| - | ID | X | Y | Protein score | Coverage | # peptides | Calc mass | App mass 2D | App mass 1D | Accession | Name | Protein complex | Associated GO terms | Peptides sequences |
|---|
| [show peptides] | 15-97 | 531 | 301 | 192.1433827877 | 51.15 | 11 | | | | XP_003532074 | PREDICTED: oxygen-evolving enhancer protein 2, chloroplastic-like | none | P:defense response to bacterium; C:chloroplast envelope; C:extrinsic to membrane; C:thylakoid lumen; F:poly(U) RNA binding; F:calcium ion binding; C:chloroplast stroma; C:apoplast; P:photosynthesis; C:chloroplast thylakoid membrane; C:oxygen evolving complex | IPSAVGYQPTLATDLGGLQER-FTQANSEVSALLGR-mLSPHILGEDHYNTAR-VLNTGSPITVPVGR-VGLTGLTVAEHFR-QISELGIYPAVDPLDSTSR-cALVYGQMNEPPGAR-TIAMDGTEGLVR-VVDLLAPYQR-TIAmDGTEGLVR-IINVIGEPIDEK |
| [show peptides] | 15-70 | 244 | 295 | 186.06631755829 | 40.08 | 13 | | | | XP_003532074 | PREDICTED: oxygen-evolving enhancer protein 2, chloroplastic-like | none | P:defense response to bacterium; C:chloroplast envelope; C:extrinsic to membrane; C:thylakoid lumen; F:poly(U) RNA binding; F:calcium ion binding; C:chloroplast stroma; C:apoplast; P:photosynthesis; C:chloroplast thylakoid membrane; C:oxygen evolving complex | KGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSR-mLSPHILGEDHYNTAR-FTQANSEVSALLGR-EAPSFVEQATEQQILVTGIK-QISELGIYPAVDPLDSTSR-cALVYGQMNEPPGAR-IPSAVGYQPTLATDLGGLQER-VLNTGSPITVPVGR-AHGGFSVFAGVGER-LVLEVAQHLGENVVR-VGLTGLTVAEHFRTIAMDGTEGLVR-IINVIGEPIDEKGDIK-TVLImELINNVAK |
| [show peptides] | 15-12 | 293 | 116 | 148.59262800217 | 48.15 | 6 | | | | XP_004972100 | PREDICTED: uncharacterized protein LOC101763014 | none | C:chloroplast envelope; F:zinc ion binding; F:proton-transporting ATP synthase activity, rotational mechanism; P:ATP hydrolysis coupled proton transport; C:nucleolus; F:cobalt ion binding; C:mitochondrial respiratory chain complex I; C:mitochondrial proton-transporting ATP synthase, catalytic core; P:ATP synthesis coupled proton transport; P:response to cadmium ion; P:ATP catabolic process; C:plasma membrane; F:copper ion binding; F:poly(U) RNA binding; F:ATP binding; P:response to oxidative str | FTQANSEVSALLGR-IPSAVGYQPTLATDLGGLQER-LVLEVAQHLGENVVR-VLNTGSPITVPVGR-AHGGFSVFAGVGER-VGLTGLTVAEHFR |
| [show peptides] | 15-118 | 185 | 284 | 136.66 | 48.85 | 4 | | | | XP_003532074 | PREDICTED: oxygen-evolving enhancer protein 2, chloroplastic-like | none | P:defense response to bacterium; C:chloroplast envelope; C:extrinsic to membrane; C:thylakoid lumen; F:poly(U) RNA binding; F:calcium ion binding; C:chloroplast stroma; C:apoplast; P:photosynthesis; C:chloroplast thylakoid membrane; C:oxygen evolving complex | SLPGITIDEKR-AEEDGVAcVEFIAGK-FPSVEVDLPAmmAQK-TPFTAGLGLEK |
| [show peptides] | 15-105 | 727 | 193 | 115.69606637955 | 38.04 | 11 | | | | EOX97859 | Fructose-bisphosphate aldolase 1 | none | C:thylakoid lumen; C:chloroplast envelope; P:response to abscisic acid stimulus; P:glycolysis; C:plastoglobule; F:fructose-bisphosphate aldolase activity; P:response to cadmium ion; C:cytosolic ribosome; C:membrane; C:apoplast | RVSLIGLGQSASTPTAFR-LTTASAIASGTVLGIHDDTR-AAQASNIGIVLASSEGLSAESK-VSLIGLGQSASTPTAFR-QLVNSPANVLTPAVLADEASK-FDmGGSAAVLGAAK-QLSGLLAEASSEEDFTGK-QGGAITAALFLK-GLGEAVAAAAK-YAEDVSSGIIFGR-GLTFDSGGYNIK |
| [show peptides] | 15-116 | 239 | 253 | 53.881411314011 | 34.88 | 1 | | | | XP_002312588 | plastid-lipid associated protein PAP | none | C:plastoglobule; P:defense response to bacterium; C:chloroplast envelope; C:thylakoid lumen; C:plasma membrane; P:chloroplast organization; P:response to ozone; C:nucleus; C:chloroplast thylakoid membrane; F:structural molecule activity | MQGGLGVGGGSGR |
