Gelmap. Spot visualization by LUH

Proteinlist

-IDXYProtein scoreCoverage# peptidesCalc massApp mass 2DApp mass 1DAccessionNameProtein complexAssociated GO termsPeptides sequences
[show peptides]15-12293116148.5926280021748.156XP_004972100PREDICTED: uncharacterized protein LOC101763014noneC:chloroplast envelope; F:zinc ion binding; F:proton-transporting ATP synthase activity, rotational mechanism; P:ATP hydrolysis coupled proton transport; C:nucleolus; F:cobalt ion binding; C:mitochondrial respiratory chain complex I; C:mitochondrial proton-transporting ATP synthase, catalytic core; P:ATP synthesis coupled proton transport; P:response to cadmium ion; P:ATP catabolic process; C:plasma membrane; F:copper ion binding; F:poly(U) RNA binding; F:ATP binding; P:response to oxidative strFTQANSEVSALLGR-IPSAVGYQPTLATDLGGLQER-LVLEVAQHLGENVVR-VLNTGSPITVPVGR-AHGGFSVFAGVGER-VGLTGLTVAEHFR
[show peptides]15-3347115339.09328222274812.963EMJ23583hypothetical protein PRUPE_ppa006025mgnoneC:mitochondrion; P:response to salt stress; P:nitrogen fixation; C:chloroplast envelope; P:glutamine biosynthetic process; F:ATP binding; F:glutamate-ammonia ligase activity; C:chloroplast thylakoid membrane; C:chloroplast stroma; P:response to cadmium ion; C:cytosolic ribosome; C:apoplastVPIIVTGNDFSTLYAPLIR-IGVcTGIFR-LVDcFPGQSIDFFGALR
[show peptides]15-70244295186.0663175582940.0813XP_003532074PREDICTED: oxygen-evolving enhancer protein 2, chloroplastic-likenoneP:defense response to bacterium; C:chloroplast envelope; C:extrinsic to membrane; C:thylakoid lumen; F:poly(U) RNA binding; F:calcium ion binding; C:chloroplast stroma; C:apoplast; P:photosynthesis; C:chloroplast thylakoid membrane; C:oxygen evolving complexKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSR-mLSPHILGEDHYNTAR-FTQANSEVSALLGR-EAPSFVEQATEQQILVTGIK-QISELGIYPAVDPLDSTSR-cALVYGQMNEPPGAR-IPSAVGYQPTLATDLGGLQER-VLNTGSPITVPVGR-AHGGFSVFAGVGER-LVLEVAQHLGENVVR-VGLTGLTVAEHFRTIAMDGTEGLVR-IINVIGEPIDEKGDIK-TVLImELINNVAK
[show peptides]15-97531301192.143382787751.1511XP_003532074PREDICTED: oxygen-evolving enhancer protein 2, chloroplastic-likenoneP:defense response to bacterium; C:chloroplast envelope; C:extrinsic to membrane; C:thylakoid lumen; F:poly(U) RNA binding; F:calcium ion binding; C:chloroplast stroma; C:apoplast; P:photosynthesis; C:chloroplast thylakoid membrane; C:oxygen evolving complexIPSAVGYQPTLATDLGGLQER-FTQANSEVSALLGR-mLSPHILGEDHYNTAR-VLNTGSPITVPVGR-VGLTGLTVAEHFR-QISELGIYPAVDPLDSTSR-cALVYGQMNEPPGAR-TIAMDGTEGLVR-VVDLLAPYQR-TIAmDGTEGLVR-IINVIGEPIDEK
[show peptides]15-105727193115.6960663795538.0411EOX97859Fructose-bisphosphate aldolase 1noneC:thylakoid lumen; C:chloroplast envelope; P:response to abscisic acid stimulus; P:glycolysis; C:plastoglobule; F:fructose-bisphosphate aldolase activity; P:response to cadmium ion; C:cytosolic ribosome; C:membrane; C:apoplastRVSLIGLGQSASTPTAFR-LTTASAIASGTVLGIHDDTR-AAQASNIGIVLASSEGLSAESK-VSLIGLGQSASTPTAFR-QLVNSPANVLTPAVLADEASK-FDmGGSAAVLGAAK-QLSGLLAEASSEEDFTGK-QGGAITAALFLK-GLGEAVAAAAK-YAEDVSSGIIFGR-GLTFDSGGYNIK
[show peptides]15-11048341731.09627079963739.8310EOY28536Photosystem II subunit Q-2noneC:chloroplast thylakoid lumen; C:extrinsic to membrane; F:calcium ion binding; C:chloroplast stroma; C:apoplast; P:photosynthesis; C:chloroplast thylakoid membrane; C:oxygen evolving complexRVSLIGLGQSASTPTAFR-LTTASAIASGTVLGIHDDTR-AAQASNIGIVLASSEGLSAESK-VSLIGLGQSASTPTAFR-SVDILGLGSGPEVDKK-YAEDVSSGIIFGR-FDmGGSAAVLGAAK-LTLADALVYAcNQGVEK-QLVNSPANVLTPAVLADEASK-QGGAITAALFLK
