Gelmap. Spot visualization by LUH

Peptidelist

IDFDRAccessionNameRank Pep_isbold Pep_isuniquePep_exp_mzPep_exp_mrPep_exp_zPep_calc_mrPep_deltaPep_missPep_scorePep_seqPep_var_modPep_var_mod_posTypePep_scan_title
1<0.01AT2G15620.1NIR1, NIR, ATHNIR, nitrite reductase 1 111839.4508838.44351838.4589-0.0154015.11DGFFILKCID Cmpd 294, +MSn(839.4508), 20.9 min
1<0.01AT2G15620.1NIR1, NIR, ATHNIR, nitrite reductase 1 111411.2207820.42682820.4443-0.0175057.82AVLEAYRCID Cmpd 82, +MSn(411.2207), 13.3 min
1<0.01AT2G15620.1NIR1, NIR, ATHNIR, nitrite reductase 1 111431.2113860.40812860.4239-0.0159054.21VTEEVERCID Cmpd 2, +MSn(431.2113), 9.1 min
1<0.01AT2G15620.1NIR1, NIR, ATHNIR, nitrite reductase 1 111474.7240947.43342947.4560-0.0225043.13GSSEDLVNKCID Cmpd 10, +MSn(474.7240), 10.1 min
1<0.01AT2G15620.1NIR1, NIR, ATHNIR, nitrite reductase 1 111517.74771033.480821033.5040-0.0232136.81SSKDDIDVRCID Cmpd 7, +MSn(517.7477), 9.6 min
1<0.01AT2G15620.1NIR1, NIR, ATHNIR, nitrite reductase 1 111534.22321066.431721066.4488-0.0171059.38SMEELDSEKCID Cmpd 47, +MSn(534.2231), 12.1 min
1<0.01AT2G15620.1NIR1, NIR, ATHNIR, nitrite reductase 1 111534.25201066.489421066.5084-0.0190037.91DYFGVNPQKCID Cmpd 149, +MSn(534.2520), 15.4 min
1<0.01AT2G15620.1NIR1, NIR, ATHNIR, nitrite reductase 1 111574.79511147.575721147.5947-0.0190035.65FSPEPSILMKCID Cmpd 226, +MSn(574.7951), 18.1 min
1<0.01AT2G15620.1NIR1, NIR, ATHNIR, nitrite reductase 1 111591.28391180.553221180.5724-0.0192088.58LADTYGSGELRCID Cmpd 95, +MSn(591.2839), 13.7 min
1<0.01AT2G15620.1NIR1, NIR, ATHNIR, nitrite reductase 1 111622.82141243.628221243.6521-0.0239059.24LPNGVTTSAQTRCID Cmpd 43, +MSn(622.8214), 12.0 min
1<0.01AT2G15620.1NIR1, NIR, ATHNIR, nitrite reductase 1 111638.78401275.553521275.5765-0.0230082.33LQADDMDELARCID Cmpd 155, +MSn(638.7840), 15.6 min
1<0.01AT2G15620.1NIR1, NIR, ATHNIR, nitrite reductase 1 111639.87511277.735621277.7595-0.0239057.99GVVLPDVPEILKCID Cmpd 300, +MSn(639.8751), 21.3 min
1<0.01AT2G15620.1NIR1, NIR, ATHNIR, nitrite reductase 1 111644.85121287.687921287.7074-0.0195076.13TEALLQEPFLKCID Cmpd 267, +MSn(644.8513), 19.7 min
1<0.01AT2G15620.1NIR1, NIR, ATHNIR, nitrite reductase 1 111672.27021342.525821342.5460-0.0202091.53YGEDGCADVTTRCID Cmpd 30, +MSn(672.2701), 11.5 min
1<0.01AT2G15620.1NIR1, NIR, ATHNIR, nitrite reductase 1 111697.34551392.676521392.6959-0.0194056.12LFMENGIEELAKCID Cmpd 273, +MSn(697.3455), 19.9 min
1<0.01AT2G15620.1NIR1, NIR, ATHNIR, nitrite reductase 1 111864.39771726.780821726.8059-0.0250018.95MMWLIDELGVEGFR2 Oxidation (M)0.22000000000000.0CID Cmpd 320, +MSn(864.3977), 23.1 min
1<0.01AT2G15620.1NIR1, NIR, ATHNIR, nitrite reductase 1 111899.48591796.957321796.9884-0.0311053.80LTVEQNIIIPNVETSKCID Cmpd 241, +MSn(899.4859), 18.9 min
1<0.01AT2G15620.1NIR1, NIR, ATHNIR, nitrite reductase 1 111902.95201803.889421803.9149-0.0255044.20GLASVGLTSLQSGMDNVRCID Cmpd 269, +MSn(902.9520), 19.8 min
1<0.01AT2G15620.1NIR1, NIR, ATHNIR, nitrite reductase 1 111436.91631307.727031307.7489-0.0219143.76VELKDGFFILKCID Cmpd 276, +MSn(436.9163), 20.0 min
1<0.01AT2G15620.1NIR1, NIR, ATHNIR, nitrite reductase 1 111440.21641317.627331317.6565-0.0292043.00IGSDSHIGEIYKCID Cmpd 91, +MSn(440.2164), 13.6 min
1<0.01AT2G15620.1NIR1, NIR, ATHNIR, nitrite reductase 1 111455.24061362.700131362.7255-0.0255131.23AVLEAYRDLGTRCID Cmpd 147, +MSn(455.2406), 15.4 min
1<0.01AT2G15620.1NIR1, NIR, ATHNIR, nitrite reductase 1 111482.91531445.724231445.7514-0.0272137.02IGSDSHIGEIYKKCID Cmpd 54, +MSn(482.9153), 12.4 min
1<0.01AT2G15620.1NIR1, NIR, ATHNIR, nitrite reductase 1 111491.21321470.617931470.6409-0.0230133.89KYGEDGCADVTTRCID Cmpd 16, +MSn(491.2133), 10.5 min
1<0.01AT2G15620.1NIR1, NIR, ATHNIR, nitrite reductase 1 111496.27081485.790731484.83110.9596141.12LKLPNGVTTSAQTRCID Cmpd 106, +MSn(496.2708), 14.1 min
1<0.01AT2G15620.1NIR1, NIR, ATHNIR, nitrite reductase 1 111532.28571593.835331593.8627-0.0275062.55QEGLSFVGLHVPVGRCID Cmpd 256, +MSn(532.2857), 19.4 min
1<0.01AT2G15620.1NIR1, NIR, ATHNIR, nitrite reductase 1 111573.60731717.800031717.8271-0.0272087.41GEEGKPVEGADVYVGGRCID Cmpd 78, +MSn(573.6072), 13.2 min
1<0.01AT2G15620.1NIR1, NIR, ATHNIR, nitrite reductase 1 111680.65692038.948832038.9816-0.0328053.63GLVACTGSQFCGQAIIETKCID Cmpd 223, +MSn(680.6569), 17.9 min
1<0.01AT2G15620.1NIR1, NIR, ATHNIR, nitrite reductase 1 111767.66593066.634543066.6852-0.0507119.86LTVEQNIIIPNVETSKTEALLQEPFLKCID Cmpd 312, +MSn(767.6659), 22.3 min
2<0.01AT2G15620.1NIR1, NIR, ATHNIR, nitrite reductase 1 111411.2196820.42462820.4443-0.0196035.37AVLEAYRCID Cmpd 48, +MSn(411.2196), 13.2 min
2<0.01AT2G15620.1NIR1, NIR, ATHNIR, nitrite reductase 1 111534.25351066.492521066.5084-0.0159038.69DYFGVNPQKCID Cmpd 116, +MSn(534.2535), 15.4 min
2<0.01AT2G15620.1NIR1, NIR, ATHNIR, nitrite reductase 1 111574.79731147.580121147.5947-0.0146025.73FSPEPSILMKCID Cmpd 187, +MSn(574.7973), 17.9 min
2<0.01AT2G15620.1NIR1, NIR, ATHNIR, nitrite reductase 1 111591.28411180.553721180.5724-0.0187065.24LADTYGSGELRCID Cmpd 66, +MSn(591.2841), 13.8 min
2<0.01AT2G15620.1NIR1, NIR, ATHNIR, nitrite reductase 1 111623.32051244.626521243.65210.9744034.44LPNGVTTSAQTRCID Cmpd 16, +MSn(623.3206), 11.8 min
2<0.01AT2G15620.1NIR1, NIR, ATHNIR, nitrite reductase 1 111638.78601275.557421275.5765-0.0190081.36LQADDMDELARCID Cmpd 121, +MSn(638.7860), 15.6 min
2<0.01AT2G15620.1NIR1, NIR, ATHNIR, nitrite reductase 1 111639.87731277.740021277.7595-0.0194037.44GVVLPDVPEILKCID Cmpd 218, +MSn(639.8773), 21.4 min
2<0.01AT2G15620.1NIR1, NIR, ATHNIR, nitrite reductase 1 111644.85191287.689121287.7074-0.0183057.24TEALLQEPFLKCID Cmpd 206, +MSn(644.8519), 19.7 min
2<0.01AT2G15620.1NIR1, NIR, ATHNIR, nitrite reductase 1 111654.87001307.725521307.7489-0.0234119.74VELKDGFFILKCID Cmpd 214, +MSn(654.8701), 20.0 min
2<0.01AT2G15620.1NIR1, NIR, ATHNIR, nitrite reductase 1 111910.94791819.881321819.9098-0.0285025.80GLASVGLTSLQSGMDNVROxidation (M)0.000000000000020000.0CID Cmpd 184, +MSn(910.9479), 17.8 min
2<0.01AT2G15620.1NIR1, NIR, ATHNIR, nitrite reductase 1 111440.21811317.632331317.6565-0.0241041.81IGSDSHIGEIYKCID Cmpd 58, +MSn(440.2180), 13.6 min
2<0.01AT2G15620.1NIR1, NIR, ATHNIR, nitrite reductase 1 111455.24251362.705831362.7255-0.0198122.56AVLEAYRDLGTRCID Cmpd 115, +MSn(455.2425), 15.3 min
2<0.01AT2G15620.1NIR1, NIR, ATHNIR, nitrite reductase 1 111482.91461445.721931445.7514-0.0295141.57IGSDSHIGEIYKKCID Cmpd 21, +MSn(482.9146), 12.2 min
2<0.01AT2G15620.1NIR1, NIR, ATHNIR, nitrite reductase 1 111532.28581593.835631593.8627-0.0271058.68QEGLSFVGLHVPVGRCID Cmpd 200, +MSn(532.2858), 19.2 min
2<0.01AT2G15620.1NIR1, NIR, ATHNIR, nitrite reductase 1 111573.60611717.796531717.8271-0.0306088.59GEEGKPVEGADVYVGGRCID Cmpd 46, +MSn(573.6061), 13.2 min
3<0.05AT2G26500.1PetM, putative (Gene model 1)111603.77651205.538421205.52990.0085042.40IETSVEEAEAECID Cmpd 13, +MSn(603.7765), 14.0 min
3<0.05AT2G26500.2PetM, putative (Gene model 2)101603.77651205.538421205.52990.0085042.40IETSVEEAEAECID Cmpd 13, +MSn(603.7765), 14.0 min
3<0.05AT2G26500.3PetM, putative (Gene model 3)101603.77651205.538421205.52990.0085042.40IETSVEEAEAECID Cmpd 13, +MSn(603.7765), 14.0 min
4<0.01AT3G19170.1PreP1, presequence protease, AtPreP1, ATZNMP111426.2130850.41152850.4297-0.0182047.79QFVSQSRCID Cmpd 2, +MSn(426.2130), 9.6 min
4<0.01AT3G19170.1PreP1, presequence protease, AtPreP1, ATZNMP111435.7149869.41532869.4283-0.0130017.45SNFFEVKCID Cmpd 178, +MSn(435.7149), 16.7 min
4<0.01AT3G19170.1PreP1, presequence protease, AtPreP1, ATZNMP111462.2286922.44272922.4582-0.0155027.53GVVFNEMKCID Cmpd 132, +MSn(462.2286), 15.2 min
4<0.01AT3G19170.1PreP1, presequence protease, AtPreP1, ATZNMP111466.2696930.52462930.5386-0.0140115.91ATEELKLKCID Cmpd 28, +MSn(466.2696), 11.5 min
4<0.01AT3G19170.1PreP1, presequence protease, AtPreP1, ATZNMP111483.7674965.52022965.5406-0.0204033.40LILNNSHRCID Cmpd 14, +MSn(483.7674), 10.6 min
4<0.01AT3G19170.1PreP1, presequence protease, AtPreP1, ATZNMP111502.28621002.557921002.5750-0.0171047.53AVFSPLIEKCID Cmpd 208, +MSn(502.2862), 17.8 min
4<0.01AT3G19170.1PreP1, presequence protease, AtPreP1, ATZNMP111511.23021020.445821020.4625-0.0167048.68ENNTGSFPRCID Cmpd 21, +MSn(511.2302), 11.3 min
4<0.01AT3G19170.1PreP1, presequence protease, AtPreP1, ATZNMP111563.79421125.573921125.5931-0.0192130.68FKQFVSQSRCID Cmpd 37, +MSn(563.7942), 11.8 min
4<0.01AT3G19170.1PreP1, presequence protease, AtPreP1, ATZNMP111567.29481132.575121132.5877-0.0125035.01DFAQAIDVVRCID Cmpd 229, +MSn(567.2949), 18.7 min
4<0.01AT3G19170.1PreP1, presequence protease, AtPreP1, ATZNMP111584.79401167.573421167.5884-0.0150028.75HLLGVTDEERCID Cmpd 62, +MSn(584.7940), 12.8 min
4<0.01AT3G19170.1PreP1, presequence protease, AtPreP1, ATZNMP111588.82791175.641221175.6584-0.0171058.06GLSLMLQSISKCID Cmpd 256, +MSn(588.8279), 20.0 min
4<0.01AT3G19170.1PreP1, presequence protease, AtPreP1, ATZNMP111609.80431217.594121217.6140-0.0199078.52GLDVDQETLTKCID Cmpd 116, +MSn(609.8043), 14.7 min
4<0.01AT3G19170.1PreP1, presequence protease, AtPreP1, ATZNMP111614.27291226.531221226.5489-0.0177068.91VSEEFISECKCID Cmpd 108, +MSn(614.2729), 14.4 min
4<0.01AT3G19170.1PreP1, presequence protease, AtPreP1, ATZNMP111621.28671240.558821240.5758-0.0170034.51TCYPVASTNTKCID Cmpd 24, +MSn(621.2867), 11.4 min
4<0.01AT3G19170.1PreP1, presequence protease, AtPreP1, ATZNMP111648.77311295.531621294.56460.9670031.31NGCIVNMTADGKOxidation (M)0.000000200000.0CID Cmpd 42, +MSn(648.7731), 12.2 min
4<0.01AT3G19170.1PreP1, presequence protease, AtPreP1, ATZNMP111659.83351317.652421317.6677-0.0153081.50GVYSQPDNILGRCID Cmpd 162, +MSn(659.8335), 16.2 min
4<0.01AT3G19170.1PreP1, presequence protease, AtPreP1, ATZNMP111664.31971326.624821326.6469-0.0221084.06HISNTWLWDRCID Cmpd 218, +MSn(664.3197), 18.1 min
4<0.01AT3G19170.1PreP1, presequence protease, AtPreP1, ATZNMP111710.33311418.651721418.6711-0.01940122.79AAMTEEDLAELARCID Cmpd 224, +MSn(710.3331), 18.3 min
4<0.01AT3G19170.1PreP1, presequence protease, AtPreP1, ATZNMP111718.87991435.745221435.7671-0.0219050.70TGGISVYPLTSSVRCID Cmpd 210, +MSn(718.8799), 17.8 min
4<0.01AT3G19170.1PreP1, presequence protease, AtPreP1, ATZNMP111743.35451484.694421484.7147-0.0203050.61TLDIYDGTGDFLRCID Cmpd 262, +MSn(743.3545), 20.3 min
4<0.01AT3G19170.1PreP1, presequence protease, AtPreP1, ATZNMP111758.91951515.824521515.8409-0.0164058.10DLTFVQLNQLIGRCID Cmpd 272, +MSn(758.9196), 23.0 min
4<0.01AT3G19170.1PreP1, presequence protease, AtPreP1, ATZNMP111822.94001643.865521643.8883-0.0228059.90NEAIVIPTQVNYVGKCID Cmpd 217, +MSn(822.9400), 18.1 min
4<0.01AT3G19170.1PreP1, presequence protease, AtPreP1, ATZNMP111938.47781874.941021874.9626-0.0215023.33AIIGTIGDVDSYQLPDAKCID Cmpd 248, +MSn(938.4778), 19.7 min
4<0.01AT3G19170.1PreP1, presequence protease, AtPreP1, ATZNMP111484.91491451.723031451.7481-0.0251151.20HLLGVTDEERQRCID Cmpd 29, +MSn(484.9149), 11.6 min
4<0.01AT3G19170.1PreP1, presequence protease, AtPreP1, ATZNMP111487.94241460.805531460.8279-0.0224137.10YPVKEPFVELLKCID Cmpd 241, +MSn(487.9424), 19.4 min
4<0.01AT3G19170.1PreP1, presequence protease, AtPreP1, ATZNMP111498.59371492.759231492.7885-0.0293115.41LKQETPDPPEALRCID Cmpd 65, +MSn(498.5937), 13.0 min
4<0.01AT3G19170.1PreP1, presequence protease, AtPreP1, ATZNMP111507.22881518.664631518.6892-0.0246065.08IWFYGDDDPVHRCID Cmpd 223, +MSn(507.2288), 18.3 min
4<0.01AT3G19170.1PreP1, presequence protease, AtPreP1, ATZNMP111554.93891661.794831661.8294-0.0346133.40VKAAMTEEDLAELAROxidation (M)0.000020000000000.0CID Cmpd 154, +MSn(554.9388), 16.0 min
4<0.01AT3G19170.1PreP1, presequence protease, AtPreP1, ATZNMP111580.28231737.825031737.8475-0.0225022.48GSLHTFLNAFTYPDRCID Cmpd 266, +MSn(580.2823), 20.5 min