| [show peptides] | 15-112 | 364 | 329 | 51.586292982101 | 41.22 | 1 | | | | XP_003532074 | PREDICTED: oxygen-evolving enhancer protein 2, chloroplastic-like | none | P:defense response to bacterium; C:chloroplast envelope; C:extrinsic to membrane; C:thylakoid lumen; F:poly(U) RNA binding; F:calcium ion binding; C:chloroplast stroma; C:apoplast; P:photosynthesis; C:chloroplast thylakoid membrane; C:oxygen evolving complex | TFQGPPHGIQVER |
| [show peptides] | 15-33 | 471 | 153 | 39.093282222748 | 12.96 | 3 | | | | EMJ23583 | hypothetical protein PRUPE_ppa006025mg | none | C:mitochondrion; P:response to salt stress; P:nitrogen fixation; C:chloroplast envelope; P:glutamine biosynthetic process; F:ATP binding; F:glutamate-ammonia ligase activity; C:chloroplast thylakoid membrane; C:chloroplast stroma; P:response to cadmium ion; C:cytosolic ribosome; C:apoplast | VPIIVTGNDFSTLYAPLIR-IGVcTGIFR-LVDcFPGQSIDFFGALR |
| [show peptides] | 15-110 | 483 | 417 | 31.096270799637 | 39.83 | 10 | | | | EOY28536 | Photosystem II subunit Q-2 | none | C:chloroplast thylakoid lumen; C:extrinsic to membrane; F:calcium ion binding; C:chloroplast stroma; C:apoplast; P:photosynthesis; C:chloroplast thylakoid membrane; C:oxygen evolving complex | RVSLIGLGQSASTPTAFR-LTTASAIASGTVLGIHDDTR-AAQASNIGIVLASSEGLSAESK-VSLIGLGQSASTPTAFR-SVDILGLGSGPEVDKK-YAEDVSSGIIFGR-FDmGGSAAVLGAAK-LTLADALVYAcNQGVEK-QLVNSPANVLTPAVLADEASK-QGGAITAALFLK |
| [show peptides] | 30-59 | 321 | 236 | 298.76988387108 | 63.75 | 2 | | | | ADZ75466 | oxygen evolving enhancer protein 1 | none | C:extrinsic to membrane; F:poly(U) RNA binding; F:oxygen evolving activity; F:calcium ion binding; P:defense response to bacterium; C:chloroplast thylakoid membrane; P:photoinhibition; C:plastoglobule; P:photosystem II assembly; P:regulation of protein dephosphorylation; P:photosystem II stabilization; C:oxygen evolving complex; C:chloroplast thylakoid lumen; C:apoplast | cINcDGAGSLTcTTcQGSGIQPR-DNTQPcFPcDGSGAQR |
| [show peptides] | 30-58 | 284 | 239 | 283.32000231743 | 70.09 | 3 | | | | ADZ75466 | oxygen evolving enhancer protein 1 | none | C:extrinsic to membrane; F:poly(U) RNA binding; F:oxygen evolving activity; F:calcium ion binding; P:defense response to bacterium; C:chloroplast thylakoid membrane; P:photoinhibition; C:plastoglobule; P:photosystem II assembly; P:regulation of protein dephosphorylation; P:photosystem II stabilization; C:oxygen evolving complex; C:chloroplast thylakoid lumen; C:apoplast | ENLGIGDEVLLLSDGNGDFTR-AIGcELDLSDKPIGLGVR-RYALLAEDGVVK |
| [show peptides] | 30-38 | 295 | 162 | 278.57462382317 | 69.82 | 1 | | | | XP_003632187 | PREDICTED: ribulose bisphosphate carboxylase/oxygenase activase 2, chloroplastic isoform 2 | none | F:ATP binding; C:chloroplast stroma | AINGGEcGGGNPGAVQAR |
| [show peptides] | 30-37 | 273 | 162 | 215.66200757027 | 56.45 | 3 | | | | XP_003632187 | PREDICTED: ribulose bisphosphate carboxylase/oxygenase activase 2, chloroplastic isoform 2 | none | F:ATP binding; C:chloroplast stroma | AITDFGSPENFLAEVNYLLGK-TADGDEGGKHQLITASIK-KFVESAASSFSVA |
| [show peptides] | 30-39 | 327 | 165 | 205.02739429474 | 57.37 | 3 | | | | XP_003632187 | PREDICTED: ribulose bisphosphate carboxylase/oxygenase activase 2, chloroplastic isoform 2 | none | F:ATP binding; C:chloroplast stroma | TADGDEGGKHQLITASIK-HQLITASIK-AITDFGSPENFLAEVNYLLGK |
| [show peptides] | 30-57 | 244 | 236 | 160.12693047524 | 53.78 | 1 | | | | ADZ75466 | oxygen evolving enhancer protein 1 | none | C:extrinsic to membrane; F:poly(U) RNA binding; F:oxygen evolving activity; F:calcium ion binding; P:defense response to bacterium; C:chloroplast thylakoid membrane; P:photoinhibition; C:plastoglobule; P:photosystem II assembly; P:regulation of protein dephosphorylation; P:photosystem II stabilization; C:oxygen evolving complex; C:chloroplast thylakoid lumen; C:apoplast | VSGVEISPSPVAR |