[show peptides]15-11236432951.58629298210141.221XP_003532074PREDICTED: oxygen-evolving enhancer protein 2, chloroplastic-likenoneP:defense response to bacterium; C:chloroplast envelope; C:extrinsic to membrane; C:thylakoid lumen; F:poly(U) RNA binding; F:calcium ion binding; C:chloroplast stroma; C:apoplast; P:photosynthesis; C:chloroplast thylakoid membrane; C:oxygen evolving complexTFQGPPHGIQVER
[show peptides]15-11623925353.88141131401134.881XP_002312588plastid-lipid associated protein PAPnoneC:plastoglobule; P:defense response to bacterium; C:chloroplast envelope; C:thylakoid lumen; C:plasma membrane; P:chloroplast organization; P:response to ozone; C:nucleus; C:chloroplast thylakoid membrane; F:structural molecule activityMQGGLGVGGGSGR
[show peptides]15-118185284136.6648.854XP_003532074PREDICTED: oxygen-evolving enhancer protein 2, chloroplastic-likenoneP:defense response to bacterium; C:chloroplast envelope; C:extrinsic to membrane; C:thylakoid lumen; F:poly(U) RNA binding; F:calcium ion binding; C:chloroplast stroma; C:apoplast; P:photosynthesis; C:chloroplast thylakoid membrane; C:oxygen evolving complexSLPGITIDEKR-AEEDGVAcVEFIAGK-FPSVEVDLPAmmAQK-TPFTAGLGLEK
[show peptides]30-02446525.85312676429712.43XP_002279101PREDICTED: stromal 70 kDa heat shock-related protein, chloroplastic-likenoneP:oxidation-reduction process; C:mitochondrion; P:protein folding; P:response to cold; C:chloroplast envelope; P:response to heat; C:thylakoid; F:ATP binding; C:chloroplast stroma; F:2-alkenal reductase [NAD(P)] activity; F:unfolded protein binding; P:protein targeting to chloroplast; P:response to cadmium ion; C:nucleus; C:apoplastAAALNIVPTSTGAAK-KGLTAEDVNAAFR-GLTAEDVNAAFR
[show peptides]30-13277130.79572367668215.371XP_002284008PREDICTED: heat shock cognate 70 kDa protein isoform 1noneF:2-alkenal reductase [NAD(P)] activity; F:ATP binding; P:response to stress; P:oxidation-reduction processTFQGPPHGIQVER
[show peptides]30-627810591.45259785652237.771XP_004972100PREDICTED: uncharacterized protein LOC101763014noneC:chloroplast envelope; F:zinc ion binding; F:proton-transporting ATP synthase activity, rotational mechanism; P:ATP hydrolysis coupled proton transport; C:nucleolus; F:cobalt ion binding; C:mitochondrial respiratory chain complex I; C:mitochondrial proton-transporting ATP synthase, catalytic core; P:ATP synthesis coupled proton transport; P:response to cadmium ion; P:ATP catabolic process; C:plasma membrane; F:copper ion binding; F:poly(U) RNA binding; F:ATP binding; P:response to oxidative strTFQGPPHGIQVER
[show peptides]30-72931082.61010313034063.331XP_002283310PREDICTED: mitochondrial-processing peptidase subunit alphanoneF:metal ion binding; C:mitochondrial inner membrane; F:ubiquinol-cytochrome-c reductase activity; F:metalloendopeptidase activity; C:respiratory chain; P:proteolysis; P:electron transport chainIATESSLAAR
[show peptides]30-8312108139.2402093410545.861XP_004972100PREDICTED: uncharacterized protein LOC101763014noneC:chloroplast envelope; F:zinc ion binding; F:proton-transporting ATP synthase activity, rotational mechanism; P:ATP hydrolysis coupled proton transport; C:nucleolus; F:cobalt ion binding; C:mitochondrial respiratory chain complex I; C:mitochondrial proton-transporting ATP synthase, catalytic core; P:ATP synthesis coupled proton transport; P:response to cadmium ion; P:ATP catabolic process; C:plasma membrane; F:copper ion binding; F:poly(U) RNA binding; F:ATP binding; P:response to oxidative strIATESSLAAR