4<0.01AT3G19170.1PreP1, presequence protease, AtPreP1, ATZNMP111705.67412114.000632114.0240-0.0234189.09DKGVAVAVASAEDIDAANNERCID Cmpd 174, +MSn(705.6741), 16.6 min
4<0.01AT3G19170.1PreP1, presequence protease, AtPreP1, ATZNMP111716.33712145.989532146.0178-0.0284069.06IAQQALSPENTYGVDSGGDPKCID Cmpd 135, +MSn(716.3371), 15.3 min
4<0.01AT2G45290.1Transketolase (AT2G45290.1)111619.31421236.613821236.6350-0.0213039.61VTTTIGYGSPNKCID Cmpd 59, +MSn(619.3141), 12.7 min
5<0.01AT1G63770.4Peptidase M1 family protein (Gene model 4)111407.1912812.36782812.3851-0.0173052.46MVSAFSROxidation (M)0.2000000.0CID Cmpd 45, +MSn(407.1912), 11.4 min
5<0.01AT1G63770.4Peptidase M1 family protein (Gene model 4)111411.2239820.43312820.4443-0.0112017.14EGLTVFRCID Cmpd 201, +MSn(411.2238), 16.3 min
5<0.01AT1G63770.4Peptidase M1 family protein (Gene model 4)111428.1890854.36352854.3770-0.0135044.06DDTFTTRCID Cmpd 35, +MSn(428.1890), 10.9 min
5<0.01AT1G63770.4Peptidase M1 family protein (Gene model 4)111442.7437883.47282883.4875-0.0147043.84LNPQVASRCID Cmpd 13, +MSn(442.7437), 10.1 min
5<0.01AT1G63770.4Peptidase M1 family protein (Gene model 4)111451.2672900.51982900.5392-0.0194133.41IADVSKLRCID Cmpd 56, +MSn(451.2672), 11.7 min
5<0.01AT1G63770.4Peptidase M1 family protein (Gene model 4)111461.7473921.48002921.4920-0.0119038.21SLNIFNSKCID Cmpd 218, +MSn(461.7473), 16.9 min
5<0.01AT1G63770.4Peptidase M1 family protein (Gene model 4)111486.7980971.58152971.6015-0.0200151.00LLSVKVEGKCID Cmpd 84, +MSn(486.7980), 12.6 min
5<0.01AT1G63770.4Peptidase M1 family protein (Gene model 4)111496.7710991.52742991.5451-0.0177061.05TLLGTQGFRCID Cmpd 194, +MSn(496.7710), 16.1 min
5<0.01AT1G63770.4Peptidase M1 family protein (Gene model 4)111506.75051011.486521011.5025-0.0161034.82GIDLYFERCID Cmpd 277, +MSn(506.7505), 18.7 min
5<0.01AT1G63770.4Peptidase M1 family protein (Gene model 4)111519.24861036.482521036.5011-0.0186027.45TAHAMYSLKOxidation (M)0.000020000.0CID Cmpd 20, +MSn(519.2485), 10.3 min
5<0.01AT1G63770.4Peptidase M1 family protein (Gene model 4)111541.25921080.503921080.5200-0.0160094.51VVSSYNADARCID Cmpd 14, +MSn(541.2593), 10.2 min
5<0.01AT1G63770.4Peptidase M1 family protein (Gene model 4)111541.73311081.451621081.4676-0.0160072.42EGDYQLDSRCID Cmpd 63, +MSn(541.7331), 11.9 min
5<0.01AT1G63770.4Peptidase M1 family protein (Gene model 4)111585.30451168.594421168.6128-0.0184046.58IWTPAEDLPKCID Cmpd 268, +MSn(585.3045), 18.5 min
5<0.01AT1G63770.4Peptidase M1 family protein (Gene model 4)111598.81681195.619021195.6349-0.0160020.85LLDHPAFDLRCID Cmpd 217, +MSn(598.8168), 16.8 min
5<0.01AT1G63770.4Peptidase M1 family protein (Gene model 4)111623.84871245.682921245.6969-0.0140062.03FLGDIVVQLDKCID Cmpd 345, +MSn(623.8488), 20.9 min
5<0.01AT1G63770.4Peptidase M1 family protein (Gene model 4)111629.74571257.476821257.4932-0.0164061.38DQEFSSDMGSRCID Cmpd 93, +MSn(629.7457), 12.9 min
5<0.01AT1G63770.4Peptidase M1 family protein (Gene model 4)111653.30871304.602921304.6190-0.0160063.84HYALWEDPFKCID Cmpd 294, +MSn(653.3087), 19.3 min
5<0.01AT1G63770.4Peptidase M1 family protein (Gene model 4)111755.34031508.666021508.6857-0.0197064.96MDNFYTVTVYEKCID Cmpd 263, +MSn(755.3403), 18.3 min
5<0.01AT1G63770.4Peptidase M1 family protein (Gene model 4)111875.34031748.666021748.6883-0.0223053.00SSGNFCTQCEAEGFRCID Cmpd 151, +MSn(875.3403), 14.8 min
5<0.01AT1G63770.4Peptidase M1 family protein (Gene model 4)1111024.01692046.019122046.0422-0.0231036.92WFLLQSTSDIPGNVENVKCID Cmpd 370, +MSn(1024.0168), 21.8 min
5<0.01AT1G63770.4Peptidase M1 family protein (Gene model 4)1111081.53432161.054122161.0837-0.0296079.73MATNLTDQFAALAALSQNPGKCID Cmpd 390, +MSn(1081.5343), 22.4 min
5<0.01AT1G63770.4Peptidase M1 family protein (Gene model 4)111442.24131323.702031323.7299-0.0279142.33KLLDHPAFDLRCID Cmpd 183, +MSn(442.2413), 15.8 min
5<0.01AT1G63770.4Peptidase M1 family protein (Gene model 4)111461.57321381.697931381.7201-0.0222044.20GSSAALVLDGHDLKCID Cmpd 175, +MSn(461.5732), 15.5 min
5<0.01AT1G63770.4Peptidase M1 family protein (Gene model 4)111467.59641399.767431399.7922-0.0248147.20QLASELKEELLKCID Cmpd 238, +MSn(467.5964), 17.5 min
5<0.01AT1G63770.4Peptidase M1 family protein (Gene model 4)111479.57571435.705331435.7307-0.0254141.37LLKEGDYQLDSRCID Cmpd 125, +MSn(479.5757), 13.9 min
5<0.01AT1G63770.4Peptidase M1 family protein (Gene model 4)111518.26171551.763131551.7868-0.0237141.68VTCRDWFQLSLKCID Cmpd 298, +MSn(518.2617), 19.4 min
5<0.01AT1G63770.4Peptidase M1 family protein (Gene model 4)111533.26541596.774331596.7970-0.0227033.05ITFYQDRPDIMAKCID Cmpd 206, +MSn(533.2654), 16.5 min
5<0.01AT1G63770.4Peptidase M1 family protein (Gene model 4)111537.29211608.854431608.8835-0.0291139.87VKGSSAALVLDGHDLKCID Cmpd 142, +MSn(537.2921), 14.5 min
5<0.01AT1G63770.4Peptidase M1 family protein (Gene model 4)111543.23571626.685231626.7096-0.0244069.26STEAYVFDHSNMARCID Cmpd 156, +MSn(543.2357), 14.9 min
5<0.01AT1G63770.4Peptidase M1 family protein (Gene model 4)111607.99711820.969431820.9971-0.0277065.18KPCYLFALVAGQLVSRCID Cmpd 396, +MSn(607.9971), 22.6 min
5<0.01AT1G63770.4Peptidase M1 family protein (Gene model 4)111626.59251876.755831876.7832-0.0274147.57SSGNFCTQCEAEGFRKCID Cmpd 100, +MSn(626.5925), 13.2 min
5<0.01AT1G63770.4Peptidase M1 family protein (Gene model 4)111642.93551925.784631925.8036-0.0190064.91HDEQAVTCEDFFAAMRCID Cmpd 296, +MSn(642.9355), 19.3 min
5<0.01AT1G63770.4Peptidase M1 family protein (Gene model 4)111651.65321951.937731951.9615-0.02370101.65VYSLIGGFCGSPVNFHAKCID Cmpd 304, +MSn(651.6532), 19.6 min
5<0.01AT1G63770.4Peptidase M1 family protein (Gene model 4)111687.64132059.902232059.9269-0.0247161.78EGLTVFRDQEFSSDMGSRCID Cmpd 246, +MSn(687.6414), 17.8 min
5<0.01AT1G63770.4Peptidase M1 family protein (Gene model 4)111704.72232111.144932111.1739-0.0290183.62FLGDIVVQLDKLNPQVASRCID Cmpd 379, +MSn(704.7222), 22.1 min
5<0.01AT1G63770.4Peptidase M1 family protein (Gene model 4)111725.70972174.107232174.1372-0.0300139.29WFLLQSTSDIPGNVENVKKCID Cmpd 324, +MSn(725.7097), 20.2 min
5<0.01AT1G63770.4Peptidase M1 family protein (Gene model 4)111747.39022239.148932239.1736-0.0248160.43FVQGLGSVLSDSSLDKEFIAKCID Cmpd 340, +MSn(747.3903), 20.7 min
5<0.01AT1G63770.4Peptidase M1 family protein (Gene model 4)111761.74562282.214932282.2456-0.0307035.15LMLNLVSDFQQNKPLALNPKCID Cmpd 350, +MSn(761.7456), 21.1 min
5<0.01AT1G63770.4Peptidase M1 family protein (Gene model 4)111772.73562315.184932315.2121-0.0273087.61TLYPVLLSNGNLISQGDIEGGRCID Cmpd 356, +MSn(772.7355), 21.4 min
5<0.01AT1G63770.4Peptidase M1 family protein (Gene model 4)111805.37982413.117632413.1505-0.03290109.72AQLEMIMSANGLSENVFEIASK2 Oxidation (M)0.0000202000000000000000.0CID Cmpd 338, +MSn(805.3798), 20.7 min
5<0.01AT1G63770.4Peptidase M1 family protein (Gene model 4)111914.42402740.250132740.2870-0.0369020.99AITLPGEGEIMDMMAVADPDAVHAVR2 Oxidation (M)0.00000000000022000000000000.0CID Cmpd 289, +MSn(914.4240), 19.1 min
5<0.01AT1G63770.4Peptidase M1 family protein (Gene model 4)111948.81752843.430832843.4665-0.0357157.47VEGDKTLYPVLLSNGNLISQGDIEGGRCID Cmpd 327, +MSn(948.8176), 20.3 min
5<0.01AT1G63770.4Peptidase M1 family protein (Gene model 4)111603.58402410.307142410.3406-0.0335142.22KLMLNLVSDFQQNKPLALNPKCID Cmpd 310, +MSn(603.5840), 19.8 min
5<0.01AT1G63770.4Peptidase M1 family protein (Gene model 4)111606.05802420.202942420.2376-0.0347142.40KEEEFVFSDIPERPVPSLFRCID Cmpd 330, +MSn(606.0580), 20.4 min
5<0.01AT1G63770.4Peptidase M1 family protein (Gene model 4)111817.17983264.690243264.7282-0.0380123.34FSQEIPPTPGQPTKEPTFIPVVVGLLDSSGKCID Cmpd 408, +MSn(817.1798), 23.7 min
5<0.01AT1G63770.4Peptidase M1 family protein (Gene model 4)111511.25372551.232352551.2794-0.0471025.68IYQFPQDAGPMAHPVRPHSYIKCID Cmpd 172, +MSn(511.2537), 15.4 min
5<0.01AT1G63770.4Peptidase M1 family protein (Gene model 4)110595.3344594.32711594.3377-0.0106025.10TFSLKCID Cmpd 107, +MSn(595.3344), 13.4 min
5<0.01AT1G63770.3Peptidase M1 family protein (Gene model 3)100595.3344594.32711594.3377-0.0106025.10TFSLKCID Cmpd 107, +MSn(595.3344), 13.4 min
5<0.01AT1G63770.3Peptidase M1 family protein (Gene model 3)101407.1912812.36782812.3851-0.0173052.46MVSAFSROxidation (M)0.2000000.0CID Cmpd 45, +MSn(407.1912), 11.4 min
5<0.01AT1G63770.3Peptidase M1 family protein (Gene model 3)101411.2239820.43312820.4443-0.0112017.14EGLTVFRCID Cmpd 201, +MSn(411.2238), 16.3 min
5<0.01AT1G63770.3Peptidase M1 family protein (Gene model 3)101428.1890854.36352854.3770-0.0135044.06DDTFTTRCID Cmpd 35, +MSn(428.1890), 10.9 min
5<0.01AT1G63770.3Peptidase M1 family protein (Gene model 3)101442.7437883.47282883.4875-0.0147043.84LNPQVASRCID Cmpd 13, +MSn(442.7437), 10.1 min
5<0.01AT1G63770.3Peptidase M1 family protein (Gene model 3)101451.2672900.51982900.5392-0.0194133.41IADVSKLRCID Cmpd 56, +MSn(451.2672), 11.7 min
5<0.01AT1G63770.3Peptidase M1 family protein (Gene model 3)101461.7473921.48002921.4920-0.0119038.21SLNIFNSKCID Cmpd 218, +MSn(461.7473), 16.9 min
5<0.01AT1G63770.3Peptidase M1 family protein (Gene model 3)101486.7980971.58152971.6015-0.0200151.00LLSVKVEGKCID Cmpd 84, +MSn(486.7980), 12.6 min
5<0.01AT1G63770.3Peptidase M1 family protein (Gene model 3)101496.7710991.52742991.5451-0.0177061.05TLLGTQGFRCID Cmpd 194, +MSn(496.7710), 16.1 min
5<0.01AT1G63770.3Peptidase M1 family protein (Gene model 3)101506.75051011.486521011.5025-0.0161034.82GIDLYFERCID Cmpd 277, +MSn(506.7505), 18.7 min
5<0.01AT1G63770.3Peptidase M1 family protein (Gene model 3)101519.24861036.482521036.5011-0.0186027.45TAHAMYSLKOxidation (M)0.000020000.0CID Cmpd 20, +MSn(519.2485), 10.3 min
5<0.01AT1G63770.3Peptidase M1 family protein (Gene model 3)101541.25921080.503921080.5200-0.0160094.51VVSSYNADARCID Cmpd 14, +MSn(541.2593), 10.2 min
5<0.01AT1G63770.3Peptidase M1 family protein (Gene model 3)101541.73311081.451621081.4676-0.0160072.42EGDYQLDSRCID Cmpd 63, +MSn(541.7331), 11.9 min
5<0.01AT1G63770.3Peptidase M1 family protein (Gene model 3)101585.30451168.594421168.6128-0.0184046.58IWTPAEDLPKCID Cmpd 268, +MSn(585.3045), 18.5 min
5<0.01AT1G63770.3Peptidase M1 family protein (Gene model 3)101598.81681195.619021195.6349-0.0160020.85LLDHPAFDLRCID Cmpd 217, +MSn(598.8168), 16.8 min
5<0.01AT1G63770.3Peptidase M1 family protein (Gene model 3)101623.84871245.682921245.6969-0.0140062.03FLGDIVVQLDKCID Cmpd 345, +MSn(623.8488), 20.9 min
5<0.01AT1G63770.3Peptidase M1 family protein (Gene model 3)101629.74571257.476821257.4932-0.0164061.38DQEFSSDMGSRCID Cmpd 93, +MSn(629.7457), 12.9 min
5<0.01AT1G63770.3Peptidase M1 family protein (Gene model 3)101653.30871304.602921304.6190-0.0160063.84HYALWEDPFKCID Cmpd 294, +MSn(653.3087), 19.3 min
5<0.01AT1G63770.3Peptidase M1 family protein (Gene model 3)101442.24131323.702031323.7299-0.0279142.33KLLDHPAFDLRCID Cmpd 183, +MSn(442.2413), 15.8 min
5<0.01AT1G63770.3Peptidase M1 family protein (Gene model 3)101461.57321381.697931381.7201-0.0222044.20GSSAALVLDGHDLKCID Cmpd 175, +MSn(461.5732), 15.5 min
5<0.01AT1G63770.3Peptidase M1 family protein (Gene model 3)101467.59641399.767431399.7922-0.0248147.20QLASELKEELLKCID Cmpd 238, +MSn(467.5964), 17.5 min
5<0.01AT1G63770.3Peptidase M1 family protein (Gene model 3)101479.57571435.705331435.7307-0.0254141.37LLKEGDYQLDSRCID Cmpd 125, +MSn(479.5757), 13.9 min
5<0.01AT1G63770.3Peptidase M1 family protein (Gene model 3)101755.34031508.666021508.6857-0.0197064.96MDNFYTVTVYEKCID Cmpd 263, +MSn(755.3403), 18.3 min
5<0.01AT1G63770.3Peptidase M1 family protein (Gene model 3)101518.26171551.763131551.7868-0.0237141.68VTCRDWFQLSLKCID Cmpd 298, +MSn(518.2617), 19.4 min