| [show peptides] | 30-14 | 364 | 116 | 154.98913621902 | 57.37 | 14 | | | | XP_004972100 | PREDICTED: uncharacterized protein LOC101763014 | none | C:chloroplast envelope; F:zinc ion binding; F:proton-transporting ATP synthase activity, rotational mechanism; P:ATP hydrolysis coupled proton transport; C:nucleolus; F:cobalt ion binding; C:mitochondrial respiratory chain complex I; C:mitochondrial proton-transporting ATP synthase, catalytic core; P:ATP synthesis coupled proton transport; P:response to cadmium ion; P:ATP catabolic process; C:plasma membrane; F:copper ion binding; F:poly(U) RNA binding; F:ATP binding; P:response to oxidative str | "mGINPImmSAGELESGNAGEPAKLIR-MGINPImmSAGELESGNAGEPAK-VPIIVTGNDFSTLYAPLIR-mGINPImmSAGELESGNAGEPAK-VQLADKYLAEAALGDANQDAVDQGTFYG-LIEYGNmLVQEQENVK-LIEYGNMLVQEQENVKR-GLAYDTSDDQQDITR-MGINPIMMSAGELESGNAGEPAK-mccLFINDLDAGAGR-MGINPIMmSAGELESGNAGEPAK-GKmccLFINDLDAGAGR-LIEYGNmLVQEQENVKR-WISGVGVDTIGKK " |
| [show peptides] | 30-8 | 312 | 108 | 139.24020934105 | 45.86 | 1 | | | | XP_004972100 | PREDICTED: uncharacterized protein LOC101763014 | none | C:chloroplast envelope; F:zinc ion binding; F:proton-transporting ATP synthase activity, rotational mechanism; P:ATP hydrolysis coupled proton transport; C:nucleolus; F:cobalt ion binding; C:mitochondrial respiratory chain complex I; C:mitochondrial proton-transporting ATP synthase, catalytic core; P:ATP synthesis coupled proton transport; P:response to cadmium ion; P:ATP catabolic process; C:plasma membrane; F:copper ion binding; F:poly(U) RNA binding; F:ATP binding; P:response to oxidative str | IATESSLAAR |
| [show peptides] | 30-83 | 327 | 400 | 137.35033869743 | 45.62 | 4 | | | | BAF80585 | Cu-Zn superoxide disumtase | none | P:toxin catabolic process; F:metal ion binding; P:response to copper ion; P:response to oxidative stress; F:superoxide dismutase activity; C:chloroplast stroma; P:superoxide metabolic process; P:response to iron ion; C:thylakoid; C:apoplast; P:response to light stimulus; P:oxidation-reduction process | HAGDLGNIVANADGVAEATIVDTQIPLSGPNAVVGR-ALVVHELEDDLGKGGHELSLTTGNAGGR-GTSSVEGVVTLSQEGDGPTTVNVR-GGHELSLTTGNAGGR |
| [show peptides] | 30-30 | 369 | 151 | 127.58072113991 | 61.98 | 4 | | | | EOY14103 | Phosphoglycerate kinase 1 | none | P:photosynthesis, light reaction; P:pentose-phosphate shunt; P:response to glucose stimulus; C:chloroplast envelope; P:hydrogen peroxide catabolic process; C:apoplast; P:response to sucrose stimulus; C:stromule; P:salicylic acid biosynthetic process; C:membrane; P:starch biosynthetic process; P:cellular cation homeostasis; P:isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway; P:maltose metabolic process; P:phosphorylation; P:defense response to bacterium; C:cell wall; C | LATWIEEmNKNEAYTQTR-ETLPPALTSTSDPPPVFDGTTR-VPALEHNNEVR-LYISYTcPFAQR |
| [show peptides] | 30-15 | 381 | 116 | 103.73843765259 | 45.5 | 19 | | | | XP_004972100 | PREDICTED: uncharacterized protein LOC101763014 | none | C:chloroplast envelope; F:zinc ion binding; F:proton-transporting ATP synthase activity, rotational mechanism; P:ATP hydrolysis coupled proton transport; C:nucleolus; F:cobalt ion binding; C:mitochondrial respiratory chain complex I; C:mitochondrial proton-transporting ATP synthase, catalytic core; P:ATP synthesis coupled proton transport; P:response to cadmium ion; P:ATP catabolic process; C:plasma membrane; F:copper ion binding; F:poly(U) RNA binding; F:ATP binding; P:response to oxidative str | EENPRVPIIVTGNDFSTLYAPLIR-mGINPImmSAGELESGNAGEPAKLIR-mGINPImMSAGELESGNAGEPAK-MGINPImMSAGELESGNAGEPAK-VPIIVTGNDFSTLYAPLIR-mGINPImmSAGELESGNAGEPAK-LIEYGNMLVQEQENVKR-GKmccLFINDLDAGAGR-LVDcFPGQSIDFFGALR-GLAYDTSDDQQDITR-KWISGVGVDTIGK-WISGVGVDTIGKK-mccLFINDLDAGAGR-MGINPIMMSAGELESGNAGEPAK-LIEYGNmLVQEQENVKR-LIEYGNMLVQEQENVK-QYmDNNmDGFYIAPAFMDK-VPLILGVWGGK-VQLADKYLAEAALGDANQDAVDQGTFYG |