[show peptides]30-932910852.74391055107134.533XP_004972100PREDICTED: uncharacterized protein LOC101763014noneC:chloroplast envelope; F:zinc ion binding; F:proton-transporting ATP synthase activity, rotational mechanism; P:ATP hydrolysis coupled proton transport; C:nucleolus; F:cobalt ion binding; C:mitochondrial respiratory chain complex I; C:mitochondrial proton-transporting ATP synthase, catalytic core; P:ATP synthesis coupled proton transport; P:response to cadmium ion; P:ATP catabolic process; C:plasma membrane; F:copper ion binding; F:poly(U) RNA binding; F:ATP binding; P:response to oxidative strLIEYGNmLVQEQENVKR-EENPRVPIIVTGNDFSTLYAPLIR-IGVcTGIFR
[show peptides]30-1334611614.66645002365110.3710XP_003632187PREDICTED: ribulose bisphosphate carboxylase/oxygenase activase 2, chloroplastic isoform 2noneF:ATP binding; C:chloroplast stroma
[show peptides]30-14364116154.9891362190257.3714XP_004972100PREDICTED: uncharacterized protein LOC101763014noneC:chloroplast envelope; F:zinc ion binding; F:proton-transporting ATP synthase activity, rotational mechanism; P:ATP hydrolysis coupled proton transport; C:nucleolus; F:cobalt ion binding; C:mitochondrial respiratory chain complex I; C:mitochondrial proton-transporting ATP synthase, catalytic core; P:ATP synthesis coupled proton transport; P:response to cadmium ion; P:ATP catabolic process; C:plasma membrane; F:copper ion binding; F:poly(U) RNA binding; F:ATP binding; P:response to oxidative str"mGINPImmSAGELESGNAGEPAKLIR-MGINPImmSAGELESGNAGEPAK-VPIIVTGNDFSTLYAPLIR-mGINPImmSAGELESGNAGEPAK-VQLADKYLAEAALGDANQDAVDQGTFYG-LIEYGNmLVQEQENVK-LIEYGNMLVQEQENVKR-GLAYDTSDDQQDITR-MGINPIMMSAGELESGNAGEPAK-mccLFINDLDAGAGR-MGINPIMmSAGELESGNAGEPAK-GKmccLFINDLDAGAGR-LIEYGNmLVQEQENVKR-WISGVGVDTIGKK "
[show peptides]30-15381116103.7384376525945.519XP_004972100PREDICTED: uncharacterized protein LOC101763014noneC:chloroplast envelope; F:zinc ion binding; F:proton-transporting ATP synthase activity, rotational mechanism; P:ATP hydrolysis coupled proton transport; C:nucleolus; F:cobalt ion binding; C:mitochondrial respiratory chain complex I; C:mitochondrial proton-transporting ATP synthase, catalytic core; P:ATP synthesis coupled proton transport; P:response to cadmium ion; P:ATP catabolic process; C:plasma membrane; F:copper ion binding; F:poly(U) RNA binding; F:ATP binding; P:response to oxidative strEENPRVPIIVTGNDFSTLYAPLIR-mGINPImmSAGELESGNAGEPAKLIR-mGINPImMSAGELESGNAGEPAK-MGINPImMSAGELESGNAGEPAK-VPIIVTGNDFSTLYAPLIR-mGINPImmSAGELESGNAGEPAK-LIEYGNMLVQEQENVKR-GKmccLFINDLDAGAGR-LVDcFPGQSIDFFGALR-GLAYDTSDDQQDITR-KWISGVGVDTIGK-WISGVGVDTIGKK-mccLFINDLDAGAGR-MGINPIMMSAGELESGNAGEPAK-LIEYGNmLVQEQENVKR-LIEYGNMLVQEQENVK-QYmDNNmDGFYIAPAFMDK-VPLILGVWGGK-VQLADKYLAEAALGDANQDAVDQGTFYG