5<0.01AT1G63770.3Peptidase M1 family protein (Gene model 3)101533.26541596.774331596.7970-0.0227033.05ITFYQDRPDIMAKCID Cmpd 206, +MSn(533.2654), 16.5 min
5<0.01AT1G63770.3Peptidase M1 family protein (Gene model 3)101537.29211608.854431608.8835-0.0291139.87VKGSSAALVLDGHDLKCID Cmpd 142, +MSn(537.2921), 14.5 min
5<0.01AT1G63770.3Peptidase M1 family protein (Gene model 3)101543.23571626.685231626.7096-0.0244069.26STEAYVFDHSNMARCID Cmpd 156, +MSn(543.2357), 14.9 min
5<0.01AT1G63770.3Peptidase M1 family protein (Gene model 3)101875.34031748.666021748.6883-0.0223053.00SSGNFCTQCEAEGFRCID Cmpd 151, +MSn(875.3403), 14.8 min
5<0.01AT1G63770.3Peptidase M1 family protein (Gene model 3)101607.99711820.969431820.9971-0.0277065.18KPCYLFALVAGQLVSRCID Cmpd 396, +MSn(607.9971), 22.6 min
5<0.01AT1G63770.3Peptidase M1 family protein (Gene model 3)101626.59251876.755831876.7832-0.0274147.57SSGNFCTQCEAEGFRKCID Cmpd 100, +MSn(626.5925), 13.2 min
5<0.01AT1G63770.3Peptidase M1 family protein (Gene model 3)101642.93551925.784631925.8036-0.0190064.91HDEQAVTCEDFFAAMRCID Cmpd 296, +MSn(642.9355), 19.3 min
5<0.01AT1G63770.3Peptidase M1 family protein (Gene model 3)101651.65321951.937731951.9615-0.02370101.65VYSLIGGFCGSPVNFHAKCID Cmpd 304, +MSn(651.6532), 19.6 min
5<0.01AT1G63770.3Peptidase M1 family protein (Gene model 3)1011024.01692046.019122046.0422-0.0231036.92WFLLQSTSDIPGNVENVKCID Cmpd 370, +MSn(1024.0168), 21.8 min
5<0.01AT1G63770.3Peptidase M1 family protein (Gene model 3)101687.64132059.902232059.9269-0.0247161.78EGLTVFRDQEFSSDMGSRCID Cmpd 246, +MSn(687.6414), 17.8 min
5<0.01AT1G63770.3Peptidase M1 family protein (Gene model 3)101704.72232111.144932111.1739-0.0290183.62FLGDIVVQLDKLNPQVASRCID Cmpd 379, +MSn(704.7222), 22.1 min
5<0.01AT1G63770.3Peptidase M1 family protein (Gene model 3)1011081.53432161.054122161.0837-0.0296079.73MATNLTDQFAALAALSQNPGKCID Cmpd 390, +MSn(1081.5343), 22.4 min
5<0.01AT1G63770.3Peptidase M1 family protein (Gene model 3)101725.70972174.107232174.1372-0.0300139.29WFLLQSTSDIPGNVENVKKCID Cmpd 324, +MSn(725.7097), 20.2 min
5<0.01AT1G63770.3Peptidase M1 family protein (Gene model 3)101747.39022239.148932239.1736-0.0248160.43FVQGLGSVLSDSSLDKEFIAKCID Cmpd 340, +MSn(747.3903), 20.7 min
5<0.01AT1G63770.3Peptidase M1 family protein (Gene model 3)101761.74562282.214932282.2456-0.0307035.15LMLNLVSDFQQNKPLALNPKCID Cmpd 350, +MSn(761.7456), 21.1 min
5<0.01AT1G63770.3Peptidase M1 family protein (Gene model 3)101772.73562315.184932315.2121-0.0273087.61TLYPVLLSNGNLISQGDIEGGRCID Cmpd 356, +MSn(772.7355), 21.4 min
5<0.01AT1G63770.3Peptidase M1 family protein (Gene model 3)101603.58402410.307142410.3406-0.0335142.22KLMLNLVSDFQQNKPLALNPKCID Cmpd 310, +MSn(603.5840), 19.8 min
5<0.01AT1G63770.3Peptidase M1 family protein (Gene model 3)101805.37982413.117632413.1505-0.03290109.72AQLEMIMSANGLSENVFEIASK2 Oxidation (M)0.0000202000000000000000.0CID Cmpd 338, +MSn(805.3798), 20.7 min
5<0.01AT1G63770.3Peptidase M1 family protein (Gene model 3)101606.05802420.202942420.2376-0.0347142.40KEEEFVFSDIPERPVPSLFRCID Cmpd 330, +MSn(606.0580), 20.4 min
5<0.01AT1G63770.3Peptidase M1 family protein (Gene model 3)101511.25372551.232352551.2794-0.0471025.68IYQFPQDAGPMAHPVRPHSYIKCID Cmpd 172, +MSn(511.2537), 15.4 min
5<0.01AT1G63770.3Peptidase M1 family protein (Gene model 3)101914.42402740.250132740.2870-0.0369020.99AITLPGEGEIMDMMAVADPDAVHAVR2 Oxidation (M)0.00000000000022000000000000.0CID Cmpd 289, +MSn(914.4240), 19.1 min
5<0.01AT1G63770.3Peptidase M1 family protein (Gene model 3)101948.81752843.430832843.4665-0.0357157.47VEGDKTLYPVLLSNGNLISQGDIEGGRCID Cmpd 327, +MSn(948.8176), 20.3 min
5<0.01AT1G63770.3Peptidase M1 family protein (Gene model 3)101817.17983264.690243264.7282-0.0380123.34FSQEIPPTPGQPTKEPTFIPVVVGLLDSSGKCID Cmpd 408, +MSn(817.1798), 23.7 min
5<0.01AT3G45140.1LOX2, ATLOX2, lipoxygenase 2 111421.2361840.45772840.4705-0.0128023.28EPIQNIKCID Cmpd 44, +MSn(421.2361), 11.2 min
5<0.01AT3G45140.1LOX2, ATLOX2, lipoxygenase 2 111494.2513986.48802986.5033-0.0153038.15GLDDIADIRCID Cmpd 228, +MSn(494.2513), 17.2 min
5<0.01AT3G45140.1LOX2, ATLOX2, lipoxygenase 2 111507.23141012.448221012.4648-0.0166040.60YTMEINAROxidation (M)0.00200000.0CID Cmpd 32, +MSn(507.2314), 10.8 min
5<0.01AT3G45140.1LOX2, ATLOX2, lipoxygenase 2 111522.75361043.492621043.49240.0002037.92VWAEAPDEKCID Cmpd 92, +MSn(522.7535), 12.9 min
5<0.01AT3G45140.1LOX2, ATLOX2, lipoxygenase 2 111532.81731063.620121063.6390-0.0189039.30DAGLLPLLPRCID Cmpd 364, +MSn(532.8173), 21.6 min
5<0.01AT3G45140.1LOX2, ATLOX2, lipoxygenase 2 111536.82571071.636821071.6539-0.0172028.46SLLVELISAKCID Cmpd 372, +MSn(536.8257), 21.8 min
5<0.01AT3G45140.1LOX2, ATLOX2, lipoxygenase 2 111544.25841086.502321086.5134-0.0112034.21YGGEFYVPRCID Cmpd 207, +MSn(544.2584), 16.5 min
5<0.01AT3G45140.1LOX2, ATLOX2, lipoxygenase 2 111547.25491092.495221092.5121-0.0169045.22GNMTVDEALKOxidation (M)0.0020000000.0CID Cmpd 71, +MSn(547.2549), 12.2 min
5<0.01AT3G45140.1LOX2, ATLOX2, lipoxygenase 2 111547.76861093.522521093.5404-0.0178057.75ITVEDYAQRCID Cmpd 128, +MSn(547.7686), 14.0 min
5<0.01AT3G45140.1LOX2, ATLOX2, lipoxygenase 2 111585.29571168.576721168.5917-0.0149021.27DEPWWPVLKCID Cmpd 384, +MSn(585.2957), 22.2 min
5<0.01AT3G45140.1LOX2, ATLOX2, lipoxygenase 2 111601.79591201.577221201.5939-0.0166046.27ANIEQEGNTVKCID Cmpd 28, +MSn(601.7959), 10.6 min
5<0.01AT3G45140.1LOX2, ATLOX2, lipoxygenase 2 111641.31671280.618821280.6360-0.0173057.29ELNNTTLYASRCID Cmpd 117, +MSn(641.3167), 13.7 min
5<0.01AT3G45140.1LOX2, ATLOX2, lipoxygenase 2 111650.83421299.653821299.6710-0.0172081.46YALELSSAVYGKCID Cmpd 253, +MSn(650.8342), 18.0 min
5<0.01AT3G45140.1LOX2, ATLOX2, lipoxygenase 2 111667.84251333.670421333.6878-0.0173075.26LQYLEGVIDERCID Cmpd 267, +MSn(667.8425), 18.5 min
5<0.01AT3G45140.1LOX2, ATLOX2, lipoxygenase 2 111673.34351344.672521344.6925-0.0200054.03FDQEGLPADLIKCID Cmpd 276, +MSn(673.3435), 18.7 min
5<0.01AT3G45140.1LOX2, ATLOX2, lipoxygenase 2 111800.43151598.848521598.8668-0.0183098.14AIQNLFEEGIQLPKCID Cmpd 361, +MSn(800.4315), 21.5 min
5<0.01AT3G45140.1LOX2, ATLOX2, lipoxygenase 2 1111099.56272197.110822197.1379-0.0271046.24ALGEAQDDILQFDAPVLINRCID Cmpd 385, +MSn(1099.5626), 22.3 min
5<0.01AT3G45140.1LOX2, ATLOX2, lipoxygenase 2 111411.20551230.594731230.6179-0.0232042.28QLSAMHPIYROxidation (M)0.0000200000.0CID Cmpd 57, +MSn(411.2055), 11.7 min
5<0.01AT3G45140.1LOX2, ATLOX2, lipoxygenase 2 111481.22631440.657231440.6786-0.0214125.66FSWLRDDEFARCID Cmpd 280, +MSn(481.2263), 18.8 min
5<0.01AT3G45140.1LOX2, ATLOX2, lipoxygenase 2 111496.60141486.782331486.8031-0.0208150.49SYLPSQTPEPLKKCID Cmpd 132, +MSn(496.6014), 14.2 min
5<0.01AT3G45140.1LOX2, ATLOX2, lipoxygenase 2 111501.26291500.766731500.7936-0.0269116.78FDQEGLPADLIKRCID Cmpd 226, +MSn(501.2628), 17.1 min
5<0.01AT3G45140.1LOX2, ATLOX2, lipoxygenase 2 111504.57751510.710731510.7376-0.0269173.08GLAEEDKTAEHGVRCID Cmpd 4, +MSn(504.5775), 9.8 min
5<0.01AT3G45140.1LOX2, ATLOX2, lipoxygenase 2 111654.68661961.037831961.0662-0.0284051.51LFVLDYHDLLLPYVNKCID Cmpd 403, +MSn(654.6865), 23.5 min
5<0.01AT3G45140.1LOX2, ATLOX2, lipoxygenase 2 111665.63561993.884931993.9058-0.0209121.90YGGEFYVPRDEEFSTAKCID Cmpd 220, +MSn(665.6356), 16.9 min
5<0.01AT3G45140.1LOX2, ATLOX2, lipoxygenase 2 111675.68222024.024932024.0538-0.0289136.55ANIEQEGNTVKEPIQNIKCID Cmpd 137, +MSn(675.6823), 14.3 min
5<0.01AT3G45140.1LOX2, ATLOX2, lipoxygenase 2 111786.01412355.020432355.0464-0.0260123.69MPTEDPTDEALKEFYESPEKCID Cmpd 283, +MSn(786.0141), 18.9 min
5<0.01AT3G45140.1LOX2, ATLOX2, lipoxygenase 2 111937.18563744.713543744.7696-0.0562019.06IYDYDVYNDVGDPDNDPELARPVIGGLTHPYPRCID Cmpd 308, +MSn(937.1857), 19.7 min
5<0.01AT3G45140.1LOX2, ATLOX2, lipoxygenase 2 110648.3945647.38721647.4006-0.0134025.76QLFLKCID Cmpd 161, +MSn(648.3945), 15.1 min
5<0.01AT2G05710.1ACO3, aconitase 3 111423.2230844.43142844.4477-0.0163025.84GPMLQGVKOxidation (M)0.00200000.0CID Cmpd 41, +MSn(423.2230), 11.1 min
5<0.01AT2G05710.1ACO3, aconitase 3 111456.7291911.44372911.4600-0.0163038.78ATYESITKCID Cmpd 52, +MSn(456.7291), 11.6 min
5<0.01AT2G05710.1ACO3, aconitase 3 111473.2078944.40102944.39880.0022038.61DFNSYGSRCID Cmpd 66, +MSn(473.2078), 12.0 min
5<0.01AT2G05710.1ACO3, aconitase 3 111558.80771115.600921115.6187-0.0177045.69TSLAPGSGVVTKCID Cmpd 90, +MSn(558.8077), 12.8 min
5<0.01AT2G05710.1ACO3, aconitase 3 111646.82721291.639921291.6561-0.0162034.44FYSLPALNDPRCID Cmpd 284, +MSn(646.8272), 18.9 min
5<0.01AT2G05710.1ACO3, aconitase 3 111509.94041526.799231526.8279-0.0287025.20ACDLGLQVKPWIKCID Cmpd 257, +MSn(509.9403), 18.1 min
5<0.01AT2G05710.1ACO3, aconitase 3 111575.92021724.738831724.7676-0.0287126.77NCDNFQVTKEDVEKCID Cmpd 95, +MSn(575.9202), 13.0 min
5<0.01AT2G45290.1Transketolase (AT2G45290.1)111619.31561236.616721236.6350-0.0183043.38VTTTIGYGSPNKCID Cmpd 86, +MSn(619.3156), 12.6 min
6<0.01AT3G27830.1Rpl12-A, Ribosomal protein L12-A 111553.80741105.600321105.6019-0.0016046.69ILVDYLQDKCID Cmpd 86, +MSn(553.8074), 17.9 min
6<0.01AT3G27830.1Rpl12-A, Ribosomal protein L12-A 111752.89881503.783121503.77800.00510110.21IGSEISSLTLEEARCID Cmpd 85, +MSn(752.8988), 17.9 min
6<0.01AT4G32260.1F0 part, B/B`subunit111539.60951615.806731615.80530.0014148.46ETQVEVEEKLAEGRCID Cmpd 44, +MSn(539.6095), 15.0 min
6<0.01AT1G31330.1PsaF111613.35871224.702721224.7078-0.0050045.36EIIIDVPLASRCID Cmpd 102, +MSn(613.3586), 19.8 min
6<0.05AT5G38570.1F-box/RNI-like superfamily protein 111435.7719869.52932869.50830.0210133.43ELRLSPRCID Cmpd 35, +MSn(435.7719), 14.8 min
7<0.01AT5G60600.1GCPE, ISPG, CSB3, CLB4, HDS, 4-hydroxy-3-methylbut1111027.46181026.454511026.4658-0.0113016.56WVDPPVADECID Cmpd 214, +MSn(1027.4618), 16.9 min
7<0.01AT5G60600.1GCPE, ISPG, CSB3, CLB4, HDS, 4-hydroxy-3-methylbut111404.2281806.44172806.4538-0.0121041.10IDLYVGKCID Cmpd 165, +MSn(404.2281), 15.4 min
7<0.01AT5G60600.1GCPE, ISPG, CSB3, CLB4, HDS, 4-hydroxy-3-methylbut111429.2313856.44802856.4654-0.0174056.68TGDLPVQKCID Cmpd 25, +MSn(429.2313), 10.9 min
7<0.01AT5G60600.1GCPE, ISPG, CSB3, CLB4, HDS, 4-hydroxy-3-methylbut111431.2387860.46292860.4756-0.0126041.33APELLYRCID Cmpd 159, +MSn(431.2387), 15.2 min
7<0.01AT5G60600.1GCPE, ISPG, CSB3, CLB4, HDS, 4-hydroxy-3-methylbut111445.7540889.49342889.5096-0.0162027.82LVVGMPFKCID Cmpd 259, +MSn(445.7540), 18.4 min
7<0.01AT5G60600.1GCPE, ISPG, CSB3, CLB4, HDS, 4-hydroxy-3-methylbut111495.2352988.45592988.4726-0.0167038.86VNPGNFADRCID Cmpd 84, +MSn(495.2352), 12.8 min
7<0.01AT5G60600.1GCPE, ISPG, CSB3, CLB4, HDS, 4-hydroxy-3-methylbut111498.7081995.40172995.4196-0.0179064.08EGEEVDYRCID Cmpd 34, +MSn(498.7081), 11.2 min
7<0.01AT5G60600.1GCPE, ISPG, CSB3, CLB4, HDS, 4-hydroxy-3-methylbut111506.72871011.442821011.4563-0.0134034.96HYFDFQRCID Cmpd 154, +MSn(506.7287), 15.0 min
7<0.01AT5G60600.1GCPE, ISPG, CSB3, CLB4, HDS, 4-hydroxy-3-methylbut111529.29241056.570221056.5927-0.0225180.87IADKGADIVRCID Cmpd 23, +MSn(529.2924), 10.8 min
7<0.01AT5G60600.1GCPE, ISPG, CSB3, CLB4, HDS, 4-hydroxy-3-methylbut111563.26811124.521621124.5383-0.0168051.23IQTMTTSDTKCID Cmpd 9, +MSn(563.2681), 10.2 min
7<0.01AT5G60600.1GCPE, ISPG, CSB3, CLB4, HDS, 4-hydroxy-3-methylbut111569.27921136.543921136.5648-0.0210176.36VAECFDKIRCID Cmpd 91, +MSn(569.2792), 13.0 min
7<0.01AT5G60600.1GCPE, ISPG, CSB3, CLB4, HDS, 4-hydroxy-3-methylbut111573.28451144.554521144.5737-0.0193130.20VNPGNFADRRCID Cmpd 49, +MSn(573.2845), 11.7 min
7<0.01AT5G60600.1GCPE, ISPG, CSB3, CLB4, HDS, 4-hydroxy-3-methylbut111578.77801155.541421155.5632-0.0219052.77IGTNHGSLSDRCID Cmpd 3, +MSn(578.7780), 9.3 min
7<0.01AT5G60600.1GCPE, ISPG, CSB3, CLB4, HDS, 4-hydroxy-3-methylbut111602.76091203.507321203.5230-0.0157058.85IMSYYGDSPROxidation (M)0.0200000000.0CID Cmpd 83, +MSn(602.7609), 12.8 min