| [show peptides] | 30-63 | 275 | 275 | 98.798755645752 | 43.13 | 1 | | | | XP_003532074 | PREDICTED: oxygen-evolving enhancer protein 2, chloroplastic-like | none | P:defense response to bacterium; C:chloroplast envelope; C:extrinsic to membrane; C:thylakoid lumen; F:poly(U) RNA binding; F:calcium ion binding; C:chloroplast stroma; C:apoplast; P:photosynthesis; C:chloroplast thylakoid membrane; C:oxygen evolving complex | AAVTTAFVNQFPGLNGLGISLAR |
| [show peptides] | 30-6 | 278 | 105 | 91.452597856522 | 37.77 | 1 | | | | XP_004972100 | PREDICTED: uncharacterized protein LOC101763014 | none | C:chloroplast envelope; F:zinc ion binding; F:proton-transporting ATP synthase activity, rotational mechanism; P:ATP hydrolysis coupled proton transport; C:nucleolus; F:cobalt ion binding; C:mitochondrial respiratory chain complex I; C:mitochondrial proton-transporting ATP synthase, catalytic core; P:ATP synthesis coupled proton transport; P:response to cadmium ion; P:ATP catabolic process; C:plasma membrane; F:copper ion binding; F:poly(U) RNA binding; F:ATP binding; P:response to oxidative str | TFQGPPHGIQVER |
| [show peptides] | 30-17 | 435 | 114 | 73.881727457046 | 30.9 | 3 | | | | EMJ05405 | hypothetical protein PRUPE_ppa003434mg | none | P:leaf senescence; C:vacuole; F:manganese ion binding; F:metalloexopeptidase activity; F:aminopeptidase activity; C:chloroplast stroma; P:proteolysis; C:cytosol | AISGQPPLKLPIPGER-AGPEAEAEASSYSK-ALVDTVYGTDFGFR |
| [show peptides] | 30-16 | 406 | 114 | 69.517779588699 | 34.9 | 18 | | | | EMJ05405 | hypothetical protein PRUPE_ppa003434mg | none | P:leaf senescence; C:vacuole; F:manganese ion binding; F:metalloexopeptidase activity; F:aminopeptidase activity; C:chloroplast stroma; P:proteolysis; C:cytosol | GKGmVDSLFQAPmGTGTHYAVLSSYEYLSTGLR-mGINPImmSAGELESGNAGEPAKLIR-GmVDSLFQAPmGTGTHYAVLSSYEYLSTGLR-VQLADKYLAEAALGDANQDAVDQGTFYG-LIEYGNMLVQEQENVKR-mGINPImmSAGELESGNAGEPAK-MGINPImmSAGELESGNAGEPAK-MGINPIMmSAGELESGNAGEPAK-YLAEAALGDANQDAVDQGTFYG-MGINPIMMSAGELESGNAGEPAK-LVDcFPGQSIDFFGALR-LIEYGNmLVQEQENVKR-mccLFINDLDAGAGR-LIEYGNmLVQEQENVK-GLAYDTSDDQQDITR-VPLILGVWGGK-IGVcTGIFR-WISGVGVDTIGKK |
| [show peptides] | 30-67 | 321 | 273 | 58.021192312241 | 39.24 | 3 | | | | XP_002281575 | PREDICTED: protein IN2-1 homolog B-like | none | P:toxin catabolic process; F:glutathione transferase activity; P:response to cyclopentenone; C:chloroplast stroma; P:protein glutathionylation | GITINTATVEYETENR-KYDEIDAAPEER-VGETLDLVGLR |
| [show peptides] | 30-9 | 329 | 108 | 52.743910551071 | 34.53 | 3 | | | | XP_004972100 | PREDICTED: uncharacterized protein LOC101763014 | none | C:chloroplast envelope; F:zinc ion binding; F:proton-transporting ATP synthase activity, rotational mechanism; P:ATP hydrolysis coupled proton transport; C:nucleolus; F:cobalt ion binding; C:mitochondrial respiratory chain complex I; C:mitochondrial proton-transporting ATP synthase, catalytic core; P:ATP synthesis coupled proton transport; P:response to cadmium ion; P:ATP catabolic process; C:plasma membrane; F:copper ion binding; F:poly(U) RNA binding; F:ATP binding; P:response to oxidative str | LIEYGNmLVQEQENVKR-EENPRVPIIVTGNDFSTLYAPLIR-IGVcTGIFR |