[show peptides]30-1640611469.51777958869934.918EMJ05405hypothetical protein PRUPE_ppa003434mgnoneP:leaf senescence; C:vacuole; F:manganese ion binding; F:metalloexopeptidase activity; F:aminopeptidase activity; C:chloroplast stroma; P:proteolysis; C:cytosolGKGmVDSLFQAPmGTGTHYAVLSSYEYLSTGLR-mGINPImmSAGELESGNAGEPAKLIR-GmVDSLFQAPmGTGTHYAVLSSYEYLSTGLR-VQLADKYLAEAALGDANQDAVDQGTFYG-LIEYGNMLVQEQENVKR-mGINPImmSAGELESGNAGEPAK-MGINPImmSAGELESGNAGEPAK-MGINPIMmSAGELESGNAGEPAK-YLAEAALGDANQDAVDQGTFYG-MGINPIMMSAGELESGNAGEPAK-LVDcFPGQSIDFFGALR-LIEYGNmLVQEQENVKR-mccLFINDLDAGAGR-LIEYGNmLVQEQENVK-GLAYDTSDDQQDITR-VPLILGVWGGK-IGVcTGIFR-WISGVGVDTIGKK
[show peptides]30-1743511473.88172745704630.93EMJ05405hypothetical protein PRUPE_ppa003434mgnoneP:leaf senescence; C:vacuole; F:manganese ion binding; F:metalloexopeptidase activity; F:aminopeptidase activity; C:chloroplast stroma; P:proteolysis; C:cytosolAISGQPPLKLPIPGER-AGPEAEAEASSYSK-ALVDTVYGTDFGFR
[show peptides]30-184541142.65312457084667.652AFA27695ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit, partialnoneP:reductive pentose-phosphate cycle; F:ribulose-bisphosphate carboxylase activity; F:monooxygenase activity; P:photorespiration; F:magnesium ion binding; C:chloroplast; P:oxidation-reduction processVAPEPEENKEEAEEANTK-TVHQEEVAVVAPK
[show peptides]30-194691162.87267851829531.593XP_002283273PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrialnoneF:zinc ion binding; C:integral to membrane; F:metalloendopeptidase activity; P:protein catabolic process; P:proteolysis; F:ATPase activity; C:chloroplast thylakoid membrane; P:ATP catabolic process; F:ATP binding; C:mitochondrionWLLQPVGDGDTR-VDmPGAFEIASNLVTVGR-EGSLLVTDLDSTNGTFIDDR
[show peptides]30-2049711940.16481304168736.092XP_002519286dihydrolipoamide dehydrogenase, putativenoneF:copper ion binding; P:hydrogen peroxide catabolic process; P:oxidation-reduction process; F:zinc ion binding; C:mitochondrial respiratory chain complex I; F:cobalt ion binding; P:response to light stimulus; P:cell redox homeostasis; F:electron carrier activity; F:ATP binding; F:flavin adenine dinucleotide binding; C:mitochondrial matrix; F:dihydrolipoyl dehydrogenase activity; C:chloroplast; P:response to cadmium ion; C:Golgi apparatus; C:apoplastVAAAAAAADAEELTIEER-LIPAAASGDSK
[show peptides]30-2153711611.5177340507519.913EMJ12384hypothetical protein PRUPE_ppa005598mgnoneP:regulation of proton transport; P:pentose-phosphate shunt; P:response to glucose stimulus; P:response to far red light; C:chloroplast envelope; P:hydrogen peroxide catabolic process; C:apoplast; P:response to sucrose stimulus; F:NAD binding; C:stromule; P:unsaturated fatty acid biosynthetic process; P:response to red light; P:photosystem II assembly; P:isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway; F:NADP binding; P:chloroplast relocation; P:defense response to bIISSIEQKEESR-KEAAESTLTAYK-AAQDIANSELAPTHPIR
[show peptides]30-225651166.08534264564517.658AFA27695ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit, partialnoneP:reductive pentose-phosphate cycle; F:ribulose-bisphosphate carboxylase activity; F:monooxygenase activity; P:photorespiration; F:magnesium ion binding; C:chloroplast; P:oxidation-reduction processFEEKDGIDYAAVTVQLPGGER-QLVASGKPESFSGEFLVPSYR-TKPETGEVIGVFESVQPSDTDLGAK-GTGTANQcPTIDGGLDSFAFKPGK-GRGGSTGYDNAVALPAGGR-DGIDYAAVTVQLPGGER-GGSTGYDNAVALPAGGRGDEEDLTK-KIcLEPTSFTVK