7<0.01AT5G60600.1GCPE, ISPG, CSB3, CLB4, HDS, 4-hydroxy-3-methylbut111608.34211214.669621214.6870-0.0174065.89DLATVDSILLRCID Cmpd 356, +MSn(608.3421), 21.6 min
7<0.01AT5G60600.1GCPE, ISPG, CSB3, CLB4, HDS, 4-hydroxy-3-methylbut111618.29241234.570321234.5864-0.0161051.90DITGTVDEVMRCID Cmpd 262, +MSn(618.2924), 18.4 min
7<0.01AT5G60600.1GCPE, ISPG, CSB3, CLB4, HDS, 4-hydroxy-3-methylbut111619.81601237.617421237.6303-0.0129042.20ELPPVDDQVARCID Cmpd 121, +MSn(619.8160), 14.0 min
7<0.01AT5G60600.1GCPE, ISPG, CSB3, CLB4, HDS, 4-hydroxy-3-methylbut111622.28511242.555721242.5703-0.0146063.49GMVESAFEFARCID Cmpd 281, +MSn(622.2851), 19.2 min
7<0.01AT5G60600.1GCPE, ISPG, CSB3, CLB4, HDS, 4-hydroxy-3-methylbut111623.31961244.624621244.6401-0.0154050.26LQQGVAPFEEKCID Cmpd 144, +MSn(623.3196), 14.7 min
7<0.01AT5G60600.1GCPE, ISPG, CSB3, CLB4, HDS, 4-hydroxy-3-methylbut111655.31211308.609621308.6245-0.0149069.00NTSFNLLQGCRCID Cmpd 234, +MSn(655.3121), 17.5 min
7<0.01AT5G60600.1GCPE, ISPG, CSB3, CLB4, HDS, 4-hydroxy-3-methylbut111658.26521314.515821314.5333-0.0175060.53TEYVSCPSCGRCID Cmpd 45, +MSn(658.2652), 11.6 min
7<0.01AT5G60600.1GCPE, ISPG, CSB3, CLB4, HDS, 4-hydroxy-3-methylbut111674.84641347.678121347.6969-0.0187081.25ASNPVIMVQAYRCID Cmpd 228, +MSn(674.8464), 17.3 min
7<0.01AT5G60600.1GCPE, ISPG, CSB3, CLB4, HDS, 4-hydroxy-3-methylbut111717.84461433.674621433.6926-0.0180035.01GDEPYEELEILKCID Cmpd 305, +MSn(717.8445), 20.0 min
7<0.01AT5G60600.1GCPE, ISPG, CSB3, CLB4, HDS, 4-hydroxy-3-methylbut111753.38751504.760421504.7807-0.0203050.03DGSVLMSISLDQLKCID Cmpd 369, +MSn(753.3875), 22.0 min
7<0.01AT5G60600.1GCPE, ISPG, CSB3, CLB4, HDS, 4-hydroxy-3-methylbut111900.48571798.956921798.9789-0.02200156.40SAIGIGTLLQDGLGDTIRCID Cmpd 394, +MSn(900.4857), 23.2 min
7<0.01AT5G60600.1GCPE, ISPG, CSB3, CLB4, HDS, 4-hydroxy-3-methylbut111467.55531399.644131399.6595-0.0154023.22LDYHNFVFSMKCID Cmpd 290, +MSn(467.5553), 19.5 min
7<0.01AT5G60600.1GCPE, ISPG, CSB3, CLB4, HDS, 4-hydroxy-3-methylbut111510.25001527.728331527.7544-0.0261121.67KLDYHNFVFSMKCID Cmpd 249, +MSn(510.2500), 18.1 min
7<0.01AT5G60600.1GCPE, ISPG, CSB3, CLB4, HDS, 4-hydroxy-3-methylbut111512.26911533.785531533.8038-0.0183019.94TLFDLQEISAEIRCID Cmpd 389, +MSn(512.2691), 22.8 min
7<0.01AT5G60600.1GCPE, ISPG, CSB3, CLB4, HDS, 4-hydroxy-3-methylbut111539.62811615.862431615.8855-0.0231070.39GIAMTEATDALIGLIKCID Cmpd 409, +MSn(539.6281), 24.2 min
7<0.01AT5G60600.1GCPE, ISPG, CSB3, CLB4, HDS, 4-hydroxy-3-methylbut111553.57211657.694531657.7188-0.0243148.13NTKTEYVSCPSCGRCID Cmpd 17, +MSn(553.5721), 10.6 min
7<0.01AT5G60600.1GCPE, ISPG, CSB3, CLB4, HDS, 4-hydroxy-3-methylbut111560.62661678.857931678.8825-0.0246064.73TVMVGNVALGSEHPIRCID Cmpd 191, +MSn(560.6266), 16.2 min
7<0.01AT5G60600.1GCPE, ISPG, CSB3, CLB4, HDS, 4-hydroxy-3-methylbut111597.97871790.914431790.9414-0.0270154.42TLFDLQEISAEIREKCID Cmpd 353, +MSn(597.9787), 21.5 min
7<0.01AT5G60600.1GCPE, ISPG, CSB3, CLB4, HDS, 4-hydroxy-3-methylbut111612.29051833.849631833.8745-0.0249160.10TGDLPVQKEGEEVDYRCID Cmpd 117, +MSn(612.2905), 13.9 min
7<0.01AT5G60600.1GCPE, ISPG, CSB3, CLB4, HDS, 4-hydroxy-3-methylbut111642.96911925.885531925.9153-0.0298135.03VSLTEPPEEEIDPCRRCID Cmpd 176, +MSn(642.9691), 15.7 min
7<0.01AT5G60600.1GCPE, ISPG, CSB3, CLB4, HDS, 4-hydroxy-3-methylbut111653.64651957.917831957.9455-0.0277018.03NIDATMILHDVPFTEDKCID Cmpd 337, +MSn(653.6465), 21.0 min
7<0.01AT5G60600.1GCPE, ISPG, CSB3, CLB4, HDS, 4-hydroxy-3-methylbut111696.39112086.151632086.1860-0.0344177.32LVVGMPFKDLATVDSILLRCID Cmpd 404, +MSn(696.3911), 24.1 min
7<0.01AT5G60600.1GCPE, ISPG, CSB3, CLB4, HDS, 4-hydroxy-3-methylbut111701.37472101.102432101.1306-0.0282136.22LVVSLRGDEPYEELEILKCID Cmpd 327, +MSn(701.3748), 20.7 min
7<0.01AT5G60600.1GCPE, ISPG, CSB3, CLB4, HDS, 4-hydroxy-3-methylbut111781.36932341.086032341.1142-0.0282138.20IQTMTTSDTKDITGTVDEVMRCID Cmpd 261, +MSn(781.3693), 18.4 min
7<0.01AT5G60600.1GCPE, ISPG, CSB3, CLB4, HDS, 4-hydroxy-3-methylbut111788.74322363.207632363.2406-0.0330129.08DGSVLMSISLDQLKAPELLYROxidation (M)0.000002000000000000000.0CID Cmpd 374, +MSn(788.7432), 22.3 min
7<0.01AT5G60600.1GCPE, ISPG, CSB3, CLB4, HDS, 4-hydroxy-3-methylbut111859.81272576.416232576.4479-0.0317034.78LVQLNYNIPLVADIHFAPTVALRCID Cmpd 402, +MSn(859.8127), 23.5 min
7<0.01AT5G60600.1GCPE, ISPG, CSB3, CLB4, HDS, 4-hydroxy-3-methylbut111524.77532095.071942095.1095-0.0376154.76GIAMTEATDALIGLIKEHGRCID Cmpd 385, +MSn(524.7753), 22.7 min
7<0.01AT5G60600.1GCPE, ISPG, CSB3, CLB4, HDS, 4-hydroxy-3-methylbut111576.03582300.114042300.1471-0.0331142.55NIDATMILHDVPFTEDKVSRCID Cmpd 307, +MSn(576.0358), 20.0 min
7<0.01AT5G60600.1GCPE, ISPG, CSB3, CLB4, HDS, 4-hydroxy-3-methylbut111586.26712341.039142341.0757-0.0366115.82IGTNHGSLSDRIMSYYGDSPROxidation (M)0.000000000000200000000.0CID Cmpd 175, +MSn(586.2670), 15.7 min
7<0.01AT3G60750.1Transketolase (AT3G60750.1)111479.2833956.55192956.5655-0.0135042.91TPSILALSRCID Cmpd 231, +MSn(479.2832), 17.4 min
7<0.01AT3G60750.1Transketolase (AT3G60750.1)111498.7313995.44812995.4613-0.0132018.00NPYWFNRCID Cmpd 221, +MSn(498.7313), 17.1 min
7<0.01AT3G60750.1Transketolase (AT3G60750.1)111503.27401004.533421004.5542-0.0208036.37FLAIDAVEKCID Cmpd 222, +MSn(503.2740), 17.1 min
7<0.01AT3G60750.1Transketolase (AT3G60750.1)111533.24981064.485121064.5026-0.0174059.26YPEEASELKCID Cmpd 86, +MSn(533.2498), 12.9 min
7<0.01AT3G60750.1Transketolase (AT3G60750.1)111543.32731084.640021084.6604-0.0204146.91KTPSILALSRCID Cmpd 170, +MSn(543.3273), 15.5 min
7<0.01AT3G60750.1Transketolase (AT3G60750.1)111558.32641114.638221114.6598-0.0216040.79TVTDKPTLIKCID Cmpd 60, +MSn(558.3264), 12.0 min
7<0.01AT3G60750.1Transketolase (AT3G60750.1)111570.24451138.474421137.50510.9694063.51NGNTGYDEIRCID Cmpd 100, +MSn(570.2445), 13.3 min
7<0.01AT3G60750.1Transketolase (AT3G60750.1)111580.29271158.570921158.5881-0.0172059.70ESVLPSDVSARCID Cmpd 130, +MSn(580.2927), 14.3 min
7<0.01AT3G60750.1Transketolase (AT3G60750.1)111597.29591192.577321192.5975-0.0202140.23KYPEEASELKCID Cmpd 56, +MSn(597.2959), 11.9 min
7<0.01AT3G60750.1Transketolase (AT3G60750.1)111619.31551236.616421236.6350-0.0186083.82VTTTIGYGSPNKCID Cmpd 77, +MSn(619.3155), 12.6 min
7<0.01AT3G60750.1Transketolase (AT3G60750.1)111676.83731351.660121351.6772-0.01710104.84VSIEAASTFGWGKCID Cmpd 273, +MSn(676.8373), 19.0 min
7<0.01AT3G60750.1Transketolase (AT3G60750.1)111680.34801358.681521358.6976-0.0161070.11NLSQQCLNALAKCID Cmpd 177, +MSn(680.3481), 15.7 min
7<0.01AT3G60750.1Transketolase (AT3G60750.1)111700.86521399.715921399.7347-0.0188078.66SIITGELPAGWEKCID Cmpd 271, +MSn(700.8652), 18.9 min
7<0.01AT3G60750.1Transketolase (AT3G60750.1)111724.87491447.735221447.7559-0.0206070.74EFGITVEAVVDAAKCID Cmpd 339, +MSn(724.8749), 21.1 min
7<0.01AT3G60750.1Transketolase (AT3G60750.1)111788.37661574.738621574.7576-0.0190032.25ALPTYTPESPGDATRCID Cmpd 150, +MSn(788.3766), 14.9 min
7<0.01AT3G60750.1Transketolase (AT3G60750.1)111903.48161804.948721804.9723-0.0236067.14SIGINSFGASAPAPLLYKCID Cmpd 323, +MSn(903.4816), 20.5 min
7<0.01AT3G60750.1Transketolase (AT3G60750.1)1111009.47522016.935922016.9581-0.0223025.52NNLGWPYEPFQVPDDVKCID Cmpd 358, +MSn(1009.4752), 21.6 min
7<0.01AT3G60750.1Transketolase (AT3G60750.1)1111039.03872076.062922076.0925-0.0296018.38VVPGFLGGSADLASSNMTLLKCID Cmpd 368, +MSn(1039.0387), 22.0 min
7<0.01AT3G60750.1Transketolase (AT3G60750.1)111468.56091402.660931402.6841-0.0232063.46ANSYSVHGAALGEKCID Cmpd 61, +MSn(468.5609), 12.0 min
7<0.01AT3G60750.1Transketolase (AT3G60750.1)111495.59881483.774731483.7976-0.0229032.06FEALGWHVIWVKCID Cmpd 348, +MSn(495.5988), 21.3 min
7<0.01AT3G60750.1Transketolase (AT3G60750.1)111543.58271627.726231627.7478-0.0216062.02HTPEGATLESDWSAKCID Cmpd 141, +MSn(543.5827), 14.6 min
7<0.01AT3G60750.1Transketolase (AT3G60750.1)111578.31291731.916731731.9519-0.0352163.50QKLPHLPGTSIEGVEKCID Cmpd 155, +MSn(578.3129), 15.0 min
7<0.01AT3G60750.1Transketolase (AT3G60750.1)111697.00472087.992232088.0236-0.0313160.65ANSYSVHGAALGEKEVEATRCID Cmpd 99, +MSn(697.0047), 13.3 min
7<0.01AT3G60750.1Transketolase (AT3G60750.1)111757.67992270.017832270.0460-0.0282018.54AMPNTLMFRPADGNETAGAYKOxidation (M)0.020000000000000000000.0CID Cmpd 183, +MSn(757.6799), 15.9 min
7<0.01AT3G60750.1Transketolase (AT3G60750.1)111635.54082538.134142538.1640-0.0299021.12SGHPGLPMGCAPMAHILYDEVMRCID Cmpd 340, +MSn(635.5408), 21.1 min
7<0.01AT3G60750.1Transketolase (AT3G60750.1)111668.56482670.230242670.2615-0.0314120.45NNLGWPYEPFQVPDDVKSHWSRCID Cmpd 317, +MSn(668.5648), 20.3 min
7<0.01AT3G60750.1Transketolase (AT3G60750.1)111944.47613773.875543773.9323-0.0568125.64GGYTISDDSSGNKPDVILIGTGSELEIAAQAAEVLRKCID Cmpd 390, +MSn(944.4761), 23.1 min
7<0.01AT3G60750.2Transketolase (AT3G60750.2)101479.2833956.55192956.5655-0.0135042.91TPSILALSRCID Cmpd 231, +MSn(479.2832), 17.4 min
7<0.01AT3G60750.2Transketolase (AT3G60750.2)101498.7313995.44812995.4613-0.0132018.00NPYWFNRCID Cmpd 221, +MSn(498.7313), 17.1 min
7<0.01AT3G60750.2Transketolase (AT3G60750.2)101503.27401004.533421004.5542-0.0208036.37FLAIDAVEKCID Cmpd 222, +MSn(503.2740), 17.1 min
7<0.01AT3G60750.2Transketolase (AT3G60750.2)101533.24981064.485121064.5026-0.0174059.26YPEEASELKCID Cmpd 86, +MSn(533.2498), 12.9 min
7<0.01AT3G60750.2Transketolase (AT3G60750.2)101543.32731084.640021084.6604-0.0204146.91KTPSILALSRCID Cmpd 170, +MSn(543.3273), 15.5 min
7<0.01AT3G60750.2Transketolase (AT3G60750.2)101558.32641114.638221114.6598-0.0216040.79TVTDKPTLIKCID Cmpd 60, +MSn(558.3264), 12.0 min
7<0.01AT3G60750.2Transketolase (AT3G60750.2)101570.24451138.474421137.50510.9694063.51NGNTGYDEIRCID Cmpd 100, +MSn(570.2445), 13.3 min
7<0.01AT3G60750.2Transketolase (AT3G60750.2)101580.29271158.570921158.5881-0.0172059.70ESVLPSDVSARCID Cmpd 130, +MSn(580.2927), 14.3 min
7<0.01AT3G60750.2Transketolase (AT3G60750.2)101597.29591192.577321192.5975-0.0202140.23KYPEEASELKCID Cmpd 56, +MSn(597.2959), 11.9 min
7<0.01AT3G60750.2Transketolase (AT3G60750.2)101619.31551236.616421236.6350-0.0186083.82VTTTIGYGSPNKCID Cmpd 77, +MSn(619.3155), 12.6 min
7<0.01AT3G60750.2Transketolase (AT3G60750.2)101676.83731351.660121351.6772-0.01710104.84VSIEAASTFGWGKCID Cmpd 273, +MSn(676.8373), 19.0 min
7<0.01AT3G60750.2Transketolase (AT3G60750.2)101680.34801358.681521358.6976-0.0161070.11NLSQQCLNALAKCID Cmpd 177, +MSn(680.3481), 15.7 min
7<0.01AT3G60750.2Transketolase (AT3G60750.2)101700.86521399.715921399.7347-0.0188078.66SIITGELPAGWEKCID Cmpd 271, +MSn(700.8652), 18.9 min
7<0.01AT3G60750.2Transketolase (AT3G60750.2)101468.56091402.660931402.6841-0.0232063.46ANSYSVHGAALGEKCID Cmpd 61, +MSn(468.5609), 12.0 min
7<0.01AT3G60750.2Transketolase (AT3G60750.2)101724.87491447.735221447.7559-0.0206070.74EFGITVEAVVDAAKCID Cmpd 339, +MSn(724.8749), 21.1 min
7<0.01AT3G60750.2Transketolase (AT3G60750.2)101495.59881483.774731483.7976-0.0229032.06FEALGWHVIWVKCID Cmpd 348, +MSn(495.5988), 21.3 min
7<0.01AT3G60750.2Transketolase (AT3G60750.2)101788.37661574.738621574.7576-0.0190032.25ALPTYTPESPGDATRCID Cmpd 150, +MSn(788.3766), 14.9 min
7<0.01AT3G60750.2Transketolase (AT3G60750.2)101543.58271627.726231627.7478-0.0216062.02HTPEGATLESDWSAKCID Cmpd 141, +MSn(543.5827), 14.6 min
7<0.01AT3G60750.2Transketolase (AT3G60750.2)101578.31291731.916731731.9519-0.0352163.50QKLPHLPGTSIEGVEKCID Cmpd 155, +MSn(578.3129), 15.0 min
7<0.01AT3G60750.2Transketolase (AT3G60750.2)101903.48161804.948721804.9723-0.0236067.14SIGINSFGASAPAPLLYKCID Cmpd 323, +MSn(903.4816), 20.5 min
7<0.01AT3G60750.2Transketolase (AT3G60750.2)1011009.47522016.935922016.9581-0.0223025.52NNLGWPYEPFQVPDDVKCID Cmpd 358, +MSn(1009.4752), 21.6 min