| [show peptides] | 30-46 | 51 | 173 | 43.698003292084 | 23.06 | 4 | | | | XP_006432747 | hypothetical protein CICLE_v10002003mg | none | C:plastoglobule; F:2-alkenal reductase [NAD(P)] activity; C:chloroplast thylakoid membrane; P:oxidation-reduction process; F:structural molecule activity | GLFIIDKEGVIQHSTINNLAIGR-EGVIQHSTINNLAIGR-SGGLGDLKYPLISDVTK-SYDVLIPDQGIALR |
| [show peptides] | 30-92 | 128 | 423 | 41.576560497284 | 36.17 | 3 | | | | EOY08108 | Thioredoxin superfamily protein | none | P:defense response to bacterium; C:chloroplast envelope; C:plant-type cell wall; F:peroxidase activity; F:peroxiredoxin activity; C:chloroplast stroma; C:thylakoid; P:oxidation-reduction process | ENLGIGDEVLLLSDGNGDFTR-AIGcELDLSDKPIGLGVR-RYALLAEDGVVK |
| [show peptides] | 30-82 | 275 | 423 | 40.32767367363 | 48.94 | 4 | | | | EOY08108 | Thioredoxin superfamily protein | none | P:defense response to bacterium; C:chloroplast envelope; C:plant-type cell wall; F:peroxidase activity; F:peroxiredoxin activity; C:chloroplast stroma; C:thylakoid; P:oxidation-reduction process | AIGcELDLSDKPIGLGVR-ENLGIGDEVLLLSDGNGDFTR-RYALLAEDGVVK-SILFAVPGAFTPTcSQK |
| [show peptides] | 30-20 | 497 | 119 | 40.164813041687 | 36.09 | 2 | | | | XP_002519286 | dihydrolipoamide dehydrogenase, putative | none | F:copper ion binding; P:hydrogen peroxide catabolic process; P:oxidation-reduction process; F:zinc ion binding; C:mitochondrial respiratory chain complex I; F:cobalt ion binding; P:response to light stimulus; P:cell redox homeostasis; F:electron carrier activity; F:ATP binding; F:flavin adenine dinucleotide binding; C:mitochondrial matrix; F:dihydrolipoyl dehydrogenase activity; C:chloroplast; P:response to cadmium ion; C:Golgi apparatus; C:apoplast | VAAAAAAADAEELTIEER-LIPAAASGDSK |
| [show peptides] | 30-74 | 224 | 312 | 31.553835630417 | 21.01 | 4 | | | | XP_002530152 | peroxiredoxins, prx-1, prx-2, prx-3, putative | none | P:defense response to bacterium; C:chloroplast envelope; P:response to cold; C:stromule; F:peroxidase activity; F:peroxiredoxin activity; C:chloroplast stroma; C:thylakoid; C:apoplast; P:oxidation-reduction process | GLFIIDKEGVIQHSTINNLAIGR-EGVIQHSTINNLAIGR-SGGLGDLKYPLISDVTK-SYDVLIPDQGIALR |
| [show peptides] | 30-1 | 327 | 71 | 30.795723676682 | 15.37 | 1 | | | | XP_002284008 | PREDICTED: heat shock cognate 70 kDa protein isoform 1 | none | F:2-alkenal reductase [NAD(P)] activity; F:ATP binding; P:response to stress; P:oxidation-reduction process | TFQGPPHGIQVER |
| [show peptides] | 30-80 | 258 | 381 | 29.402103662491 | 46.81 | 3 | | | | EOY08108 | Thioredoxin superfamily protein | none | P:defense response to bacterium; C:chloroplast envelope; C:plant-type cell wall; F:peroxidase activity; F:peroxiredoxin activity; C:chloroplast stroma; C:thylakoid; P:oxidation-reduction process | AIGcELDLSDKPIGLGVR-RYALLAEDGVVK-SILFAVPGAFTPTcSQK |
| [show peptides] | 30-111 | 878 | 471 | 28.473926067352 | 18.23 | 2 | | | | BAI53118 | ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit | none | P:reductive pentose-phosphate cycle; F:ribulose-bisphosphate carboxylase activity; F:monooxygenase activity; P:photorespiration; C:chloroplast; P:oxidation-reduction process | GFVYREHHHSPGYYDGR-KFETLSYLPPLTPTQLAK |
| [show peptides] | 30-0 | 244 | 65 | 25.853126764297 | 12.4 | 3 | | | | XP_002279101 | PREDICTED: stromal 70 kDa heat shock-related protein, chloroplastic-like | none | P:oxidation-reduction process; C:mitochondrion; P:protein folding; P:response to cold; C:chloroplast envelope; P:response to heat; C:thylakoid; F:ATP binding; C:chloroplast stroma; F:2-alkenal reductase [NAD(P)] activity; F:unfolded protein binding; P:protein targeting to chloroplast; P:response to cadmium ion; C:nucleus; C:apoplast | AAALNIVPTSTGAAK-KGLTAEDVNAAFR-GLTAEDVNAAFR |