[show peptides]30-236251167.75389051437387.6510AFA27695ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit, partialnoneP:reductive pentose-phosphate cycle; F:ribulose-bisphosphate carboxylase activity; F:monooxygenase activity; P:photorespiration; F:magnesium ion binding; C:chloroplast; P:oxidation-reduction process"FEEKDGIDYAAVTVQLPGGER-QLVASGKPESFSGEFLVPSYR-GGSTGYDNAVALPAGGRGDEEDLTK-GRGGSTGYDNAVALPAGGR-TKPETGEVIGVFESVQPSDTDLGAK-LTYTLDEIEGPFEVSPDGTVKFEEK-DGIDYAAVTVQLPGGER-GGSTGYDNAVALPAGGR-IcLEPTSFTVKAESVSK-LTYTLDEIEGPFEVSPDGTVK "
[show peptides]30-246481165.49104714393624.0211AAK07827AF297643_1mitochondrial processing peptidase beta subunitnoneC:vacuolar membrane; P:response to misfolded protein; P:pentose-phosphate shunt; P:photorespiration; F:zinc ion binding; C:mitochondrial intermembrane space; C:mitochondrial matrix; P:response to salt stress; P:proteasome core complex assembly; C:chloroplast; C:cell wall; C:nucleolus; P:ubiquitin-dependent protein catabolic process; C:mitochondrial outer membrane; F:metalloendopeptidase activity; P:response to cadmium ion; C:mitochondrial respiratory chain complex III; C:plasma membraneFEEKDGIDYAAVTVQLPGGER-GRGGSTGYDNAVALPAGGR-LTYTLDEIEGPFEVSPDGTVKFEEK-QLVASGKPESFSGEFLVPSYR-TKPETGEVIGVFESVQPSDTDLGAK-GTGTANQcPTIDGGLDSFAFKPGK-DGIDYAAVTVQLPGGER-LTYTLDEIEGPFEVSPDGTVK-GGSTGYDNAVALPAGGRGDEEDLTK-GGSTGYDNAVALPAGGR-RLTYDEIQSK
[show peptides]30-256701163.1202089786531.923AAK07827AF297643_1mitochondrial processing peptidase beta subunitnoneC:vacuolar membrane; P:response to misfolded protein; P:pentose-phosphate shunt; P:photorespiration; F:zinc ion binding; C:mitochondrial intermembrane space; C:mitochondrial matrix; P:response to salt stress; P:proteasome core complex assembly; C:chloroplast; C:cell wall; C:nucleolus; P:ubiquitin-dependent protein catabolic process; C:mitochondrial outer membrane; F:metalloendopeptidase activity; P:response to cadmium ion; C:mitochondrial respiratory chain complex III; C:plasma membraneAAQDIAQADLASTHPIR-KAAAEDTmLAYK-IVSSIEQKEEGR
[show peptides]30-2624413612.63542914390611.526XP_003632187PREDICTED: ribulose bisphosphate carboxylase/oxygenase activase 2, chloroplastic isoform 2noneF:ATP binding; C:chloroplast stromaTDSEGGFESDAVATANILESSTPEIGGK-TDSEGGFESDAVATANILESSTPEIGGKK-TADGDEGGKHQLITASIK-KYYFVSVLTR-HQLITASIKDGK-YEDNFDTTSNVSVMVTPTDK
[show peptides]30-30369151127.5807211399161.984EOY14103Phosphoglycerate kinase 1noneP:photosynthesis, light reaction; P:pentose-phosphate shunt; P:response to glucose stimulus; C:chloroplast envelope; P:hydrogen peroxide catabolic process; C:apoplast; P:response to sucrose stimulus; C:stromule; P:salicylic acid biosynthetic process; C:membrane; P:starch biosynthetic process; P:cellular cation homeostasis; P:isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway; P:maltose metabolic process; P:phosphorylation; P:defense response to bacterium; C:cell wall; CLATWIEEmNKNEAYTQTR-ETLPPALTSTSDPPPVFDGTTR-VPALEHNNEVR-LYISYTcPFAQR
[show peptides]30-37273162215.6620075702756.453XP_003632187PREDICTED: ribulose bisphosphate carboxylase/oxygenase activase 2, chloroplastic isoform 2noneF:ATP binding; C:chloroplast stromaAITDFGSPENFLAEVNYLLGK-TADGDEGGKHQLITASIK-KFVESAASSFSVA
[show peptides]30-38295162278.5746238231769.821XP_003632187PREDICTED: ribulose bisphosphate carboxylase/oxygenase activase 2, chloroplastic isoform 2noneF:ATP binding; C:chloroplast stromaAINGGEcGGGNPGAVQAR
[show peptides]30-39327165205.0273942947457.373XP_003632187PREDICTED: ribulose bisphosphate carboxylase/oxygenase activase 2, chloroplastic isoform 2noneF:ATP binding; C:chloroplast stromaTADGDEGGKHQLITASIK-HQLITASIK-AITDFGSPENFLAEVNYLLGK