7<0.01AT3G60750.2Transketolase (AT3G60750.2)1011039.03872076.062922076.0925-0.0296018.38VVPGFLGGSADLASSNMTLLKCID Cmpd 368, +MSn(1039.0387), 22.0 min
7<0.01AT3G60750.2Transketolase (AT3G60750.2)101697.00472087.992232088.0236-0.0313160.65ANSYSVHGAALGEKEVEATRCID Cmpd 99, +MSn(697.0047), 13.3 min
7<0.01AT3G60750.2Transketolase (AT3G60750.2)101757.67992270.017832270.0460-0.0282018.54AMPNTLMFRPADGNETAGAYKOxidation (M)0.020000000000000000000.0CID Cmpd 183, +MSn(757.6799), 15.9 min
7<0.01AT3G60750.2Transketolase (AT3G60750.2)101635.54082538.134142538.1640-0.0299021.12SGHPGLPMGCAPMAHILYDEVMRCID Cmpd 340, +MSn(635.5408), 21.1 min
7<0.01AT3G60750.2Transketolase (AT3G60750.2)101668.56482670.230242670.2615-0.0314120.45NNLGWPYEPFQVPDDVKSHWSRCID Cmpd 317, +MSn(668.5648), 20.3 min
7<0.01AT3G60750.2Transketolase (AT3G60750.2)101944.47613773.875543773.9323-0.0568125.64GGYTISDDSSGNKPDVILIGTGSELEIAAQAAEVLRKCID Cmpd 390, +MSn(944.4761), 23.1 min
7<0.01AT5G65620.1Zincin-like metalloproteases family protein (AT5G6111400.7393799.46412799.4803-0.0163020.87LVEAQIKCID Cmpd 55, +MSn(400.7393), 11.9 min
7<0.01AT5G65620.1Zincin-like metalloproteases family protein (AT5G6111414.2398826.46512826.4800-0.0149051.97LVEPLEKCID Cmpd 96, +MSn(414.2398), 13.2 min
7<0.01AT5G65620.1Zincin-like metalloproteases family protein (AT5G6111472.2743942.53402942.5498-0.0158021.94NTILALGGGKCID Cmpd 181, +MSn(472.2743), 15.9 min
7<0.01AT5G65620.1Zincin-like metalloproteases family protein (AT5G6111529.27871056.542921056.5564-0.0135079.80QDEGLVAGIRCID Cmpd 160, +MSn(529.2787), 15.2 min
7<0.01AT5G65620.1Zincin-like metalloproteases family protein (AT5G6111540.78111079.547621079.5685-0.0209043.50VMDGLFSLAKCID Cmpd 315, +MSn(540.7811), 20.3 min
7<0.01AT5G65620.1Zincin-like metalloproteases family protein (AT5G6111562.27851122.542521122.5557-0.0132043.11FSENVLDATKCID Cmpd 168, +MSn(562.2785), 15.5 min
7<0.01AT5G65620.1Zincin-like metalloproteases family protein (AT5G6111632.84431263.674121263.6823-0.0081048.43TQVIPPLPEDRCID Cmpd 197, +MSn(632.8444), 16.4 min
7<0.01AT5G65620.1Zincin-like metalloproteases family protein (AT5G6111887.45351772.892521772.9156-0.0230047.57ASSGDLDNTAIIDQILKCID Cmpd 362, +MSn(887.4536), 21.8 min
7<0.01AT5G65620.1Zincin-like metalloproteases family protein (AT5G6111442.90581325.695431325.7191-0.0236146.59AAIEDVQPEKVKCID Cmpd 66, +MSn(442.9058), 12.2 min
7<0.01AT5G65620.1Zincin-like metalloproteases family protein (AT5G6111455.91541364.724431364.7452-0.0208039.38LGQSKPIYNAFKCID Cmpd 136, +MSn(455.9154), 14.4 min
7<0.01AT5G65620.1Zincin-like metalloproteases family protein (AT5G6111608.29061821.849931821.8785-0.0286137.23HYETGETLPEEVYKKCID Cmpd 109, +MSn(608.2906), 13.6 min
7<0.01AT5G36210.1Alpha/beta-Hydrolases superfamily protein (AT5G362111503.21881004.423121004.4420-0.0189060.88VCVAGCDPKCID Cmpd 10, +MSn(503.2188), 10.3 min
7<0.01AT5G36210.1Alpha/beta-Hydrolases superfamily protein (AT5G362111525.25241048.490321048.5077-0.0174030.03YVESPTEPKCID Cmpd 20, +MSn(525.2524), 10.7 min
7<0.01AT5G36210.1Alpha/beta-Hydrolases superfamily protein (AT5G362111582.80761163.600721163.6186-0.0179050.19AGASLYGVADLKCID Cmpd 220, +MSn(582.8076), 17.1 min
7<0.01AT5G36210.1Alpha/beta-Hydrolases superfamily protein (AT5G362111742.86871483.722921483.7460-0.0230017.61VLVSGNDFYAFPRCID Cmpd 297, +MSn(742.8688), 19.7 min
7<0.01AT5G36210.1Alpha/beta-Hydrolases superfamily protein (AT5G362111859.44251716.870421716.8934-0.0230053.99ALSSEIVWSSSPDVLKCID Cmpd 300, +MSn(859.4424), 19.8 min
7<0.01AT5G36210.1Alpha/beta-Hydrolases superfamily protein (AT5G362111625.95731874.850031874.8686-0.0186143.76YIDNLVGDEKDFYERCID Cmpd 237, +MSn(625.9573), 17.6 min
7<0.01AT5G36210.1Alpha/beta-Hydrolases superfamily protein (AT5G362111634.31391899.920031899.9479-0.0279033.00GLPVALVEYEGEQHGFRCID Cmpd 296, +MSn(634.3140), 19.7 min
7<0.01AT4G09020.1ATISA3, ISA3, isoamylase 3 111540.77061079.526621079.5434-0.0167027.11FDLASVLCRCID Cmpd 342, +MSn(540.7706), 21.1 min
7<0.01AT4G09020.1ATISA3, ISA3, isoamylase 3 111697.87761393.740621393.7565-0.0159045.97ATDGSPLSAPPLIRCID Cmpd 240, +MSn(697.8776), 17.7 min
7<0.01AT4G09020.1ATISA3, ISA3, isoamylase 3 111441.54871321.624331321.6514-0.0270121.20YASGEGDPIKASKCID Cmpd 15, +MSn(441.5487), 10.5 min
7<0.01AT4G09020.1ATISA3, ISA3, isoamylase 3 111468.57931402.716031402.7357-0.0198030.75FLAFTLHDGIGGRCID Cmpd 270, +MSn(468.5793), 18.9 min
8<0.05AT5G60600.1GCPE, ISPG, CSB3, CLB4, HDS, 4-hydroxy-3-methylbut111807.4512806.44391806.4538-0.0099029.62IDLYVGKCID Cmpd 165, +MSn(807.4512), 15.4 min
8<0.05AT5G60600.1GCPE, ISPG, CSB3, CLB4, HDS, 4-hydroxy-3-methylbut1111027.46211026.454811026.4658-0.0110036.74WVDPPVADECID Cmpd 212, +MSn(1027.4622), 16.9 min
8<0.05AT5G60600.1GCPE, ISPG, CSB3, CLB4, HDS, 4-hydroxy-3-methylbut111429.2310856.44752856.4654-0.0179044.14TGDLPVQKCID Cmpd 24, +MSn(429.2310), 10.9 min
8<0.05AT5G60600.1GCPE, ISPG, CSB3, CLB4, HDS, 4-hydroxy-3-methylbut111431.2387860.46282860.4756-0.0127042.63APELLYRCID Cmpd 157, +MSn(431.2387), 15.1 min
8<0.05AT5G60600.1GCPE, ISPG, CSB3, CLB4, HDS, 4-hydroxy-3-methylbut111495.2353988.45612988.4726-0.0166056.18VNPGNFADRCID Cmpd 81, +MSn(495.2353), 12.7 min
8<0.05AT5G60600.1GCPE, ISPG, CSB3, CLB4, HDS, 4-hydroxy-3-methylbut111498.7086995.40262995.4196-0.0170067.24EGEEVDYRCID Cmpd 33, +MSn(498.7086), 11.2 min
8<0.05AT5G60600.1GCPE, ISPG, CSB3, CLB4, HDS, 4-hydroxy-3-methylbut111506.72851011.442521011.4563-0.0138030.00HYFDFQRCID Cmpd 153, +MSn(506.7285), 15.0 min
8<0.05AT5G60600.1GCPE, ISPG, CSB3, CLB4, HDS, 4-hydroxy-3-methylbut111529.29201056.569321056.5927-0.0234179.31IADKGADIVRCID Cmpd 22, +MSn(529.2919), 10.8 min
8<0.05AT5G60600.1GCPE, ISPG, CSB3, CLB4, HDS, 4-hydroxy-3-methylbut111563.26751124.520421124.5383-0.0179059.91IQTMTTSDTKCID Cmpd 14, +MSn(563.2675), 10.2 min
8<0.05AT5G60600.1GCPE, ISPG, CSB3, CLB4, HDS, 4-hydroxy-3-methylbut111569.27931136.543921136.5648-0.0209143.37VAECFDKIRCID Cmpd 92, +MSn(569.2792), 13.1 min
8<0.05AT5G60600.1GCPE, ISPG, CSB3, CLB4, HDS, 4-hydroxy-3-methylbut111573.28421144.553821144.5737-0.0200119.77VNPGNFADRRCID Cmpd 48, +MSn(573.2842), 11.6 min
8<0.05AT5G60600.1GCPE, ISPG, CSB3, CLB4, HDS, 4-hydroxy-3-methylbut111578.77651155.538521155.5632-0.0247034.51IGTNHGSLSDRCID Cmpd 5, +MSn(578.7766), 9.4 min
8<0.05AT5G60600.1GCPE, ISPG, CSB3, CLB4, HDS, 4-hydroxy-3-methylbut111602.76141203.508221203.5230-0.0148077.73IMSYYGDSPROxidation (M)0.0200000000.0CID Cmpd 82, +MSn(602.7614), 12.7 min
8<0.05AT5G60600.1GCPE, ISPG, CSB3, CLB4, HDS, 4-hydroxy-3-methylbut111608.34201214.669521214.6870-0.0175046.46DLATVDSILLRCID Cmpd 356, +MSn(608.3420), 21.8 min
8<0.05AT5G60600.1GCPE, ISPG, CSB3, CLB4, HDS, 4-hydroxy-3-methylbut111618.29441234.574321234.5864-0.0120062.89DITGTVDEVMRCID Cmpd 259, +MSn(618.2944), 18.4 min
8<0.05AT5G60600.1GCPE, ISPG, CSB3, CLB4, HDS, 4-hydroxy-3-methylbut111619.81501237.615521237.6303-0.0148057.99ELPPVDDQVARCID Cmpd 119, +MSn(619.8150), 13.9 min
8<0.05AT5G60600.1GCPE, ISPG, CSB3, CLB4, HDS, 4-hydroxy-3-methylbut111622.28441242.554121242.5703-0.0161076.20GMVESAFEFARCID Cmpd 281, +MSn(622.2844), 19.3 min
8<0.05AT5G60600.1GCPE, ISPG, CSB3, CLB4, HDS, 4-hydroxy-3-methylbut111623.32071244.626921244.6401-0.0131061.95LQQGVAPFEEKCID Cmpd 143, +MSn(623.3207), 14.7 min
8<0.05AT5G60600.1GCPE, ISPG, CSB3, CLB4, HDS, 4-hydroxy-3-methylbut111655.31201308.609521308.6245-0.0150069.63NTSFNLLQGCRCID Cmpd 233, +MSn(655.3120), 17.5 min
8<0.05AT5G60600.1GCPE, ISPG, CSB3, CLB4, HDS, 4-hydroxy-3-methylbut111658.26681314.519121314.5333-0.0142060.78TEYVSCPSCGRCID Cmpd 43, +MSn(658.2668), 11.5 min
8<0.05AT5G60600.1GCPE, ISPG, CSB3, CLB4, HDS, 4-hydroxy-3-methylbut111682.84481363.675021363.6918-0.0168034.33ASNPVIMVQAYROxidation (M)0.000000200000.0CID Cmpd 172, +MSn(682.8448), 15.6 min
8<0.05AT5G60600.1GCPE, ISPG, CSB3, CLB4, HDS, 4-hydroxy-3-methylbut111753.39141504.768221504.7807-0.0125028.66DGSVLMSISLDQLKCID Cmpd 362, +MSn(753.3914), 22.0 min
8<0.05AT5G60600.1GCPE, ISPG, CSB3, CLB4, HDS, 4-hydroxy-3-methylbut111767.90051533.786521533.8038-0.01730104.68TLFDLQEISAEIRCID Cmpd 377, +MSn(767.9006), 22.7 min
8<0.05AT5G60600.1GCPE, ISPG, CSB3, CLB4, HDS, 4-hydroxy-3-methylbut111808.93581615.857121615.8855-0.0284043.87GIAMTEATDALIGLIKCID Cmpd 395, +MSn(808.9358), 24.2 min
8<0.05AT5G60600.1GCPE, ISPG, CSB3, CLB4, HDS, 4-hydroxy-3-methylbut111900.48511798.955721798.9789-0.02320126.11SAIGIGTLLQDGLGDTIRCID Cmpd 385, +MSn(900.4851), 23.2 min
8<0.05AT5G60600.1GCPE, ISPG, CSB3, CLB4, HDS, 4-hydroxy-3-methylbut111467.55811399.652631399.6595-0.0069032.76LDYHNFVFSMKCID Cmpd 290, +MSn(467.5581), 19.5 min
8<0.05AT5G60600.1GCPE, ISPG, CSB3, CLB4, HDS, 4-hydroxy-3-methylbut111510.25121527.731931527.7544-0.0225151.72KLDYHNFVFSMKCID Cmpd 250, +MSn(510.2512), 18.2 min
8<0.05AT5G60600.1GCPE, ISPG, CSB3, CLB4, HDS, 4-hydroxy-3-methylbut111560.62651678.857731678.8825-0.0247071.18TVMVGNVALGSEHPIRCID Cmpd 187, +MSn(560.6265), 16.1 min
8<0.05AT5G60600.1GCPE, ISPG, CSB3, CLB4, HDS, 4-hydroxy-3-methylbut111597.98041790.919331790.9414-0.0221166.44TLFDLQEISAEIREKCID Cmpd 348, +MSn(597.9803), 21.5 min
8<0.05AT5G60600.1GCPE, ISPG, CSB3, CLB4, HDS, 4-hydroxy-3-methylbut111612.29101833.851231833.8745-0.0233171.09TGDLPVQKEGEEVDYRCID Cmpd 115, +MSn(612.2910), 13.8 min
8<0.05AT5G60600.1GCPE, ISPG, CSB3, CLB4, HDS, 4-hydroxy-3-methylbut111642.97191925.894031925.9153-0.0212127.82VSLTEPPEEEIDPCRRCID Cmpd 176, +MSn(642.9719), 15.7 min
8<0.05AT5G60600.1GCPE, ISPG, CSB3, CLB4, HDS, 4-hydroxy-3-methylbut111653.64781957.921631957.9455-0.0240020.08NIDATMILHDVPFTEDKCID Cmpd 331, +MSn(653.6478), 20.9 min
8<0.05AT5G60600.1GCPE, ISPG, CSB3, CLB4, HDS, 4-hydroxy-3-methylbut111701.72412102.150532102.1810-0.0305159.56LVVGMPFKDLATVDSILLROxidation (M)0.0000200000000000000.0CID Cmpd 390, +MSn(701.7241), 23.3 min
8<0.05AT5G60600.1GCPE, ISPG, CSB3, CLB4, HDS, 4-hydroxy-3-methylbut111781.37042341.089332341.1142-0.0248135.81IQTMTTSDTKDITGTVDEVMRCID Cmpd 261, +MSn(781.3704), 18.5 min
8<0.05AT5G60600.1GCPE, ISPG, CSB3, CLB4, HDS, 4-hydroxy-3-methylbut111524.77742095.080642095.1095-0.0290154.03GIAMTEATDALIGLIKEHGRCID Cmpd 378, +MSn(524.7774), 22.7 min
8<0.05AT5G60600.1GCPE, ISPG, CSB3, CLB4, HDS, 4-hydroxy-3-methylbut111576.03682300.118242300.1471-0.0289119.02NIDATMILHDVPFTEDKVSRCID Cmpd 306, +MSn(576.0368), 20.1 min
8<0.05AT3G60750.1Transketolase (AT3G60750.1)111406.6947811.37492811.3865-0.0116031.07AFGDFQKCID Cmpd 126, +MSn(406.6947), 14.1 min
8<0.05AT3G60750.1Transketolase (AT3G60750.1)111479.2835956.55242956.5655-0.0130043.89TPSILALSRCID Cmpd 230, +MSn(479.2835), 17.4 min
8<0.05AT3G60750.1Transketolase (AT3G60750.1)111498.7312995.44782995.4613-0.0135030.93NPYWFNRCID Cmpd 220, +MSn(498.7312), 17.1 min
8<0.05AT3G60750.1Transketolase (AT3G60750.1)111503.27681004.539021004.5542-0.0152049.43FLAIDAVEKCID Cmpd 221, +MSn(503.2768), 17.1 min
8<0.05AT3G60750.1Transketolase (AT3G60750.1)111533.24981064.485021064.5026-0.0175056.32YPEEASELKCID Cmpd 86, +MSn(533.2498), 12.9 min
8<0.05AT3G60750.1Transketolase (AT3G60750.1)111543.32861084.642621084.6604-0.0178174.45KTPSILALSRCID Cmpd 166, +MSn(543.3286), 15.4 min
8<0.05AT3G60750.1Transketolase (AT3G60750.1)111558.32541114.636221114.6598-0.0235060.36TVTDKPTLIKCID Cmpd 57, +MSn(558.3254), 12.0 min
8<0.05AT3G60750.1Transketolase (AT3G60750.1)111569.75261137.490521137.5051-0.0145070.33NGNTGYDEIRCID Cmpd 63, +MSn(569.7526), 12.2 min
8<0.05AT3G60750.1Transketolase (AT3G60750.1)111580.29361158.572721158.5881-0.0153062.29ESVLPSDVSARCID Cmpd 131, +MSn(580.2936), 14.3 min
8<0.05AT3G60750.1Transketolase (AT3G60750.1)111597.29471192.574721192.5975-0.0228136.00KYPEEASELKCID Cmpd 42, +MSn(597.2947), 11.5 min