| [show peptides] | 30-61 | 193 | 270 | 21.023201704025 | 19.71 | 1 | | | | ADK93079 | 14-3-3f protein | none | C:cytosol; P:defense response to bacterium; C:plant-type cell wall; F:protein domain specific binding; P:brassinosteroid mediated signaling pathway; C:chloroplast; P:response to cadmium ion; C:nucleus; C:plasma membrane | EYWTDALEKVSLMENDIR |
| [show peptides] | 30-50 | 9 | 352 | 16.004689455032 | 24.18 | 3 | | | | XP_002273249 | PREDICTED: zeaxanthin epoxidase, chloroplastic | none | P:stomatal complex morphogenesis; P:pentose-phosphate shunt; P:positive regulation of catalytic activity; P:starch biosynthetic process; P:photosystem II assembly; P:maltose metabolic process; C:chloroplast stroma; P:plastid organization; C:chloroplast thylakoid membrane; P:rRNA processing | AIGcELDLSDKPIGLGVR-RYALLAEDGVVK-SILFAVPGAFTPTcSQK |
| [show peptides] | 30-71 | 295 | 295 | 15.850888967514 | 20.99 | 2 | | | | XP_003532074 | PREDICTED: oxygen-evolving enhancer protein 2, chloroplastic-like | none | P:defense response to bacterium; C:chloroplast envelope; C:extrinsic to membrane; C:thylakoid lumen; F:poly(U) RNA binding; F:calcium ion binding; C:chloroplast stroma; C:apoplast; P:photosynthesis; C:chloroplast thylakoid membrane; C:oxygen evolving complex | GFVYREHHHSPGYYDGR-KFETLSYLPPLTPTQLAK |
| [show peptides] | 30-13 | 346 | 116 | 14.666450023651 | 10.37 | 10 | | | | XP_003632187 | PREDICTED: ribulose bisphosphate carboxylase/oxygenase activase 2, chloroplastic isoform 2 | none | F:ATP binding; C:chloroplast stroma | |
| [show peptides] | 30-55 | 170 | 233 | 13.317028045654 | 11.75 | 4 | | | | NP_001267852 | 14-3-3 protein | none | C:vacuole; F:protein domain specific binding; P:response to cadmium ion; C:plasma membrane; C:chloroplast; C:nucleus; C:cytosol; C:apoplast; P:brassinosteroid mediated signaling pathway | AIGcELDLSDKPIGLGVR-ENLGIGDEVLLLSDGNGDFTR-RYALLAEDGVVK-SILFAVPGAFTPTcSQK |
| [show peptides] | 30-26 | 244 | 136 | 12.635429143906 | 11.52 | 6 | | | | XP_003632187 | PREDICTED: ribulose bisphosphate carboxylase/oxygenase activase 2, chloroplastic isoform 2 | none | F:ATP binding; C:chloroplast stroma | TDSEGGFESDAVATANILESSTPEIGGK-TDSEGGFESDAVATANILESSTPEIGGKK-TADGDEGGKHQLITASIK-KYYFVSVLTR-HQLITASIKDGK-YEDNFDTTSNVSVMVTPTDK |
| [show peptides] | 30-56 | 199 | 233 | 11.71434879303 | 15.59 | 4 | | | | XP_006472571 | PREDICTED: 14-3-3-like protein-like | none | C:vacuole; F:protein domain specific binding; P:response to cadmium ion; C:plasma membrane; C:chloroplast; C:nucleus; C:cytosol; C:apoplast; P:brassinosteroid mediated signaling pathway | HAGDLGNIVANADGVAEATIVDTQIPLSGPNAVVGR-ALVVHELEDDLGKGGHELSLTTGNAGGR-GTSSVEGVVTLSQEGDGPTTVNVR-GGHELSLTTGNAGGR |
| [show peptides] | 30-21 | 537 | 116 | 11.517734050751 | 9.91 | 3 | | | | EMJ12384 | hypothetical protein PRUPE_ppa005598mg | none | P:regulation of proton transport; P:pentose-phosphate shunt; P:response to glucose stimulus; P:response to far red light; C:chloroplast envelope; P:hydrogen peroxide catabolic process; C:apoplast; P:response to sucrose stimulus; F:NAD binding; C:stromule; P:unsaturated fatty acid biosynthetic process; P:response to red light; P:photosystem II assembly; P:isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway; F:NADP binding; P:chloroplast relocation; P:defense response to b | IISSIEQKEESR-KEAAESTLTAYK-AAQDIANSELAPTHPIR |
| [show peptides] | 30-73 | 187 | 310 | 10.6863925457 | 14.89 | 3 | | | | XP_003532074 | PREDICTED: oxygen-evolving enhancer protein 2, chloroplastic-like | none | P:defense response to bacterium; C:chloroplast envelope; C:extrinsic to membrane; C:thylakoid lumen; F:poly(U) RNA binding; F:calcium ion binding; C:chloroplast stroma; C:apoplast; P:photosynthesis; C:chloroplast thylakoid membrane; C:oxygen evolving complex | TADGDEGGKHQLITASIK-HQLITASIK-AITDFGSPENFLAEVNYLLGK |
