Notice: Undefined index: hash_2_1227 in /home/wwwadmin/gelmap.de/inc/authfunctions.php on line 12

Notice: Undefined index: hash_1_1227 in /home/wwwadmin/gelmap.de/inc/authfunctions.php on line 12
Gelmap. Spot visualization by LUH

Peptidelist

Spot IDProtein noAccessionTITLECmpd.m/z meas.Mr calc.zDelta m/z [ppm]RMS90 [ppm]Rt [min]Scores#Cmpds.RankPSequenceModificationsTypeRange
0621AT1G79750.1NADP-malic enzyme 4214487.7705973.523323,253,7419,0145,5310K.NIWLVDSK.GCID423 - 430
0621AT1G79750.1NADP-malic enzyme 4223490.7557979.495021,924,5819,3029,06210K.GMIYPPFR.NCID590 - 597
0621AT1G79750.1NADP-malic enzyme 4142497.2725992.529121,363,9216,5971,4210K.AYELGLATR.LCID614 - 622
0621AT1G79750.1NADP-malic enzyme 4166498.7538995.489923,185,5617,3335,8310K.GMIYPPFR.NOxidation: 2CID590 - 597
0621AT1G79750.1NADP-malic enzyme 481502.28121002.54982-1,978,1814,3035,4310R.QYQVPLQK.YCID156 - 163
0621AT1G79750.1NADP-malic enzyme 429526.27991050.54582-0,535,2712,4644,6310K.SHIPLEEAR.KCID413 - 421
0621AT1G79750.1NADP-malic enzyme 426537.77081073.525421,538,7812,3648,1210R.FVGGSLSDHR.FCID379 - 388
0621AT1G79750.1NADP-malic enzyme 4136551.81661101.618220,364,8816,4067,8211R.KNIWLVDSK.GCID422 - 430
0621AT1G79750.1NADP-malic enzyme 4121454.92991361.766730,868,0315,7164,8311K.VAAKAYELGLATR.LCID610 - 622
0621AT1G79750.1NADP-malic enzyme 45462.57591384.700034,227,6210,1037,1311K.KPWAHDHEPIR.ECID446 - 456
0621AT1G79750.1NADP-malic enzyme 4192778.94621555.872223,615,4418,1659,1511K.AYELGLATRLPQPK.ECID614 - 627
0621AT1G79750.1NADP-malic enzyme 4285804.47561606.929424,5013,2522,0025,04110R.GLLPPTVISQDLQVK.KCID134 - 148
0621AT1G79750.1NADP-malic enzyme 434840.34521678.663727,233,9912,6241,6210K.YMAMMDLQETNER.LOxidation: 2, 4, 5CID164 - 176
0621AT1G79750.1NADP-malic enzyme 4263562.99041685.946531,734,6820,9166,2311K.NIWLVDSKGLIVSSR.KCID423 - 437
0621AT1G79750.1NADP-malic enzyme 4239579.35041735.024432,8810,6319,9559,1311R.GLLPPTVISQDLQVKK.ICID134 - 149
0621AT1G79750.1NADP-malic enzyme 4275885.44571768.867225,455,8921,31102,2510R.AIFASGSPFAPVEYEGK.TCID522 - 538
0621AT1G79750.1NADP-malic enzyme 4277900.97491799.927424,3710,9721,3440,7110R.ILGLGDLGCQGMGIPVGK.LCarbamidomethyl: 9; Oxidation: 12CID248 - 265
0621AT1G79750.1NADP-malic enzyme 4100651.60901951.792836,333,3815,0462,7210K.ELEQCAESSMYSPSYR.SCarbamidomethyl: 5; Oxidation: 10CID628 - 643
0621AT1G79750.1NADP-malic enzyme 4172744.33562229.974534,7110,5817,5125,05111K.YMAMMDLQETNERLFYK.LOxidation: 2, 4, 5CID164 - 180
0621AT1G79750.1NADP-malic enzyme 4245702.31592103.912936,158,5220,2023,08310R.ATGEEYSELMHEFMTAVK.QOxidation: 10, 14CID308 - 325
0621AT1G79750.1NADP-malic enzyme 4271936.84002806.47863362,887,1221,1876,6311K.AIKPTVLIGTSGVGQTFTQDVVETMAK.LOxidation: 25CID464 - 490