8<0.05AT3G60750.1Transketolase (AT3G60750.1)111619.31571236.616921236.6350-0.0181079.93VTTTIGYGSPNKCID Cmpd 76, +MSn(619.3157), 12.5 min
8<0.05AT3G60750.1Transketolase (AT3G60750.1)111676.83811351.661721351.6772-0.01550100.93VSIEAASTFGWGKCID Cmpd 273, +MSn(676.8381), 19.0 min
8<0.05AT3G60750.1Transketolase (AT3G60750.1)111680.34911358.683721358.6976-0.0139076.62NLSQQCLNALAKCID Cmpd 175, +MSn(680.3491), 15.7 min
8<0.05AT3G60750.1Transketolase (AT3G60750.1)111700.86541399.716321399.7347-0.0184062.66SIITGELPAGWEKCID Cmpd 269, +MSn(700.8654), 18.9 min
8<0.05AT3G60750.1Transketolase (AT3G60750.1)111724.87561447.736621447.7559-0.0193064.55EFGITVEAVVDAAKCID Cmpd 336, +MSn(724.8755), 21.1 min
8<0.05AT3G60750.1Transketolase (AT3G60750.1)111742.89601483.777521483.7976-0.0201025.78FEALGWHVIWVKCID Cmpd 347, +MSn(742.8960), 21.5 min
8<0.05AT3G60750.1Transketolase (AT3G60750.1)111903.48191804.949121804.9723-0.0232082.41SIGINSFGASAPAPLLYKCID Cmpd 315, +MSn(903.4819), 20.4 min
8<0.05AT3G60750.1Transketolase (AT3G60750.1)111423.19751266.570831266.5894-0.0186119.49NPYWFNRDRCID Cmpd 159, +MSn(423.1975), 15.2 min
8<0.05AT3G60750.1Transketolase (AT3G60750.1)111468.55561402.644931402.6841-0.0392065.53ANSYSVHGAALGEKCID Cmpd 71, +MSn(468.5556), 12.4 min
8<0.05AT3G60750.1Transketolase (AT3G60750.1)111492.93201475.774331475.7984-0.0241048.23LPHLPGTSIEGVEKCID Cmpd 191, +MSn(492.9320), 16.2 min
8<0.05AT3G60750.1Transketolase (AT3G60750.1)111525.92071574.740331574.7576-0.0173057.13ALPTYTPESPGDATRCID Cmpd 146, +MSn(525.9207), 14.8 min
8<0.05AT3G60750.1Transketolase (AT3G60750.1)111543.58331627.728131627.7478-0.0197052.03HTPEGATLESDWSAKCID Cmpd 142, +MSn(543.5833), 14.7 min
8<0.05AT3G60750.1Transketolase (AT3G60750.1)111578.31631731.927231731.9519-0.0247164.74QKLPHLPGTSIEGVEKCID Cmpd 152, +MSn(578.3163), 15.0 min
8<0.05AT3G60750.1Transketolase (AT3G60750.1)111673.31952016.936632016.9581-0.0215050.47NNLGWPYEPFQVPDDVKCID Cmpd 355, +MSn(673.3195), 21.8 min
8<0.05AT3G60750.1Transketolase (AT3G60750.1)111693.02972076.067232076.0925-0.0253041.68VVPGFLGGSADLASSNMTLLKCID Cmpd 363, +MSn(693.0297), 22.0 min
8<0.05AT3G60750.1Transketolase (AT3G60750.1)111697.00372087.989332088.0236-0.0343151.53ANSYSVHGAALGEKEVEATRCID Cmpd 100, +MSn(697.0037), 13.3 min
8<0.05AT3G60750.1Transketolase (AT3G60750.1)111752.34992254.028032254.0510-0.0231017.14AMPNTLMFRPADGNETAGAYKCID Cmpd 222, +MSn(752.3499), 17.1 min
8<0.05AT3G60750.1Transketolase (AT3G60750.1)111584.32082333.254342333.2842-0.0299151.96TVTDKPTLIKVTTTIGYGSPNKCID Cmpd 190, +MSn(584.3209), 16.2 min
8<0.05AT3G60750.1Transketolase (AT3G60750.1)111635.53802538.123142538.1640-0.0409030.70SGHPGLPMGCAPMAHILYDEVMRCID Cmpd 335, +MSn(635.5380), 21.1 min
8<0.05AT3G60750.2Transketolase (AT3G60750.2)101406.6947811.37492811.3865-0.0116031.07AFGDFQKCID Cmpd 126, +MSn(406.6947), 14.1 min
8<0.05AT3G60750.2Transketolase (AT3G60750.2)101479.2835956.55242956.5655-0.0130043.89TPSILALSRCID Cmpd 230, +MSn(479.2835), 17.4 min
8<0.05AT3G60750.2Transketolase (AT3G60750.2)101498.7312995.44782995.4613-0.0135030.93NPYWFNRCID Cmpd 220, +MSn(498.7312), 17.1 min
8<0.05AT3G60750.2Transketolase (AT3G60750.2)101503.27681004.539021004.5542-0.0152049.43FLAIDAVEKCID Cmpd 221, +MSn(503.2768), 17.1 min
8<0.05AT3G60750.2Transketolase (AT3G60750.2)101533.24981064.485021064.5026-0.0175056.32YPEEASELKCID Cmpd 86, +MSn(533.2498), 12.9 min
8<0.05AT3G60750.2Transketolase (AT3G60750.2)101543.32861084.642621084.6604-0.0178174.45KTPSILALSRCID Cmpd 166, +MSn(543.3286), 15.4 min
8<0.05AT3G60750.2Transketolase (AT3G60750.2)101558.32541114.636221114.6598-0.0235060.36TVTDKPTLIKCID Cmpd 57, +MSn(558.3254), 12.0 min
8<0.05AT3G60750.2Transketolase (AT3G60750.2)101569.75261137.490521137.5051-0.0145070.33NGNTGYDEIRCID Cmpd 63, +MSn(569.7526), 12.2 min
8<0.05AT3G60750.2Transketolase (AT3G60750.2)101580.29361158.572721158.5881-0.0153062.29ESVLPSDVSARCID Cmpd 131, +MSn(580.2936), 14.3 min
8<0.05AT3G60750.2Transketolase (AT3G60750.2)101597.29471192.574721192.5975-0.0228136.00KYPEEASELKCID Cmpd 42, +MSn(597.2947), 11.5 min
8<0.05AT3G60750.2Transketolase (AT3G60750.2)101619.31571236.616921236.6350-0.0181079.93VTTTIGYGSPNKCID Cmpd 76, +MSn(619.3157), 12.5 min
8<0.05AT3G60750.2Transketolase (AT3G60750.2)101423.19751266.570831266.5894-0.0186119.49NPYWFNRDRCID Cmpd 159, +MSn(423.1975), 15.2 min
8<0.05AT3G60750.2Transketolase (AT3G60750.2)101676.83811351.661721351.6772-0.01550100.93VSIEAASTFGWGKCID Cmpd 273, +MSn(676.8381), 19.0 min
8<0.05AT3G60750.2Transketolase (AT3G60750.2)101680.34911358.683721358.6976-0.0139076.62NLSQQCLNALAKCID Cmpd 175, +MSn(680.3491), 15.7 min
8<0.05AT3G60750.2Transketolase (AT3G60750.2)101700.86541399.716321399.7347-0.0184062.66SIITGELPAGWEKCID Cmpd 269, +MSn(700.8654), 18.9 min
8<0.05AT3G60750.2Transketolase (AT3G60750.2)101468.55561402.644931402.6841-0.0392065.53ANSYSVHGAALGEKCID Cmpd 71, +MSn(468.5556), 12.4 min
8<0.05AT3G60750.2Transketolase (AT3G60750.2)101724.87561447.736621447.7559-0.0193064.55EFGITVEAVVDAAKCID Cmpd 336, +MSn(724.8755), 21.1 min
8<0.05AT3G60750.2Transketolase (AT3G60750.2)101492.93201475.774331475.7984-0.0241048.23LPHLPGTSIEGVEKCID Cmpd 191, +MSn(492.9320), 16.2 min
8<0.05AT3G60750.2Transketolase (AT3G60750.2)101742.89601483.777521483.7976-0.0201025.78FEALGWHVIWVKCID Cmpd 347, +MSn(742.8960), 21.5 min
8<0.05AT3G60750.2Transketolase (AT3G60750.2)101525.92071574.740331574.7576-0.0173057.13ALPTYTPESPGDATRCID Cmpd 146, +MSn(525.9207), 14.8 min
8<0.05AT3G60750.2Transketolase (AT3G60750.2)101543.58331627.728131627.7478-0.0197052.03HTPEGATLESDWSAKCID Cmpd 142, +MSn(543.5833), 14.7 min
8<0.05AT3G60750.2Transketolase (AT3G60750.2)101578.31631731.927231731.9519-0.0247164.74QKLPHLPGTSIEGVEKCID Cmpd 152, +MSn(578.3163), 15.0 min
8<0.05AT3G60750.2Transketolase (AT3G60750.2)101903.48191804.949121804.9723-0.0232082.41SIGINSFGASAPAPLLYKCID Cmpd 315, +MSn(903.4819), 20.4 min
8<0.05AT3G60750.2Transketolase (AT3G60750.2)101673.31952016.936632016.9581-0.0215050.47NNLGWPYEPFQVPDDVKCID Cmpd 355, +MSn(673.3195), 21.8 min
8<0.05AT3G60750.2Transketolase (AT3G60750.2)101693.02972076.067232076.0925-0.0253041.68VVPGFLGGSADLASSNMTLLKCID Cmpd 363, +MSn(693.0297), 22.0 min
8<0.05AT3G60750.2Transketolase (AT3G60750.2)101697.00372087.989332088.0236-0.0343151.53ANSYSVHGAALGEKEVEATRCID Cmpd 100, +MSn(697.0037), 13.3 min
8<0.05AT3G60750.2Transketolase (AT3G60750.2)101752.34992254.028032254.0510-0.0231017.14AMPNTLMFRPADGNETAGAYKCID Cmpd 222, +MSn(752.3499), 17.1 min
8<0.05AT3G60750.2Transketolase (AT3G60750.2)101584.32082333.254342333.2842-0.0299151.96TVTDKPTLIKVTTTIGYGSPNKCID Cmpd 190, +MSn(584.3209), 16.2 min
8<0.05AT3G60750.2Transketolase (AT3G60750.2)101635.53802538.123142538.1640-0.0409030.70SGHPGLPMGCAPMAHILYDEVMRCID Cmpd 335, +MSn(635.5380), 21.1 min
8<0.05AT5G65620.1Zincin-like metalloproteases family protein (AT5G6111529.27991056.545221056.5564-0.0111051.12QDEGLVAGIRCID Cmpd 158, +MSn(529.2799), 15.2 min
8<0.05AT5G65620.1Zincin-like metalloproteases family protein (AT5G6111540.78301079.551421079.5685-0.0171024.56VMDGLFSLAKCID Cmpd 313, +MSn(540.7830), 20.3 min
8<0.05AT5G65620.1Zincin-like metalloproteases family protein (AT5G6111682.31041362.606321362.60510.0012051.09ESPDWSSLSEARCID Cmpd 200, +MSn(682.3104), 16.5 min
8<0.05AT5G65620.1Zincin-like metalloproteases family protein (AT5G6111442.90481325.692531325.7191-0.0265128.96AAIEDVQPEKVKCID Cmpd 64, +MSn(442.9048), 12.2 min
8<0.05AT5G65620.1Zincin-like metalloproteases family protein (AT5G6110400.7400799.46552799.4803-0.0148019.84LVEAQIKCID Cmpd 53, +MSn(400.7400), 11.8 min
8<0.05AT5G65620.1Zincin-like metalloproteases family protein (AT5G6110414.2384826.46232826.4800-0.0177043.46LVEPLEKCID Cmpd 96, +MSn(414.2384), 13.2 min
8<0.05AT5G65620.1Zincin-like metalloproteases family protein (AT5G6110472.2745942.53442942.5498-0.0154019.11NTILALGGGKCID Cmpd 180, +MSn(472.2745), 15.8 min
8<0.05AT5G65620.1Zincin-like metalloproteases family protein (AT5G6110562.27891122.543221122.5557-0.0125039.70FSENVLDATKCID Cmpd 167, +MSn(562.2789), 15.4 min
8<0.05AT5G65620.1Zincin-like metalloproteases family protein (AT5G6110632.84241263.670221263.6823-0.0121054.71TQVIPPLPEDRCID Cmpd 196, +MSn(632.8423), 16.4 min
8<0.05AT5G65620.1Zincin-like metalloproteases family protein (AT5G6110455.91431364.721231364.7452-0.0240032.04LGQSKPIYNAFKCID Cmpd 137, +MSn(455.9143), 14.5 min
8<0.05AT5G65620.1Zincin-like metalloproteases family protein (AT5G6110887.45641772.898321772.9156-0.0173041.73ASSGDLDNTAIIDQILKCID Cmpd 357, +MSn(887.4564), 21.8 min
8<0.05AT5G10540.1Zincin-like metalloproteases family protein (AT5G1100400.7400799.46552799.4803-0.0148019.84LVEAQIKCID Cmpd 53, +MSn(400.7400), 11.8 min
8<0.05AT5G10540.1Zincin-like metalloproteases family protein (AT5G1100414.2384826.46232826.4800-0.0177043.46LVEPLEKCID Cmpd 96, +MSn(414.2384), 13.2 min
8<0.05AT5G10540.1Zincin-like metalloproteases family protein (AT5G1100472.2745942.53442942.5498-0.0154019.11NTILALGGGKCID Cmpd 180, +MSn(472.2745), 15.8 min
8<0.05AT5G10540.1Zincin-like metalloproteases family protein (AT5G1100562.27891122.543221122.5557-0.0125039.70FSENVLDATKCID Cmpd 167, +MSn(562.2789), 15.4 min
8<0.05AT5G10540.1Zincin-like metalloproteases family protein (AT5G1100632.84241263.670221263.6823-0.0121054.71TQVIPPLPEDRCID Cmpd 196, +MSn(632.8423), 16.4 min
8<0.05AT5G10540.1Zincin-like metalloproteases family protein (AT5G1100455.91431364.721231364.7452-0.0240032.04LGQSKPIYNAFKCID Cmpd 137, +MSn(455.9143), 14.5 min
8<0.05AT5G10540.1Zincin-like metalloproteases family protein (AT5G1100887.45641772.898321772.9156-0.0173041.73ASSGDLDNTAIIDQILKCID Cmpd 357, +MSn(887.4564), 21.8 min
8<0.05AT5G10540.1Zincin-like metalloproteases family protein (AT5G1111530.29231058.570121057.54041.0298068.24EDEGLVAGIRCID Cmpd 156, +MSn(530.2924), 15.1 min
9<0.01AT5G66570.1PsbO-1, OEE1, OEE33, OE33, MSP-1110850.4209849.41371849.4232-0.0096031.79GSSFLDPKCID Cmpd 138, +MSn(850.4210), 14.3 min
9<0.01AT5G66570.1PsbO-1, OEE1, OEE33, OE33, MSP-1110441.2408880.46702880.4807-0.0137052.89FLVPSYRCID Cmpd 211, +MSn(441.2408), 16.7 min
9<0.01AT5G66570.1PsbO-1, OEE1, OEE33, OE33, MSP-1110475.7837949.55292949.5637-0.0108052.50VPFLFTVKCID Cmpd 336, +MSn(475.7838), 20.6 min
9<0.01AT5G66570.1PsbO-1, OEE1, OEE33, OE33, MSP-1110548.77461095.534621095.5448-0.0102055.25LTYDEIQSKCID Cmpd 115, +MSn(548.7745), 13.7 min
9<0.01AT5G66570.1PsbO-1, OEE1, OEE33, OE33, MSP-1110602.32681202.639121202.6507-0.0115064.75NTAASVGEITLKCID Cmpd 172, +MSn(602.3268), 15.4 min
9<0.01AT5G66570.1PsbO-1, OEE1, OEE33, OE33, MSP-1110418.21831251.633131251.6459-0.0128156.21RLTYDEIQSKCID Cmpd 79, +MSn(418.2183), 12.5 min
9<0.01AT5G66570.1PsbO-1, OEE1, OEE33, OE33, MSP-1110681.81971361.624721361.6326-0.0079028.55FCFEPTSFTVKCID Cmpd 309, +MSn(681.8196), 19.8 min
9<0.01AT5G66570.1PsbO-1, OEE1, OEE33, OE33, MSP-1110745.86431489.714021489.7276-0.0135142.10KFCFEPTSFTVKCID Cmpd 258, +MSn(745.8643), 18.1 min
9<0.01AT5G66570.1PsbO-1, OEE1, OEE33, OE33, MSP-1110781.87681561.739121561.7485-0.0093075.24GGSTGYDNAVALPAGGRCID Cmpd 155, +MSn(781.8768), 14.9 min
9<0.01AT5G66570.1PsbO-1, OEE1, OEE33, OE33, MSP-1110868.76802603.282232603.2966-0.0145069.00SKPETGEVIGVFESLQPSDTDLGAKCID Cmpd 340, +MSn(868.7680), 20.7 min
9<0.01AT5G66570.1PsbO-1, OEE1, OEE33, OE33, MSP-11111192.58881191.581511191.5924-0.0109025.66IQGVWYGQLECID Cmpd 325, +MSn(1192.5889), 20.3 min
9<0.01AT5G66570.1PsbO-1, OEE1, OEE33, OE33, MSP-1111459.7196917.42462917.4342-0.0095053.97GDEEELVKCID Cmpd 60, +MSn(459.7196), 11.9 min
9<0.01AT5G66570.1PsbO-1, OEE1, OEE33, OE33, MSP-1111573.27841144.542221144.5513-0.0091052.75NAPPEFQNTKCID Cmpd 50, +MSn(573.2784), 11.6 min
