79	1275.56	638.79	1275.57	2	-9.95	14.6	8834	33	2	104 - 113	K.YLEYEADVMK.D	Oxidation: 9
143	AT2G33220.1	B16.6-2	complex I	a) oxidative phosphorylation	mitochondria	25	547.76	1093.50	547.76	1093.52	2	-9.96	11	106296	65	4	120 - 129	K.VGENVYNSGR.W
143	AT2G33220.1	B16.6-2	complex I	a) oxidative phosphorylation	mitochondria	193	748.90	1495.78	748.90	1495.79	2	-7.18	20	18300	55	5	84 - 96	R.AILPILQAEEDER.F
143	AT2G33220.1	B16.6-2	complex I	a) oxidative phosphorylation	mitochondria	139	630.79	1259.57	630.79	1259.57	2	-7.31	16.4	4123	41	1	104 - 113	K.YLEYEADVMK.D
143	AT2G33220.1	B16.6-2	complex I	a) oxidative phosphorylation	mitochondria	173	627.31	1878.91	627.32	1878.93	3	-9.05	18.2	26506	66	3	17 - 34	K.DMPLLQDGPPPGGFAPVR.Y	Oxidation: 2
143	AT2G33220.1	B16.6-2	complex I	a) oxidative phosphorylation	mitochondria	161	653.64	1957.90	653.64	1957.91	3	-7.08	17.8	5232	49	3	104 - 119	K.YLEYEADVMKDVPGWK.V	Oxidation: 9
143	AT2G33220.1	B16.6-2	complex I	a) oxidative phosphorylation	mitochondria	164	653.64	1957.89	653.64	1957.91	3	-9.68	17.9	8729	26	3	104 - 119	K.YLEYEADVMKDVPGWK.V	Oxidation: 9
143	AT2G33220.1	B16.6-2	complex I	a) oxidative phosphorylation	mitochondria	175	551.63	1651.87	551.64	1651.89	3	-12.06	18.3	4672	50	2	83 - 96	R.RAILPILQAEEDER.F
143	AT2G33220.1	B16.6-2	complex I	a) oxidative phosphorylation	mitochondria	23	547.76	1093.50	547.76	1093.52	2	-10.23	11	9043	74	4	120 - 129	K.VGENVYNSGR.W
143	AT2G33220.1	B16.6-2	complex I	a) oxidative phosphorylation	mitochondria	195	748.90	1495.78	748.90	1495.79	2	-6.91	20.1	18775	39	5	84 - 96	R.AILPILQAEEDER.F
143	AT2G33220.1	B16.6-2	complex I	a) oxidative phosphorylation	mitochondria	26	547.76	1093.50	547.76	1093.52	2	-13.44	11.1	56454	73	4	120 - 129	K.VGENVYNSGR.W
143	AT2G33220.1	B16.6-2	complex I	a) oxidative phosphorylation	mitochondria	162	653.64	1957.90	653.64	1957.91	3	-7.23	17.8	10219	35	3	104 - 119	K.YLEYEADVMKDVPGWK.V	Oxidation: 9
143	AT2G33220.1	B16.6-2	complex I	a) oxidative phosphorylation	mitochondria	170	627.31	1878.91	627.32	1878.93	3	-8.79	18.1	27664	84	3	17 - 34	K.DMPLLQDGPPPGGFAPVR.Y	Oxidation: 2
143	AT2G33220.1	B16.6-2	complex I	a) oxidative phosphorylation	mitochondria	192	748.90	1495.78	748.90	1495.79	2	-7.09	20	9001	53	5	84 - 96	R.AILPILQAEEDER.F
143	AT2G33220.1	B16.6-2	complex I	a) oxidative phosphorylation	mitochondria	168	627.31	1878.91	627.32	1878.93	3	-8.94	18	7872	72	3	17 - 34	K.DMPLLQDGPPPGGFAPVR.Y	Oxidation: 2
143	AT2G33220.1	B16.6-2	complex I	a) oxidative phosphorylation	mitochondria	194	748.90	1495.78	748.90	1495.79	2	-6.46	20.1	21473	47	5	84 - 96	R.AILPILQAEEDER.F
223	AT2G33220.1	B16.6-2	complex I	a) oxidative phosphorylation	mitochondria	228	748.90	1495.78	748.90	1495.79	2	-6.53	20.23968333	8011	39	3	84 - 96	R.AILPILQAEEDER.F
223	AT2G33220.1	B16.6-2	complex I	a) oxidative phosphorylation	mitochondria	149	630.79	1259.57	630.79	1259.57	2	-6.14	16.56915	4443	44	1	104 - 113	K.YLEYEADVMK.D
223	AT2G33220.1	B16.6-2	complex I	a) oxidative phosphorylation	mitochondria	229	748.90	1495.78	748.90	1495.79	2	-7.73	20.28016667	7978	36	3	84 - 96	R.AILPILQAEEDER.F
223	AT2G33220.1	B16.6-2	complex I	a) oxidative phosphorylation	mitochondria	200	940.47	1878.92	940.47	1878.93	2	-4.98	18.37325	11273	42	3	17 - 34	K.DMPLLQDGPPPGGFAPVR.Y	Oxidation: 2
223	AT2G33220.1	B16.6-2	complex I	a) oxidative phospho