Notice: Undefined index: hash_2_1227 in /home/wwwadmin/gelmap.de/inc/authfunctions.php on line 12

Notice: Undefined index: hash_1_1227 in /home/wwwadmin/gelmap.de/inc/authfunctions.php on line 12
Gelmap. Spot visualization by LUH

Peptidelist

Spot IDProtein noAccessionTITLECmpd.m/z meas.Mr calc.zDelta m/z [ppm]RMS90 [ppm]Rt [min]Scores#Cmpds.RankPSequenceModificationsTypeRange
0611AT5G08670.1beta subunit (Isoforms: At5g08670, At5g08680, At5g08690)297975.5634974.554911,244,4918,5384,7610K.IGLFGGAGVGK.TCID227 - 237
0611AT5G08670.1beta subunit (Isoforms: At5g08670, At5g08680, At5g08690)1981005.53471004.521216,169,6015,1444,6310R.EMIESGVIK.LCID274 - 282
0611AT5G08670.1beta subunit (Isoforms: At5g08670, At5g08680, At5g08690)152511.26551020.516120,294,4013,7050,1110R.EMIESGVIK.LOxidation: 2CID274 - 282
0611AT5G08670.1beta subunit (Isoforms: At5g08670, At5g08680, At5g08690)125583.30991164.604021,085,6312,7945,5310K.TEHYLPIHR.DCID185 - 193
0611AT5G08670.1beta subunit (Isoforms: At5g08670, At5g08680, At5g08690)324587.33841172.655425,865,4019,4464,9510K.VVDLLAPYQR.GCID214 - 223
0611AT5G08670.1beta subunit (Isoforms: At5g08670, At5g08680, At5g08690)115629.31681256.614923,265,0312,4975,5111K.TYDYGGKGAIGR.VCID74 - 85
0611AT5G08670.1beta subunit (Isoforms: At5g08670, At5g08680, At5g08690)252631.82701261.633624,608,0517,09118,2310R.TIAMDGTEGLVR.GCID135 - 146
0611AT5G08670.1beta subunit (Isoforms: At5g08670, At5g08680, At5g08690)187639.82451277.628624,614,7614,8380,8310R.TIAMDGTEGLVR.GOxidation: 4CID135 - 146
0611AT5G08670.1beta subunit (Isoforms: At5g08670, At5g08680, At5g08690)330664.87361327.728223,345,6919,6467,7110R.VCQVIGAIVDVR.FCarbamidomethyl: 2CID86 - 97
0611AT5G08670.1beta subunit (Isoforms: At5g08670, At5g08680, At5g08690)318693.36121384.702124,185,4419,2569,4210R.IMNVLGEPIDER.GCID169 - 180
0611AT5G08670.1beta subunit (Isoforms: At5g08670, At5g08680, At5g08690)272695.85001389.678924,674,7817,7550,3110K.AHGGFSVFAGVGER.TCID251 - 264
0611AT5G08670.1beta subunit (Isoforms: At5g08670, At5g08680, At5g08690)263697.41631392.808926,564,6917,4685,6310K.VLNTGAPITVPVGR.ACID150 - 163
0611AT5G08670.1beta subunit (Isoforms: At5g08670, At5g08680, At5g08690)256701.35821400.697023,483,9817,2067,1110R.IMNVLGEPIDER.GOxidation: 2CID169 - 180
0611AT5G08670.1beta subunit (Isoforms: At5g08670, At5g08680, At5g08690)432713.39491424.766426,234,5323,48108,3310R.VGLTGLTVAEYFR.DCID309 - 321
0611AT5G08670.1beta subunit (Isoforms: At5g08670, At5g08680, At5g08690)507729.42621456.832323,784,2526,1187,9210K.TVLIMELINNVAK.ACID238 - 250
0611AT5G08670.1beta subunit (Isoforms: At5g08670, At5g08680, At5g08690)462737.42481472.827325,293,7724,5286,1610K.TVLIMELINNVAK.AOxidation: 5CID238 - 250
0611AT5G08670.1beta subunit (Isoforms: At5g08670, At5g08680, At5g08690)333746.89621491.768226,493,1619,82121,1210R.FTQANSEVSALLGR.ICID338 - 351