[show peptides]30-465117343.69800329208423.064XP_006432747hypothetical protein CICLE_v10002003mgnoneC:plastoglobule; F:2-alkenal reductase [NAD(P)] activity; C:chloroplast thylakoid membrane; P:oxidation-reduction process; F:structural molecule activityGLFIIDKEGVIQHSTINNLAIGR-EGVIQHSTINNLAIGR-SGGLGDLKYPLISDVTK-SYDVLIPDQGIALR
[show peptides]30-49262077.822390556335517.611#N/A#N/Anone#N/AAAVTTAFVNQFPGLNGLGISLAR
[show peptides]30-50935216.00468945503224.183XP_002273249PREDICTED: zeaxanthin epoxidase, chloroplasticnoneP:stomatal complex morphogenesis; P:pentose-phosphate shunt; P:positive regulation of catalytic activity; P:starch biosynthetic process; P:photosystem II assembly; P:maltose metabolic process; C:chloroplast stroma; P:plastid organization; C:chloroplast thylakoid membrane; P:rRNA processingAIGcELDLSDKPIGLGVR-RYALLAEDGVVK-SILFAVPGAFTPTcSQK
[show peptides]30-5517023313.31702804565411.754NP_00126785214-3-3 proteinnoneC:vacuole; F:protein domain specific binding; P:response to cadmium ion; C:plasma membrane; C:chloroplast; C:nucleus; C:cytosol; C:apoplast; P:brassinosteroid mediated signaling pathwayAIGcELDLSDKPIGLGVR-ENLGIGDEVLLLSDGNGDFTR-RYALLAEDGVVK-SILFAVPGAFTPTcSQK
[show peptides]30-5619923311.7143487930315.594XP_006472571PREDICTED: 14-3-3-like protein-likenoneC:vacuole; F:protein domain specific binding; P:response to cadmium ion; C:plasma membrane; C:chloroplast; C:nucleus; C:cytosol; C:apoplast; P:brassinosteroid mediated signaling pathwayHAGDLGNIVANADGVAEATIVDTQIPLSGPNAVVGR-ALVVHELEDDLGKGGHELSLTTGNAGGR-GTSSVEGVVTLSQEGDGPTTVNVR-GGHELSLTTGNAGGR
[show peptides]30-57244236160.1269304752453.781ADZ75466oxygen evolving enhancer protein 1noneC:extrinsic to membrane; F:poly(U) RNA binding; F:oxygen evolving activity; F:calcium ion binding; P:defense response to bacterium; C:chloroplast thylakoid membrane; P:photoinhibition; C:plastoglobule; P:photosystem II assembly; P:regulation of protein dephosphorylation; P:photosystem II stabilization; C:oxygen evolving complex; C:chloroplast thylakoid lumen; C:apoplastVSGVEISPSPVAR
[show peptides]30-58284239283.3200023174370.093ADZ75466oxygen evolving enhancer protein 1noneC:extrinsic to membrane; F:poly(U) RNA binding; F:oxygen evolving activity; F:calcium ion binding; P:defense response to bacterium; C:chloroplast thylakoid membrane; P:photoinhibition; C:plastoglobule; P:photosystem II assembly; P:regulation of protein dephosphorylation; P:photosystem II stabilization; C:oxygen evolving complex; C:chloroplast thylakoid lumen; C:apoplastENLGIGDEVLLLSDGNGDFTR-AIGcELDLSDKPIGLGVR-RYALLAEDGVVK
[show peptides]30-59321236298.7698838710863.752ADZ75466oxygen evolving enhancer protein 1noneC:extrinsic to membrane; F:poly(U) RNA binding; F:oxygen evolving activity; F:calcium ion binding; P:defense response to bacterium; C:chloroplast thylakoid membrane; P:photoinhibition; C:plastoglobule; P:photosystem II assembly; P:regulation of protein dephosphorylation; P:photosystem II stabilization; C:oxygen evolving complex; C:chloroplast thylakoid lumen; C:apoplastcINcDGAGSLTcTTcQGSGIQPR-DNTQPcFPcDGSGAQR
[show peptides]30-6119327021.02320170402519.711ADK9307914-3-3f proteinnoneC:cytosol; P:defense response to bacterium; C:plant-type cell wall; F:protein domain specific binding; P:brassinosteroid mediated signaling pathway; C:chloroplast; P:response to cadmium ion; C:nucleus; C:plasma membraneEYWTDALEKVSLMENDIR