0621AT1G79750.1NADP-malic enzyme 4300702.07372804.252144,8515,1323,2341,5110R.VHDDMLLAASEALAEELMEEHYEK.GOxidation: 5, 18CID566 - 589
0621AT1G79750.1NADP-malic enzyme 4307698.63322790.483747,149,8823,9135,9111K.AIKPTVLIGTSGVGQTFTQDVVETMAK.LCID464 - 490
0622ATMG01190.1alpha-1 subunit265500.3416499.33701-5,325,8520,9720,04110R.ALALI.-CID503 - 507
0622ATMG01190.1alpha-1 subunit176514.30081025.58692973,244,1917,6240,8210K.AVDSLVPIGR.GCID154 - 163
0622ATMG01190.1alpha-1 subunit82522.29161042.565922,656,1514,3139,5110R.TGSIVDVPAGK.ACID93 - 103
0622ATMG01190.1alpha-1 subunit250625.82531249.630324,625,3220,3975,7310R.AAELTNLFESR.ICID7 - 17
0622ATMG01190.1alpha-1 subunit253665.88181329.75042-1,009,1420,5475,8310K.TTIAIDTILNQK.QCID178 - 189
0622ATMG01190.1alpha-1 subunit158480.28951437.841633,529,1417,0653,1111R.GIRPAINVGLSVSR.VCID363 - 376
0622ATMG01190.1alpha-1 subunit268786.88041571.736925,9710,5821,0753,4110R.NFYANFQVDEIGR.VCID20 - 32
0622ATMG01190.1alpha-1 subunit266546.33771635.99233-0,6515,8520,9930,09111K.AILNSVKPELLQALK.GCID470 - 484
0622ATMG01190.1alpha-1 subunit241614.64981840.922033,005,1320,0437,6111R.IRNFYANFQVDEIGR.VCID18 - 32
0622ATMG01190.1alpha-1 subunit200656.38151966.113934,4513,3018,4345,9111R.LTEVLKQPQYAPLPIEK.QCID427 - 443
0622ATMG01190.1alpha-1 subunit255731.68452192.024233,417,0520,6236,9111R.ATSESETMYCVYVAIGQKR.SCarbamidomethyl: 10CID195 - 213
0622ATMG01190.1alpha-1 subunit87553.27842209.079742,157,8214,5723,08111R.VVDAMGVPIDGKGALSDHEQR.ROxidation: 5CID109 - 129
0622ATMG01190.1alpha-1 subunit319770.05992307.149533,616,5526,0670,6110R.EVAAFAQFGSDLDAATQALLNR.GCID402 - 423
0622ATMG01190.1alpha-1 subunit3171026.87853076.59033332,309,7125,9888,3110R.VVSVGDGIAQVYGLNEIQAGEMVLFANGVK.GCID33 - 62
0623AT2G07698.1alpha-2 subunit265500.3416499.33701-5,325,8520,9720,04110R.ALALI.-CID773 - 777
0623AT2G07698.1alpha-2 subunit176514.30081025.58692973,244,1917,6240,8210K.AVDSLVPIGR.GCID424 - 433
0623AT2G07698.1alpha-2 subunit82522.29161042.565922,656,1514,3139,5110R.TGSIVDVPAGK.ACID363 - 373
0623AT2G07698.1alpha-2 subunit250625.82531249.630324,625,3220,3975,7310R.AAELTNLFESR.ICID277 - 287
0623AT2G07698.1alpha-2 subunit253665.88181329.75042-1,009,1420,5475,8310K.TTIAIDTILNQK.QCID448 - 459
0623AT2G07698.1alpha-2 subunit158480.28951437.841633,529,1417,0653,1211R.GIRPAINVGLSVSR.VCID633 - 646
0623AT2G07698.1alpha-2 subunit268786.88041571.736925,9710,5821,0753,4110R.NFYANFQVDEIGR.VCID290 - 302
0623AT2G07698.1alpha-2 subunit241614.64981840.922033,005,1320,0437,6111R.IRNFYANFQVDEIGR.VCID288 - 302
0623AT2G07698.1alpha-2 subunit255731.68452192.024233,417,0520,6236,9111R.ATSESETMYCVYVAIGQKR.SCarbamidomethyl: 10CID465 - 483
0623AT2G07698.1alpha-2 subunit87553.27842209.079742,157,8214,5723,08111R.VVDAMGVPIDGKGALSDHEQR.ROxidation: 5CID379 - 399