| [show peptides] | 30-102 | 636 | 329 | 9.4136168956757 | 8.09 | 3 | | | | XP_003525588 | PREDICTED: elongation factor Tu, chloroplastic-like | none | C:chloroplast envelope; C:apoplast; C:nucleoid; F:translation elongation factor activity; P:translational elongation; F:GTP binding; P:GTP catabolic process; C:nucleolus; C:chloroplast stroma; F:GTPase activity; C:chloroplast thylakoid membrane | GITINTATVEYETENR-KYDEIDAAPEER-VGETLDLVGLR |
| [show peptides] | 30-76 | 346 | 298 | 8.5318531990051 | 11.92 | 1 | | | | ABV03161 | germin-like protein | none | F:nutrient reservoir activity; P:photosynthesis, light reaction; P:stomatal complex morphogenesis; F:manganese ion binding; P:defense response to bacterium; F:oxalate oxidase activity; P:response to cold; C:plant-type cell wall; P:cellular cation homeostasis; C:extracellular matrix; P:divalent metal ion transport; C:nucleus; C:apoplast | AAVTTAFVNQFPGLNGLGISLAR |
| [show peptides] | 30-49 | 26 | 207 | 7.8223905563355 | 17.61 | 1 | | | | #N/A | #N/A | none | #N/A | AAVTTAFVNQFPGLNGLGISLAR |
| [show peptides] | 30-23 | 625 | 116 | 7.7538905143738 | 7.65 | 10 | | | | AFA27695 | ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit, partial | none | P:reductive pentose-phosphate cycle; F:ribulose-bisphosphate carboxylase activity; F:monooxygenase activity; P:photorespiration; F:magnesium ion binding; C:chloroplast; P:oxidation-reduction process | "FEEKDGIDYAAVTVQLPGGER-QLVASGKPESFSGEFLVPSYR-GGSTGYDNAVALPAGGRGDEEDLTK-GRGGSTGYDNAVALPAGGR-TKPETGEVIGVFESVQPSDTDLGAK-LTYTLDEIEGPFEVSPDGTVKFEEK-DGIDYAAVTVQLPGGER-GGSTGYDNAVALPAGGR-IcLEPTSFTVKAESVSK-LTYTLDEIEGPFEVSPDGTVK " |
| [show peptides] | 30-22 | 565 | 116 | 6.0853426456451 | 7.65 | 8 | | | | AFA27695 | ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit, partial | none | P:reductive pentose-phosphate cycle; F:ribulose-bisphosphate carboxylase activity; F:monooxygenase activity; P:photorespiration; F:magnesium ion binding; C:chloroplast; P:oxidation-reduction process | FEEKDGIDYAAVTVQLPGGER-QLVASGKPESFSGEFLVPSYR-TKPETGEVIGVFESVQPSDTDLGAK-GTGTANQcPTIDGGLDSFAFKPGK-GRGGSTGYDNAVALPAGGR-DGIDYAAVTVQLPGGER-GGSTGYDNAVALPAGGRGDEEDLTK-KIcLEPTSFTVK |
| [show peptides] | 30-93 | 91 | 480 | 5.877660036087 | 34.21 | 2 | | | | XP_004499244 | PREDICTED: protein disulfide-isomerase LQY1-like | none | F:protein disulfide isomerase activity; F:heat shock protein binding; P:protein folding; P:pentose-phosphate shunt; P:rRNA processing; C:chloroplast thylakoid membrane; P:plastid organization; C:chloroplast stroma; P:photosystem II assembly; P:photosystem II repair; F:unfolded protein binding; P:regulation of protein dephosphorylation | cINcDGAGSLTcTTcQGSGIQPR-DNTQPcFPcDGSGAQR |
| [show peptides] | 30-24 | 648 | 116 | 5.4910471439362 | 4.02 | 11 | | | | AAK07827 | AF297643_1mitochondrial processing peptidase beta subunit | none | C:vacuolar membrane; P:response to misfolded protein; P:pentose-phosphate shunt; P:photorespiration; F:zinc ion binding; C:mitochondrial intermembrane space; C:mitochondrial matrix; P:response to salt stress; P:proteasome core complex assembly; C:chloroplast; C:cell wall; C:nucleolus; P:ubiquitin-dependent protein catabolic process; C:mitochondrial outer membrane; F:metalloendopeptidase activity; P:response to cadmium ion; C:mitochondrial respiratory chain complex III; C:plasma membrane | FEEKDGIDYAAVTVQLPGGER-GRGGSTGYDNAVALPAGGR-LTYTLDEIEGPFEVSPDGTVKFEEK-QLVASGKPESFSGEFLVPSYR-TKPETGEVIGVFESVQPSDTDLGAK-GTGTANQcPTIDGGLDSFAFKPGK-DGIDYAAVTVQLPGGER-LTYTLDEIEGPFEVSPDGTVK-GGSTGYDNAVALPAGGRGDEEDLTK-GGSTGYDNAVALPAGGR-RLTYDEIQSK |