[show peptides]30-6327527598.79875564575243.131XP_003532074PREDICTED: oxygen-evolving enhancer protein 2, chloroplastic-likenoneP:defense response to bacterium; C:chloroplast envelope; C:extrinsic to membrane; C:thylakoid lumen; F:poly(U) RNA binding; F:calcium ion binding; C:chloroplast stroma; C:apoplast; P:photosynthesis; C:chloroplast thylakoid membrane; C:oxygen evolving complexAAVTTAFVNQFPGLNGLGISLAR
[show peptides]30-6732127358.02119231224139.243XP_002281575PREDICTED: protein IN2-1 homolog B-likenoneP:toxin catabolic process; F:glutathione transferase activity; P:response to cyclopentenone; C:chloroplast stroma; P:protein glutathionylationGITINTATVEYETENR-KYDEIDAAPEER-VGETLDLVGLR
[show peptides]30-7129529515.85088896751420.992XP_003532074PREDICTED: oxygen-evolving enhancer protein 2, chloroplastic-likenoneP:defense response to bacterium; C:chloroplast envelope; C:extrinsic to membrane; C:thylakoid lumen; F:poly(U) RNA binding; F:calcium ion binding; C:chloroplast stroma; C:apoplast; P:photosynthesis; C:chloroplast thylakoid membrane; C:oxygen evolving complexGFVYREHHHSPGYYDGR-KFETLSYLPPLTPTQLAK
[show peptides]30-721623104.6016678810126.411XP_002274620PREDICTED: endochitinase PR4noneF:chitinase activity; P:carbohydrate metabolic process; P:chitin catabolic process; F:chitin binding; P:cell wall macromolecule catabolic processAGPEAEAEASSYSK
[show peptides]30-7318731010.686392545714.893XP_003532074PREDICTED: oxygen-evolving enhancer protein 2, chloroplastic-likenoneP:defense response to bacterium; C:chloroplast envelope; C:extrinsic to membrane; C:thylakoid lumen; F:poly(U) RNA binding; F:calcium ion binding; C:chloroplast stroma; C:apoplast; P:photosynthesis; C:chloroplast thylakoid membrane; C:oxygen evolving complexTADGDEGGKHQLITASIK-HQLITASIK-AITDFGSPENFLAEVNYLLGK
[show peptides]30-7422431231.55383563041721.014XP_002530152peroxiredoxins, prx-1, prx-2, prx-3, putativenoneP:defense response to bacterium; C:chloroplast envelope; P:response to cold; C:stromule; F:peroxidase activity; F:peroxiredoxin activity; C:chloroplast stroma; C:thylakoid; C:apoplast; P:oxidation-reduction processGLFIIDKEGVIQHSTINNLAIGR-EGVIQHSTINNLAIGR-SGGLGDLKYPLISDVTK-SYDVLIPDQGIALR
[show peptides]30-763462988.531853199005111.921ABV03161germin-like proteinnoneF:nutrient reservoir activity; P:photosynthesis, light reaction; P:stomatal complex morphogenesis; F:manganese ion binding; P:defense response to bacterium; F:oxalate oxidase activity; P:response to cold; C:plant-type cell wall; P:cellular cation homeostasis; C:extracellular matrix; P:divalent metal ion transport; C:nucleus; C:apoplastAAVTTAFVNQFPGLNGLGISLAR
[show peptides]30-8025838129.40210366249146.813EOY08108Thioredoxin superfamily proteinnoneP:defense response to bacterium; C:chloroplast envelope; C:plant-type cell wall; F:peroxidase activity; F:peroxiredoxin activity; C:chloroplast stroma; C:thylakoid; P:oxidation-reduction processAIGcELDLSDKPIGLGVR-RYALLAEDGVVK-SILFAVPGAFTPTcSQK
[show peptides]30-8227542340.3276736736348.944EOY08108Thioredoxin superfamily proteinnoneP:defense response to bacterium; C:chloroplast envelope; C:plant-type cell wall; F:peroxidase activity; F:peroxiredoxin activity; C:chloroplast stroma; C:thylakoid; P:oxidation-reduction processAIGcELDLSDKPIGLGVR-ENLGIGDEVLLLSDGNGDFTR-RYALLAEDGVVK-SILFAVPGAFTPTcSQK