9<0.01AT5G66570.1PsbO-1, OEE1, OEE33, OE33, MSP-1111463.56221387.664831387.6831-0.0183149.65GDEEELVKENVKCID Cmpd 107, +MSn(463.5622), 13.4 min
9<0.01AT5G66570.1PsbO-1, OEE1, OEE33, OE33, MSP-1111484.23801449.692131449.7100-0.0178062.81QLDASGKPDSFTGKCID Cmpd 62, +MSn(484.2380), 12.0 min
9<0.01AT5G66570.1PsbO-1, OEE1, OEE33, OE33, MSP-1111819.71182456.113732456.1278-0.0141062.87GTGTANQCPTIDGGSETFSFKPGKCID Cmpd 204, +MSn(819.7119), 16.4 min
9<0.01AT3G50820.1PsbO-2, OEC33100850.4209849.41371849.4232-0.0096031.79GSSFLDPKCID Cmpd 138, +MSn(850.4210), 14.3 min
9<0.01AT3G50820.1PsbO-2, OEC33100441.2408880.46702880.4807-0.0137052.89FLVPSYRCID Cmpd 211, +MSn(441.2408), 16.7 min
9<0.01AT3G50820.1PsbO-2, OEC33100475.7837949.55292949.5637-0.0108052.50VPFLFTVKCID Cmpd 336, +MSn(475.7838), 20.6 min
9<0.01AT3G50820.1PsbO-2, OEC33100548.77461095.534621095.5448-0.0102055.25LTYDEIQSKCID Cmpd 115, +MSn(548.7745), 13.7 min
9<0.01AT3G50820.1PsbO-2, OEC331011192.58881191.581511191.5924-0.0109025.66IQGVWYGQIECID Cmpd 325, +MSn(1192.5889), 20.3 min
9<0.01AT3G50820.1PsbO-2, OEC33100602.32681202.639121202.6507-0.0115064.75NTAASVGEITLKCID Cmpd 172, +MSn(602.3268), 15.4 min
9<0.01AT3G50820.1PsbO-2, OEC33100418.21831251.633131251.6459-0.0128156.21RLTYDEIQSKCID Cmpd 79, +MSn(418.2183), 12.5 min
9<0.01AT3G50820.1PsbO-2, OEC33100681.81971361.624721361.6326-0.0079028.55FCFEPTSFTVKCID Cmpd 309, +MSn(681.8196), 19.8 min
9<0.01AT3G50820.1PsbO-2, OEC33100745.86431489.714021489.7276-0.0135142.10KFCFEPTSFTVKCID Cmpd 258, +MSn(745.8643), 18.1 min
9<0.01AT3G50820.1PsbO-2, OEC33100781.87681561.739121561.7485-0.0093075.24GGSTGYDNAVALPAGGRCID Cmpd 155, +MSn(781.8768), 14.9 min
9<0.01AT3G50820.1PsbO-2, OEC33100868.76802603.282232603.2966-0.0145069.00SKPETGEVIGVFESLQPSDTDLGAKCID Cmpd 340, +MSn(868.7680), 20.7 min
9<0.01AT3G50820.1PsbO-2, OEC33111566.26941130.524321130.5356-0.0113033.03NAPPDFQNTKCID Cmpd 52, +MSn(566.2695), 11.6 min
9<0.01AT3G50820.1PsbO-2, OEC33111459.55031375.629231375.6467-0.0174142.78GDEEELSKENVKCID Cmpd 28, +MSn(459.5504), 10.7 min
9<0.01AT3G50820.1PsbO-2, OEC33111488.90911463.705631463.7256-0.0200066.60QLEASGKPESFSGKCID Cmpd 46, +MSn(488.9091), 11.5 min
9<0.01AT3G50820.1PsbO-2, OEC33111765.37802293.112132293.1226-0.0105154.78FKEEDGIDYAAVTVQLPGGERCID Cmpd 273, +MSn(765.3780), 18.6 min
9<0.01AT4G09010.1APX4, TL29, ascorbate peroxidase 4 111413.2023824.39002824.4028-0.0128052.15FSSELSRCID Cmpd 63, +MSn(413.2023), 12.0 min
9<0.01AT4G09010.1APX4, TL29, ascorbate peroxidase 4 111444.7857887.55682887.5692-0.0124052.67ILLSTTIKCID Cmpd 194, +MSn(444.7857), 16.1 min
9<0.01AT4G09010.1APX4, TL29, ascorbate peroxidase 4 111465.2753928.53602928.5494-0.0134028.51FIAVGLGPRCID Cmpd 226, +MSn(465.2753), 17.1 min
9<0.01AT4G09010.1APX4, TL29, ascorbate peroxidase 4 111521.28351040.552521040.5655-0.0130036.67FTYLASAIRCID Cmpd 236, +MSn(521.2835), 17.4 min
9<0.01AT4G09010.1APX4, TL29, ascorbate peroxidase 4 111574.24061146.466721146.4789-0.0122073.11SDATEADPEGRCID Cmpd 4, +MSn(574.2406), 9.2 min
9<0.01AT4G09010.1APX4, TL29, ascorbate peroxidase 4 111627.79791253.581221253.5962-0.0149067.29LALNDAMTYDKCID Cmpd 208, +MSn(627.7979), 16.6 min
9<0.01AT4G09010.1APX4, TL29, ascorbate peroxidase 4 111944.50621886.997821887.0102-0.0123093.49GGPISYADIIQLAGQSAVKCID Cmpd 374, +MSn(944.5062), 22.4 min
9<0.01AT4G09010.1APX4, TL29, ascorbate peroxidase 4 111644.33141929.972531929.9895-0.0170167.17AENEGLSDGLSLIEEVKKCID Cmpd 313, +MSn(644.3314), 19.9 min
9<0.01AT4G04020.1FIB, fibrillin111406.7410811.46742811.4803-0.0129028.88IDLNPIKCID Cmpd 188, +MSn(406.7410), 15.9 min
9<0.01AT4G04020.1FIB, fibrillin111461.2294920.44432920.4563-0.0120055.06GLSVSSDTRCID Cmpd 36, +MSn(461.2294), 11.1 min
9<0.01AT4G04020.1FIB, fibrillin111581.77731161.540121161.5513-0.0112057.72AIESVEETERCID Cmpd 57, +MSn(581.7773), 11.8 min
9<0.01AT4G04020.1FIB, fibrillin111649.32981296.645121296.6562-0.0110088.41VFASSSTVSVADKCID Cmpd 112, +MSn(649.3298), 13.6 min
9<0.01AT4G04020.1FIB, fibrillin111730.88951459.764421459.7769-0.0125077.92AEISELITQLESKCID Cmpd 367, +MSn(730.8895), 22.1 min
9<0.01AT4G04020.1FIB, fibrillin111752.88481503.755121503.7893-0.0342062.84GLLTSVQDTASSVARCID Cmpd 265, +MSn(752.8848), 18.4 min
9<0.01AT4G04020.1FIB, fibrillin111781.87431561.734021561.7413-0.0073051.32FAGPFSTTSFSTNAKCID Cmpd 269, +MSn(781.8743), 18.5 min
9<0.01AT2G21960.1AT2G21960.1111562.27481122.535121122.5458-0.0107030.86WSSQPYLSRCID Cmpd 167, +MSn(562.2748), 15.3 min
9<0.01AT2G21960.1AT2G21960.1111562.78381123.553021123.5622-0.0091018.07EHVNLIDERCID Cmpd 97, +MSn(562.7838), 13.1 min
9<0.01AT2G21960.1AT2G21960.1111585.82231169.630121169.6404-0.0103038.90NAETLAIPSVRCID Cmpd 213, +MSn(585.8223), 16.7 min
9<0.01AT2G21960.1AT2G21960.1111625.85561249.696721249.7070-0.0103045.11WAVLYSASLLKCID Cmpd 355, +MSn(625.8557), 21.2 min
9<0.01AT2G21960.1AT2G21960.1111665.83321329.651921329.6637-0.0118084.57ISNEQQQNLTRCID Cmpd 17, +MSn(665.8332), 10.4 min
9<0.01AT2G21960.1AT2G21960.1111693.38251384.750521384.7748-0.0243053.20LAAVAMAGLAAEGLKCID Cmpd 319, +MSn(693.3825), 20.1 min
9<0.01AT2G21960.1AT2G21960.1111717.38641432.758221432.7674-0.0092070.75VIGQSADLFSLQRCID Cmpd 288, +MSn(717.3864), 19.1 min
9<0.01AT4G17600.1LIL3:1, Chlorophyll A-B binding family protein 111553.25771104.500821104.5121-0.0113036.84NVAVEGEEMKCID Cmpd 72, +MSn(553.2577), 12.3 min
9<0.01AT4G17600.1LIL3:1, Chlorophyll A-B binding family protein 111566.78851131.562421131.5713-0.0089027.59WINGTWDLKCID Cmpd 294, +MSn(566.7885), 19.3 min
9<0.01AT4G17600.1LIL3:1, Chlorophyll A-B binding family protein 111667.33131332.648021332.6561-0.0081092.12TDWDSVIVAEAKCID Cmpd 290, +MSn(667.3313), 19.2 min
9<0.01AT4G17600.1LIL3:1, Chlorophyll A-B binding family protein 111679.82181357.629021357.6402-0.0112063.05NLFDETTLYDKCID Cmpd 284, +MSn(679.8218), 19.0 min
9<0.01AT4G17600.1LIL3:1, Chlorophyll A-B binding family protein 111545.26811632.782431632.7995-0.0171145.41DGKTDWDSVIVAEAKCID Cmpd 256, +MSn(545.2681), 18.1 min
9<0.01AT4G17600.1LIL3:1, Chlorophyll A-B binding family protein 111622.63861864.894131864.9088-0.0147129.41NVAVEGEEMKTTESVVKOxidation (M)0.00000000200000000.0CID Cmpd 89, +MSn(622.6387), 12.8 min
9<0.01AT2G21170.1TIM, PDTPI, triosephosphate isomerase (Gene model 111477.7394953.46432953.4760-0.0116023.58FFVGGNWKCID Cmpd 257, +MSn(477.7394), 18.1 min
9<0.01AT2G21170.1TIM, PDTPI, triosephosphate isomerase (Gene model 111481.7361961.45762961.4716-0.0140042.71NVSEEVASKCID Cmpd 13, +MSn(481.7361), 9.8 min
9<0.01AT2G21170.1TIM, PDTPI, triosephosphate isomerase (Gene model 111718.36921434.723921434.7355-0.0115090.01GGAFTGEISVEQLKCID Cmpd 254, +MSn(718.3693), 18.0 min
9<0.01AT2G21170.1TIM, PDTPI, triosephosphate isomerase (Gene model 111725.37811448.741721448.7511-0.0094075.87GPEFATIVNSVTSKCID Cmpd 311, +MSn(725.3781), 19.8 min
9<0.01AT2G21170.1TIM, PDTPI, triosephosphate isomerase (Gene model 111540.28841617.843331617.8587-0.0154037.18VASPQQAQEVHVAVRCID Cmpd 88, +MSn(540.2884), 12.8 min
9<0.01AT2G34460.1NAD(P)-binding Rossmann-fold superfamily protein (111479.2828956.55102956.5655-0.0144069.39IVEQLLSRCID Cmpd 179, +MSn(479.2828), 15.7 min
9<0.01AT2G34460.1NAD(P)-binding Rossmann-fold superfamily protein (111568.30251134.590421134.6033-0.0130040.43VFVAGATGQTGKCID Cmpd 64, +MSn(568.3025), 12.0 min
9<0.01AT2G34460.1NAD(P)-binding Rossmann-fold superfamily protein (111790.37521578.735921578.7461-0.0102094.65VDNFGTVNLVDACRCID Cmpd 253, +MSn(790.3752), 18.0 min
9<0.01AT2G34460.1NAD(P)-binding Rossmann-fold superfamily protein (111502.59691504.768731504.7886-0.0198165.50TSFKDDPSLQIVRCID Cmpd 184, +MSn(502.5969), 15.8 min
9<0.01AT4G10340.1Lhcb5, CP26111485.7582969.50182969.5131-0.0113071.26DPEQGALLKCID Cmpd 113, +MSn(485.7581), 13.6 min
9<0.01AT4G10340.1Lhcb5, CP26111575.28001148.545521148.5561-0.0106037.41AVSETSDELAKCID Cmpd 35, +MSn(575.2800), 11.1 min
9<0.01AT4G10340.1Lhcb5, CP26111579.82251157.630421157.6445-0.0141046.50IFLPDGLLDRCID Cmpd 350, +MSn(579.8224), 21.1 min
9<0.01AT4G10340.1Lhcb5, CP26111848.94461695.874621695.8832-0.0085047.18TGALLLDGNTLNYFGKCID Cmpd 359, +MSn(848.9446), 21.3 min
9<0.01AT4G22890.1PGR5-LIKE A (Gene model 1)111622.80421243.593821243.6044-0.0106090.09IDGSDIVSEGPRCID Cmpd 147, +MSn(622.8042), 14.6 min
9<0.01AT4G22890.1PGR5-LIKE A (Gene model 1)111660.32461318.634621318.6445-0.0099082.89VYSDLAVDYFKCID Cmpd 300, +MSn(660.3246), 19.5 min
9<0.01AT4G22890.1PGR5-LIKE A (Gene model 1)111495.92951484.766631484.7835-0.0169149.38LKIDGSDIVSEGPRCID Cmpd 181, +MSn(495.9295), 15.7 min
9<0.01AT4G22890.2PGR5-LIKE A (Gene model 2)101622.80421243.593821243.6044-0.0106090.09IDGSDIVSEGPRCID Cmpd 147, +MSn(622.8042), 14.6 min
9<0.01AT4G22890.2PGR5-LIKE A (Gene model 2)101660.32461318.634621318.6445-0.0099082.89VYSDLAVDYFKCID Cmpd 300, +MSn(660.3246), 19.5 min
9<0.01AT4G22890.2PGR5-LIKE A (Gene model 2)101495.92951484.766631484.7835-0.0169149.38LKIDGSDIVSEGPRCID Cmpd 181, +MSn(495.9295), 15.7 min
9<0.01AT4G22890.3PGR5-LIKE A (Gene model 3)101622.80421243.593821243.6044-0.0106090.09IDGSDIVSEGPRCID Cmpd 147, +MSn(622.8042), 14.6 min
9<0.01AT4G22890.3PGR5-LIKE A (Gene model 3)101660.32461318.634621318.6445-0.0099082.89VYSDLAVDYFKCID Cmpd 300, +MSn(660.3246), 19.5 min
9<0.01AT4G22890.3PGR5-LIKE A (Gene model 3)101495.92951484.766631484.7835-0.0169149.38LKIDGSDIVSEGPRCID Cmpd 181, +MSn(495.9295), 15.7 min
9<0.01AT4G22890.4PGR5-LIKE A (Gene model 4)101622.80421243.593821243.6044-0.0106090.09IDGSDIVSEGPRCID Cmpd 147, +MSn(622.8042), 14.6 min
9<0.01AT4G22890.4PGR5-LIKE A (Gene model 4)101660.32461318.634621318.6445-0.0099082.89VYSDLAVDYFKCID Cmpd 300, +MSn(660.3246), 19.5 min
9<0.01AT4G22890.4PGR5-LIKE A (Gene model 4)101495.92951484.766631484.7835-0.0169149.38LKIDGSDIVSEGPRCID Cmpd 181, +MSn(495.9295), 15.7 min
9<0.01AT4G22890.5PGR5-LIKE A (Gene model 5)101622.80421243.593821243.6044-0.0106090.09IDGSDIVSEGPRCID Cmpd 147, +MSn(622.8042), 14.6 min
9<0.01AT4G22890.5PGR5-LIKE A (Gene model 5)101660.32461318.634621318.6445-0.0099082.89VYSDLAVDYFKCID Cmpd 300, +MSn(660.3246), 19.5 min
9<0.01AT4G22890.5PGR5-LIKE A (Gene model 5)101495.92951484.766631484.7835-0.0169149.38LKIDGSDIVSEGPRCID Cmpd 181, +MSn(495.9295), 15.7 min
9<0.01AT5G01530.1Lhcb4.1, CP29111508.27301014.531521014.5458-0.0143054.74NLAGDVIGTRCID Cmpd 177, +MSn(508.2730), 15.6 min
9<0.01AT5G01530.1Lhcb4.1, CP29111557.81931113.624121113.6393-0.0152061.33TAQLQLAEIKCID Cmpd 207, +MSn(557.8193), 16.5 min
9<0.01AT5G01530.1Lhcb4.1, CP29111710.35781418.700921418.7082-0.0072068.60FFDPLGLAADPEKCID Cmpd 363, +MSn(710.3577), 21.5 min
9<0.01AT5G47110.1LIL3:2, Chlorophyll A-B binding family protein 111675.32741348.640221348.6511-0.0109078.06TDWDSVIVSEAKCID Cmpd 278, +MSn(675.3274), 18.7 min
9<0.01AT5G47110.1LIL3:2, Chlorophyll A-B binding family protein 111550.60141648.782431648.7944-0.0120122.09DGKTDWDSVIVSEAKCID Cmpd 248, +MSn(550.6014), 17.8 min
9<0.01AT5G47110.1LIL3:2, Chlorophyll A-B binding family protein 111890.39642668.167332667.19950.9678018.44SPAESSSASENGAVGGEATDSSTETVIKCID Cmpd 126, +MSn(890.3964), 14.0 min
9<0.01AT1G16880.1Uridylyltransferase-related similar to ACT domain-111513.22731024.439921024.4462-0.0062030.55RPSTDESSFCID Cmpd 48, +MSn(513.2272), 11.5 min
9<0.01AT1G16880.1Uridylyltransferase-related similar to ACT domain-111630.34811258.681721258.6955-0.0138057.88LGALLDTMNALKCID Cmpd 327, +MSn(630.3481), 20.4 min
9<0.01AT5G07020.1Proline-rich family protein 111838.90851675.802521675.8093-0.0069061.39AVDYSGPSLSYYINKCID Cmpd 283, +MSn(838.9085), 18.9 min
9<0.01AT1G16880.2Uridylyltransferase-related similar to ACT domain-101630.34811258.681721258.6955-0.0138057.88LGALLDTMNALKCID Cmpd 327, +MSn(630.3481), 20.4 min