| [show peptides] | 30-100 | 477 | 329 | 4.9276633262634 | 11.92 | 1 | | | | ABV03161 | germin-like protein | none | F:nutrient reservoir activity; P:photosynthesis, light reaction; P:stomatal complex morphogenesis; F:manganese ion binding; P:defense response to bacterium; F:oxalate oxidase activity; P:response to cold; C:plant-type cell wall; P:cellular cation homeostasis; C:extracellular matrix; P:divalent metal ion transport; C:nucleus; C:apoplast | AAVTTAFVNQFPGLNGLGISLAR |
| [show peptides] | 30-72 | 162 | 310 | 4.601667881012 | 6.41 | 1 | | | | XP_002274620 | PREDICTED: endochitinase PR4 | none | F:chitinase activity; P:carbohydrate metabolic process; P:chitin catabolic process; F:chitin binding; P:cell wall macromolecule catabolic process | AGPEAEAEASSYSK |
| [show peptides] | 30-88 | 139 | 483 | 3.6383762359619 | 8.61 | 1 | | | | XP_002524079 | Phosphatidylglycerol/phosphatidylinositol transfer protein precursor, putative | none | P:response to nitrate; C:extracellular region; C:vacuole; P:nitrate transport | VSGVEISPSPVAR |
| [show peptides] | 30-25 | 670 | 116 | 3.120208978653 | 1.92 | 3 | | | | AAK07827 | AF297643_1mitochondrial processing peptidase beta subunit | none | C:vacuolar membrane; P:response to misfolded protein; P:pentose-phosphate shunt; P:photorespiration; F:zinc ion binding; C:mitochondrial intermembrane space; C:mitochondrial matrix; P:response to salt stress; P:proteasome core complex assembly; C:chloroplast; C:cell wall; C:nucleolus; P:ubiquitin-dependent protein catabolic process; C:mitochondrial outer membrane; F:metalloendopeptidase activity; P:response to cadmium ion; C:mitochondrial respiratory chain complex III; C:plasma membrane | AAQDIAQADLASTHPIR-KAAAEDTmLAYK-IVSSIEQKEEGR |
| [show peptides] | 30-19 | 469 | 116 | 2.8726785182953 | 1.59 | 3 | | | | XP_002283273 | PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial | none | F:zinc ion binding; C:integral to membrane; F:metalloendopeptidase activity; P:protein catabolic process; P:proteolysis; F:ATPase activity; C:chloroplast thylakoid membrane; P:ATP catabolic process; F:ATP binding; C:mitochondrion | WLLQPVGDGDTR-VDmPGAFEIASNLVTVGR-EGSLLVTDLDSTNGTFIDDR |
| [show peptides] | 30-18 | 454 | 114 | 2.6531245708466 | 7.65 | 2 | | | | AFA27695 | ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit, partial | none | P:reductive pentose-phosphate cycle; F:ribulose-bisphosphate carboxylase activity; F:monooxygenase activity; P:photorespiration; F:magnesium ion binding; C:chloroplast; P:oxidation-reduction process | VAPEPEENKEEAEEANTK-TVHQEEVAVVAPK |
| [show peptides] | 30-95 | 469 | 222 | 2.631275177002 | 2.27 | 1 | | | | XP_006389285 | hypothetical protein POPTR_0031s004402g, partial | none | P:defense response; F:ADP binding; F:ATP binding; F:nucleotide binding; F:nucleoside-triphosphatase activity; F:DNA binding | EYWTDALEKVSLMENDIR |
| [show peptides] | 30-7 | 293 | 108 | 2.6101031303406 | 3.33 | 1 | | | | XP_002283310 | PREDICTED: mitochondrial-processing peptidase subunit alpha | none | F:metal ion binding; C:mitochondrial inner membrane; F:ubiquinol-cytochrome-c reductase activity; F:metalloendopeptidase activity; C:respiratory chain; P:proteolysis; P:electron transport chain | IATESSLAAR |
| [show peptides] | 30-121 | 54 | 202 | 2.2997827529907 | 3.89 | 1 | | | | XP_004972101 | hypothetical protein CICLE_v10002003mg | none | C:plastoglobule; F:2-alkenal reductase [NAD(P)] activity; C:chloroplast thylakoid membrane; P:oxidation-reduction process; F:structural molecule activity | AGPEAEAEASSYSK |