[show peptides]30-83327400137.3503386974345.624BAF80585Cu-Zn superoxide disumtasenoneP:toxin catabolic process; F:metal ion binding; P:response to copper ion; P:response to oxidative stress; F:superoxide dismutase activity; C:chloroplast stroma; P:superoxide metabolic process; P:response to iron ion; C:thylakoid; C:apoplast; P:response to light stimulus; P:oxidation-reduction processHAGDLGNIVANADGVAEATIVDTQIPLSGPNAVVGR-ALVVHELEDDLGKGGHELSLTTGNAGGR-GTSSVEGVVTLSQEGDGPTTVNVR-GGHELSLTTGNAGGR
[show peptides]30-881394833.63837623596198.611XP_002524079Phosphatidylglycerol/phosphatidylinositol transfer protein precursor, putativenoneP:response to nitrate; C:extracellular region; C:vacuole; P:nitrate transportVSGVEISPSPVAR
[show peptides]30-9212842341.57656049728436.173EOY08108Thioredoxin superfamily proteinnoneP:defense response to bacterium; C:chloroplast envelope; C:plant-type cell wall; F:peroxidase activity; F:peroxiredoxin activity; C:chloroplast stroma; C:thylakoid; P:oxidation-reduction processENLGIGDEVLLLSDGNGDFTR-AIGcELDLSDKPIGLGVR-RYALLAEDGVVK
[show peptides]30-93914805.87766003608734.212XP_004499244PREDICTED: protein disulfide-isomerase LQY1-likenoneF:protein disulfide isomerase activity; F:heat shock protein binding; P:protein folding; P:pentose-phosphate shunt; P:rRNA processing; C:chloroplast thylakoid membrane; P:plastid organization; C:chloroplast stroma; P:photosystem II assembly; P:photosystem II repair; F:unfolded protein binding; P:regulation of protein dephosphorylationcINcDGAGSLTcTTcQGSGIQPR-DNTQPcFPcDGSGAQR
[show peptides]30-954692222.6312751770022.271XP_006389285hypothetical protein POPTR_0031s004402g, partialnoneP:defense response; F:ADP binding; F:ATP binding; F:nucleotide binding; F:nucleoside-triphosphatase activity; F:DNA bindingEYWTDALEKVSLMENDIR
[show peptides]30-1004773294.927663326263411.921ABV03161germin-like proteinnoneF:nutrient reservoir activity; P:photosynthesis, light reaction; P:stomatal complex morphogenesis; F:manganese ion binding; P:defense response to bacterium; F:oxalate oxidase activity; P:response to cold; C:plant-type cell wall; P:cellular cation homeostasis; C:extracellular matrix; P:divalent metal ion transport; C:nucleus; C:apoplastAAVTTAFVNQFPGLNGLGISLAR
[show peptides]30-1026363299.41361689567578.093XP_003525588PREDICTED: elongation factor Tu, chloroplastic-likenoneC:chloroplast envelope; C:apoplast; C:nucleoid; F:translation elongation factor activity; P:translational elongation; F:GTP binding; P:GTP catabolic process; C:nucleolus; C:chloroplast stroma; F:GTPase activity; C:chloroplast thylakoid membraneGITINTATVEYETENR-KYDEIDAAPEER-VGETLDLVGLR
[show peptides]30-11187847128.47392606735218.232BAI53118ribulose-1,5-bisphosphate carboxylase/oxygenase small subunitnoneP:reductive pentose-phosphate cycle; F:ribulose-bisphosphate carboxylase activity; F:monooxygenase activity; P:photorespiration; C:chloroplast; P:oxidation-reduction processGFVYREHHHSPGYYDGR-KFETLSYLPPLTPTQLAK
[show peptides]30-121542022.29978275299073.891XP_004972101hypothetical protein CICLE_v10002003mgnoneC:plastoglobule; F:2-alkenal reductase [NAD(P)] activity; C:chloroplast thylakoid membrane; P:oxidation-reduction process; F:structural molecule activityAGPEAEAEASSYSK