9<0.01ATCG00020.1PsbA, D1111657.85651313.698521313.7092-0.0106044.59VINTWADIINRCID Cmpd 317, +MSn(657.8566), 20.0 min
9<0.05AT4G28740.1AT4G28740.1111665.84941329.684221329.6969-0.0127038.36VTPVFVPEWEKCID Cmpd 302, +MSn(665.8494), 19.5 min
9<0.05AT4G31530.1NAD(P)-binding Rossmann-fold superfamily protein (111564.82901127.643421127.6550-0.0116034.33NLISALPSSVKCID Cmpd 250, +MSn(564.8290), 17.9 min
9<0.05AT4G31530.2NAD(P)-binding Rossmann-fold superfamily protein (101564.82901127.643421127.6550-0.0116034.33NLISALPSSVKCID Cmpd 250, +MSn(564.8290), 17.9 min
10<0.01AT5G66570.1PsbO-1, OEE1, OEE33, OE33, MSP-1110850.4205849.41331849.4232-0.0100022.88GSSFLDPKCID Cmpd 112, +MSn(850.4205), 15.6 min
10<0.01AT5G66570.1PsbO-1, OEE1, OEE33, OE33, MSP-1110441.2421880.46972880.4807-0.0110055.63FLVPSYRCID Cmpd 185, +MSn(441.2421), 17.9 min
10<0.01AT5G66570.1PsbO-1, OEE1, OEE33, OE33, MSP-1110475.7836949.55262949.5637-0.0111050.39VPFLFTVKCID Cmpd 284, +MSn(475.7836), 21.2 min
10<0.01AT5G66570.1PsbO-1, OEE1, OEE33, OE33, MSP-1110548.77561095.536721095.5448-0.0081055.21LTYDEIQSKCID Cmpd 90, +MSn(548.7756), 15.0 min
10<0.01AT5G66570.1PsbO-1, OEE1, OEE33, OE33, MSP-1110602.32791202.641221202.6507-0.0094070.59NTAASVGEITLKCID Cmpd 143, +MSn(602.3279), 16.6 min
10<0.01AT5G66570.1PsbO-1, OEE1, OEE33, OE33, MSP-1110626.82481251.635121251.6459-0.0108151.84RLTYDEIQSKCID Cmpd 57, +MSn(626.8248), 13.9 min
10<0.01AT5G66570.1PsbO-1, OEE1, OEE33, OE33, MSP-1110681.82051361.626421361.6326-0.0062042.79FCFEPTSFTVKCID Cmpd 266, +MSn(681.8205), 20.7 min
10<0.01AT5G66570.1PsbO-1, OEE1, OEE33, OE33, MSP-1110497.58011489.718431489.7276-0.0091132.51KFCFEPTSFTVKCID Cmpd 223, +MSn(497.5801), 19.1 min
10<0.01AT5G66570.1PsbO-1, OEE1, OEE33, OE33, MSP-1110781.87681561.739121561.7485-0.00930108.67GGSTGYDNAVALPAGGRCID Cmpd 129, +MSn(781.8768), 16.2 min
10<0.01AT5G66570.1PsbO-1, OEE1, OEE33, OE33, MSP-1110592.62611774.856631774.8711-0.0145143.53GRGGSTGYDNAVALPAGGRCID Cmpd 92, +MSn(592.6262), 15.0 min
10<0.01AT5G66570.1PsbO-1, OEE1, OEE33, OE33, MSP-11101009.98022017.945922017.9593-0.0134032.90EEDGIDYAAVTVQLPGGERCID Cmpd 252, +MSn(1009.9802), 20.2 min
10<0.01AT5G66570.1PsbO-1, OEE1, OEE33, OE33, MSP-1110868.76442603.271332603.2966-0.0253042.41SKPETGEVIGVFESLQPSDTDLGAKCID Cmpd 296, +MSn(868.7644), 21.6 min
10<0.01AT5G66570.1PsbO-1, OEE1, OEE33, OE33, MSP-1111459.7191917.42362917.4342-0.0106047.20GDEEELVKCID Cmpd 42, +MSn(459.7191), 13.4 min
10<0.01AT5G66570.1PsbO-1, OEE1, OEE33, OE33, MSP-1111573.27931144.544021144.5513-0.0072044.38NAPPEFQNTKCID Cmpd 38, +MSn(573.2793), 13.3 min
10<0.01AT5G66570.1PsbO-1, OEE1, OEE33, OE33, MSP-1111596.79941191.584321191.5924-0.0081041.87IQGVWYGQLECID Cmpd 278, +MSn(596.7994), 21.0 min
10<0.01AT5G66570.1PsbO-1, OEE1, OEE33, OE33, MSP-1111463.56291387.667031387.6831-0.0161147.50GDEEELVKENVKCID Cmpd 84, +MSn(463.5629), 14.7 min
10<0.01AT5G66570.1PsbO-1, OEE1, OEE33, OE33, MSP-1111484.23841449.693331449.7100-0.0167073.49QLDASGKPDSFTGKCID Cmpd 41, +MSn(484.2384), 13.4 min
10<0.01AT5G66570.1PsbO-1, OEE1, OEE33, OE33, MSP-1111819.71202456.114332456.1278-0.0135050.97GTGTANQCPTIDGGSETFSFKPGKCID Cmpd 169, +MSn(819.7120), 17.4 min
10<0.01AT5G66570.1PsbO-1, OEE1, OEE33, OE33, MSP-1111821.39382461.159632461.1721-0.0125125.75GGSTGYDNAVALPAGGRGDEEELVKCID Cmpd 166, +MSn(821.3938), 17.3 min
10<0.01AT3G50820.1PsbO-2, OEC33100850.4205849.41331849.4232-0.0100022.88GSSFLDPKCID Cmpd 112, +MSn(850.4205), 15.6 min
10<0.01AT3G50820.1PsbO-2, OEC33100441.2421880.46972880.4807-0.0110055.63FLVPSYRCID Cmpd 185, +MSn(441.2421), 17.9 min
10<0.01AT3G50820.1PsbO-2, OEC33100475.7836949.55262949.5637-0.0111050.39VPFLFTVKCID Cmpd 284, +MSn(475.7836), 21.2 min
10<0.01AT3G50820.1PsbO-2, OEC33100548.77561095.536721095.5448-0.0081055.21LTYDEIQSKCID Cmpd 90, +MSn(548.7756), 15.0 min
10<0.01AT3G50820.1PsbO-2, OEC33101596.79941191.584321191.5924-0.0081041.87IQGVWYGQIECID Cmpd 278, +MSn(596.7994), 21.0 min
10<0.01AT3G50820.1PsbO-2, OEC33100602.32791202.641221202.6507-0.0094070.59NTAASVGEITLKCID Cmpd 143, +MSn(602.3279), 16.6 min
10<0.01AT3G50820.1PsbO-2, OEC33100626.82481251.635121251.6459-0.0108151.84RLTYDEIQSKCID Cmpd 57, +MSn(626.8248), 13.9 min
10<0.01AT3G50820.1PsbO-2, OEC33100681.82051361.626421361.6326-0.0062042.79FCFEPTSFTVKCID Cmpd 266, +MSn(681.8205), 20.7 min
10<0.01AT3G50820.1PsbO-2, OEC33100497.58011489.718431489.7276-0.0091132.51KFCFEPTSFTVKCID Cmpd 223, +MSn(497.5801), 19.1 min
10<0.01AT3G50820.1PsbO-2, OEC33100781.87681561.739121561.7485-0.00930108.67GGSTGYDNAVALPAGGRCID Cmpd 129, +MSn(781.8768), 16.2 min
10<0.01AT3G50820.1PsbO-2, OEC33100592.62611774.856631774.8711-0.0145143.53GRGGSTGYDNAVALPAGGRCID Cmpd 92, +MSn(592.6262), 15.0 min
10<0.01AT3G50820.1PsbO-2, OEC331001009.98022017.945922017.9593-0.0134032.90EEDGIDYAAVTVQLPGGERCID Cmpd 252, +MSn(1009.9802), 20.2 min
10<0.01AT3G50820.1PsbO-2, OEC33100868.76442603.271332603.2966-0.0253042.41SKPETGEVIGVFESLQPSDTDLGAKCID Cmpd 296, +MSn(868.7644), 21.6 min
10<0.01AT3G50820.1PsbO-2, OEC33111566.27061130.526621130.5356-0.0090031.36NAPPDFQNTKCID Cmpd 40, +MSn(566.2706), 13.3 min
10<0.01AT3G50820.1PsbO-2, OEC331111128.54352255.072422255.0845-0.0122024.34LTYTLDEIEGPFEVGSDGSVKCID Cmpd 311, +MSn(1128.5435), 22.1 min
10<0.01AT3G50820.1PsbO-2, OEC33111459.54931375.626231375.6467-0.0205154.42GDEEELSKENVKCID Cmpd 13, +MSn(459.5493), 12.2 min
10<0.01AT3G50820.1PsbO-2, OEC33111488.91051463.709831463.7256-0.0158066.62QLEASGKPESFSGKCID Cmpd 29, +MSn(488.9106), 13.0 min
10<0.01AT3G50820.1PsbO-2, OEC33111765.37752293.110732293.1226-0.0119136.35FKEEDGIDYAAVTVQLPGGERCID Cmpd 236, +MSn(765.3775), 19.5 min
10<0.01AT4G04020.1FIB, fibrillin111406.7421811.46962811.4803-0.0107037.89IDLNPIKCID Cmpd 156, +MSn(406.7421), 17.0 min
10<0.01AT4G04020.1FIB, fibrillin111461.2289920.44312920.4563-0.0132048.02GLSVSSDTRCID Cmpd 18, +MSn(461.2289), 12.6 min
10<0.01AT4G04020.1FIB, fibrillin111554.29981106.585121106.5972-0.0121051.71GDGGSVYVLIKCID Cmpd 204, +MSn(554.2998), 18.5 min
10<0.01AT4G04020.1FIB, fibrillin111581.77901161.543521161.5513-0.0078058.40AIESVEETERCID Cmpd 39, +MSn(581.7791), 13.3 min
10<0.01AT4G04020.1FIB, fibrillin111649.32911296.643721296.6562-0.0125096.31VFASSSTVSVADKCID Cmpd 85, +MSn(649.3291), 14.8 min
10<0.01AT4G04020.1FIB, fibrillin111730.88951459.764421459.7769-0.0126079.15AEISELITQLESKCID Cmpd 314, +MSn(730.8895), 22.5 min
10<0.01AT4G04020.1FIB, fibrillin111752.88651503.758421503.7893-0.0309033.53GLLTSVQDTASSVARCID Cmpd 229, +MSn(752.8865), 19.3 min
10<0.01AT4G04020.1FIB, fibrillin111781.87491561.735121561.7413-0.0061053.61FAGPFSTTSFSTNAKCID Cmpd 231, +MSn(781.8749), 19.4 min
10<0.01AT4G04020.1FIB, fibrillin111747.35662239.048132239.0605-0.0123057.66VDEISQTIDSDSFTVQNSVRCID Cmpd 239, +MSn(747.3566), 19.7 min
10<0.01AT4G04020.1FIB, fibrillin111971.83232912.475032912.5019-0.0269037.81FEQGVIGTPQLTDSIEIPESVEVLGQKCID Cmpd 322, +MSn(971.8323), 22.7 min
10<0.01AT2G34460.1NAD(P)-binding Rossmann-fold superfamily protein (111479.2831956.55162956.5655-0.0139057.20IVEQLLSRCID Cmpd 150, +MSn(479.2831), 16.8 min
10<0.01AT2G34460.1NAD(P)-binding Rossmann-fold superfamily protein (111790.37621578.737921578.7461-0.0082077.44VDNFGTVNLVDACRCID Cmpd 218, +MSn(790.3762), 19.0 min
10<0.01AT2G34460.1NAD(P)-binding Rossmann-fold superfamily protein (111492.27261473.796031473.8304-0.0344030.29SGINYTIVRPGGLKCID Cmpd 163, +MSn(492.2726), 17.2 min
10<0.01AT2G34460.1NAD(P)-binding Rossmann-fold superfamily protein (111502.59731504.770131504.7886-0.0185143.76TSFKDDPSLQIVRCID Cmpd 157, +MSn(502.5973), 17.0 min
10<0.01AT4G10340.1Lhcb5, CP26111575.27891148.543221148.5561-0.0129043.57AVSETSDELAKCID Cmpd 21, +MSn(575.2789), 12.7 min
10<0.01AT4G10340.1Lhcb5, CP26111579.82421157.633921157.6445-0.0106051.78IFLPDGLLDRCID Cmpd 297, +MSn(579.8242), 21.7 min
10<0.01AT4G10340.1Lhcb5, CP26111848.94311695.871721695.8832-0.0115050.67TGALLLDGNTLNYFGKCID Cmpd 303, +MSn(848.9431), 21.8 min
10<0.01AT4G10340.1Lhcb5, CP26111709.03262124.076132124.0964-0.0202055.09HLSDPFGNNLLTVIAGTAERCID Cmpd 329, +MSn(709.0327), 23.4 min
10<0.01AT4G09010.1APX4, TL29, ascorbate peroxidase 4 111574.24241146.470221146.4789-0.0086093.32SDATEADPEGRCID Cmpd 2, +MSn(574.2424), 10.9 min
10<0.01AT4G09010.1APX4, TL29, ascorbate peroxidase 4 111944.50331886.992021887.0102-0.0182063.14GGPISYADIIQLAGQSAVKCID Cmpd 321, +MSn(944.5032), 22.7 min
10<0.01AT4G09010.1APX4, TL29, ascorbate peroxidase 4 111644.33341929.978331929.9895-0.0111138.39AENEGLSDGLSLIEEVKKCID Cmpd 270, +MSn(644.3334), 20.8 min
10<0.01AT2G21960.1AT2G21960.1111665.83471329.654821329.6637-0.0088078.38ISNEQQQNLTRCID Cmpd 7, +MSn(665.8347), 12.0 min
10<0.01AT2G21960.1AT2G21960.1111717.38561432.756721432.7674-0.0107068.09VIGQSADLFSLQRCID Cmpd 245, +MSn(717.3856), 20.0 min
10<0.01AT1G16880.1Uridylyltransferase-related similar to ACT domain-111630.34961258.684721258.6955-0.0108078.24LGALLDTMNALKCID Cmpd 277, +MSn(630.3496), 21.0 min
10<0.01AT1G16880.1Uridylyltransferase-related similar to ACT domain-111700.40212098.184432098.2038-0.0194039.68SLLFIESADRPGLLVELVKCID Cmpd 331, +MSn(700.4021), 23.5 min
10<0.01AT4G22890.1PGR5-LIKE A (Gene model 1)111660.32521318.635821318.6445-0.0087068.34VYSDLAVDYFKCID Cmpd 258, +MSn(660.3252), 20.4 min
10<0.01AT4G22890.2PGR5-LIKE A (Gene model 2)101660.32521318.635821318.6445-0.0087068.34VYSDLAVDYFKCID Cmpd 258, +MSn(660.3252), 20.4 min
10<0.01AT4G22890.3PGR5-LIKE A (Gene model 3)101660.32521318.635821318.6445-0.0087068.34VYSDLAVDYFKCID Cmpd 258, +MSn(660.3252), 20.4 min
10<0.01AT4G22890.4PGR5-LIKE A (Gene model 4)101660.32521318.635821318.6445-0.0087068.34VYSDLAVDYFKCID Cmpd 258, +MSn(660.3252), 20.4 min
10<0.01AT4G22890.5PGR5-LIKE A (Gene model 5)101660.32521318.635821318.6445-0.0087068.34VYSDLAVDYFKCID Cmpd 258, +MSn(660.3252), 20.4 min
10<0.01AT1G16880.2Uridylyltransferase-related similar to ACT domain-101630.34961258.684721258.6955-0.0108078.24LGALLDTMNALKCID Cmpd 277, +MSn(630.3496), 21.0 min
10<0.01AT5G01530.1Lhcb4.1, CP29111710.35601418.697421418.7082-0.0108067.46FFDPLGLAADPEKCID Cmpd 312, +MSn(710.3560), 22.1 min
10<0.05AT2G21170.1TIM, PDTPI, triosephosphate isomerase (Gene model 111718.37221434.729821434.7355-0.0057041.16GGAFTGEISVEQLKCID Cmpd 219, +MSn(718.3721), 19.0 min
10<0.05AT2G21170.2TIM, PDTPI, triosephosphate isomerase (Gene model 101718.37221434.729821434.7355-0.0057041.16GGAFTGEISVEQLKCID Cmpd 219, +MSn(718.3721), 19.0 min
11<0.01ATCG00470.1F1 part, epsilon subunit (AtpE) 111508.79091015.567321015.56620.0011132.01TRVEALNTICID Cmpd 69, +MSn(508.7909), 15.6 min
11<0.01ATCG00470.1F1 part, epsilon subunit (AtpE) 111564.82191127.629221127.6298-0.0006054.79QTIEANLALRCID Cmpd 80, +MSn(564.8219), 16.3 min
11<0.01AT2G44920.2Tetratricopeptide repeat (TPR)-like superfamily pr111673.83941345.664221345.65860.0056063.74VADGVNATTGNATRCID Cmpd 3, +MSn(673.8394), 10.3 min
11<0.01AT1G67090.1RbcS, ribulose-bisphosphate carboxylase small chai111468.2506934.48662934.4872-0.0006058.06IIGFDNTRCID Cmpd 71, +MSn(468.2506), 15.6 min
12<0.01AT4G01150.1AT4G01150.1111431.2033860.39192860.4028-0.0109015.35WDGLENKCID Cmpd 27, +MSn(431.2032), 13.6 min
12<0.01AT4G01150.1AT4G01150.1111559.77081117.527021117.5404-0.0134120.48EKWDGLENKCID Cmpd 12, +MSn(559.7708), 12.8 min
12<0.01AT4G01150.1AT4G01150.1111573.79051145.566421145.5815-0.0152065.49ELAEDIESLKCID Cmpd 85, +MSn(573.7905), 17.3 min
12<0.01AT4G01150.1AT4G01150.1111637.83791273.661321273.6765-0.0152154.21ELAEDIESLKKCID Cmpd 63, +MSn(637.8380), 15.6 min
12<0.01AT4G01150.1AT4G01150.1111637.83821273.661921273.6765-0.0146125.28KELAEDIESLKCID Cmpd 66, +MSn(637.8382), 15.8 min
12<0.01AT4G01150.1AT4G01150.1110683.4012682.39401682.4054-0.0114039.44YLLFKCID Cmpd 108, +MSn(683.4012), 18.3 min
12