0623AT2G07698.1alpha-2 subunit319770.05992307.149533,616,5526,0670,6110R.EVAAFAQFGSDLDAATQALLNR.GCID672 - 693
0623AT2G07698.1alpha-2 subunit3171026.87853076.59033332,309,7125,9888,3110R.VVSVGDGIAQVYGLNEIQAGEMVLFANGVK.GCID303 - 332
0624AT5G08670.1beta subunit (Isoforms: At5g08670, At5g08680, At5g08690)208488.2842974.55492-1,097,9318,7144,0310K.IGLFGGAGVGK.TCID227 - 237
0624AT5G08670.1beta subunit (Isoforms: At5g08670, At5g08680, At5g08690)235587.33481172.65542-0,263,2019,7758,8410K.VVDLLAPYQR.GCID214 - 223
0624AT5G08670.1beta subunit (Isoforms: At5g08670, At5g08680, At5g08690)161631.82581261.633622,708,4317,1533,7110R.TIAMDGTEGLVR.GCID135 - 146
0624AT5G08670.1beta subunit (Isoforms: At5g08670, At5g08680, At5g08690)178697.41371392.808922,8310,4517,7058,5110K.VLNTGAPITVPVGR.ACID150 - 163
0624AT5G08670.1beta subunit (Isoforms: At5g08670, At5g08680, At5g08690)301713.39251424.766422,862,4423,5034,6110R.VGLTGLTVAEYFR.DCID309 - 321
0624AT5G08670.1beta subunit (Isoforms: At5g08670, At5g08680, At5g08690)316729.42661456.832324,335,0025,9767,4110K.TVLIMELINNVAK.ACID238 - 250
0624AT5G08670.1beta subunit (Isoforms: At5g08670, At5g08680, At5g08690)242746.89441491.768224,086,2720,0653,4110R.FTQANSEVSALLGR.ICID338 - 351
0624AT5G08670.1beta subunit (Isoforms: At5g08670, At5g08680, At5g08690)128567.32521698.952930,495,1716,0831,9110R.LVLEVSHHLGQNVVR.TCID120 - 134
0624AT5G08670.1beta subunit (Isoforms: At5g08670, At5g08680, At5g08690)310998.55731995.088825,627,0025,2562,1410R.DAPALVDLATGQEILATGIK.VCID194 - 213
0624AT5G08670.1beta subunit (Isoforms: At5g08670, At5g08680, At5g08690)293961.76053841.97384270,185,5122,8040,6211K.KGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSR.QCID378 - 414
0625AT3G49240.1PPR/TPR like helical59544.78281087.551020,094,9313,4547,4210K.GLVSNDNLEK.ACID210 - 219
0625AT3G49240.1PPR/TPR like helical204550.31941098.62852-3,849,2518,5852,8110K.LPESVSALVGK.RCID84 - 94
0625AT3G49240.1PPR/TPR like helical58492.58631474.735131,355,1513,3842,1211R.LRMEPPVNSFNR.SOxidation: 3CID53 - 64
0625AT3G49240.1PPR/TPR like helical198602.65311804.931933,077,9018,3859,8211K.LIRENDLEEAALYTR.HCID105 - 119
0625AT3G49240.1PPR/TPR like helical110734.40042200.171333,686,3115,3439,7211R.SQQQQSQIPRPIQNPNIPK.LCID65 - 83
0626AT2G47510.1FUM1 (fumarase 1)64546.78861091.561121,396,5513,6876,7210K.IGYDNAAAVAK.KCID444 - 454
0627ATMG00090.1ribosomal protein S3150507.28891012.56652-3,2513,6816,8026,03110R.EQLLNQLR.VCID357 - 364
0628AT2G24200.1cytosol aminopeptidase16590.28031178.535029,372,8711,3238,2210K.SGVADMVNTGGR.AOxidation: 6CID453 - 464
0629AT3G15590.1DNA-binding protein56527.25471052.49612-1,1730,0413,3637,7210K.TPAYGMIER.MOxidation: 6CID569 - 577
06210AT1G26460.1PPR1226644.80531287.591823,3111,6119,4035,0110R.NMLFNIDYSR.GOxidation: 2CID615 - 624