0611AT5G08670.1beta subunit (Isoforms: At5g08670, At5g08680, At5g08690)226507.97661520.903932,705,1216,0858,9111R.KVLNTGAPITVPVGR.ACID149 - 163
0611AT5G08670.1beta subunit (Isoforms: At5g08670, At5g08680, At5g08690)184471.73401882.899643,889,2914,7488,2510R.MLSPHILGEEHYNTAR.GOxidation: 1CID434 - 449
0611AT5G08670.1beta subunit (Isoforms: At5g08670, At5g08680, At5g08690)194478.48541908.91524521,324,3315,0343,9110R.MLSPHILGEEHYNTAR.GAcetyl: 1CID434 - 449
0611AT5G08670.1beta subunit (Isoforms: At5g08670, At5g08680, At5g08690)212623.31081866.904733,165,8615,6068,1410R.MLSPHILGEEHYNTAR.GCID434 - 449
0611AT5G08670.1beta subunit (Isoforms: At5g08670, At5g08680, At5g08690)219850.48761698.952924,535,5715,8082,0610R.LVLEVSHHLGQNVVR.TCID120 - 134
0611AT5G08670.1beta subunit (Isoforms: At5g08670, At5g08680, At5g08690)235831.89471661.765425,684,2316,4684,1210K.CALVYGQMNEPPGAR.ACarbamidomethyl: 1CID292 - 306
0611AT5G08670.1beta subunit (Isoforms: At5g08670, At5g08680, At5g08690)253610.32321827.940034,228,1117,1065,0211R.IMNVLGEPIDERGEIK.TOxidation: 2CID169 - 184
0611AT5G08670.1beta subunit (Isoforms: At5g08670, At5g08680, At5g08690)298604.99051811.945132,503,5318,5965,4111R.IMNVLGEPIDERGEIK.TCID169 - 184
0611AT5G08670.1beta subunit (Isoforms: At5g08670, At5g08680, At5g08690)306852.74712554.20103398,286,8418,8850,0210R.FEDQEGLPPIMTSLEVQDHPTR.LOxidation: 11CID98 - 119
0611AT5G08670.1beta subunit (Isoforms: At5g08670, At5g08680, At5g08690)375618.31161851.903735,028,3021,4271,9411R.EGNDLYREMIESGVIK.LCID267 - 282
0611AT5G08670.1beta subunit (Isoforms: At5g08670, At5g08680, At5g08690)389847.41472538.20613399,895,5121,8956,8110R.FEDQEGLPPIMTSLEVQDHPTR.LCID98 - 119
0611AT5G08670.1beta subunit (Isoforms: At5g08670, At5g08680, At5g08690)3911031.03462060.042625,844,3521,98107,5410R.QISELGIYPAVDPLDSTSR.MCID415 - 433
0611AT5G08670.1beta subunit (Isoforms: At5g08670, At5g08680, At5g08690)393729.39172185.137937,033,5822,07124,8410R.IPSAVGYQPTLASDLGALQER.ICID352 - 372
0611AT5G08670.1beta subunit (Isoforms: At5g08670, At5g08680, At5g08690)400649.34671945.009834,369,0422,2967,0210R.FLSQPFHVAEIFTGAPGK.YCID490 - 507
0611AT5G08670.1beta subunit (Isoforms: At5g08670, At5g08680, At5g08690)414961.75973841.97384269,345,0622,8459,5311K.KGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSR.QCID378 - 414
0611AT5G08670.1beta subunit (Isoforms: At5g08670, At5g08680, At5g08690)446929.73573713.87884278,3411,2723,9731,08310K.GSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSR.QCID379 - 414
0611AT5G08670.1beta subunit (Isoforms: At5g08670, At5g08680, At5g08690)482998.55791995.088826,224,7125,23159,9710R.DAPALVDLATGQEILATGIK.VCID194 - 213
0611AT5G08670.1beta subunit (Isoforms: At5g08670, At5g08680, At5g08690)486915.98943658.89554282,029,9925,3569,8111R.FTQANSEVSALLGRIPSAVGYQPTLASDLGALQER.ICID338 - 372
0611AT5G08670.1beta subunit (Isoforms: At5g08670, At5g08680, At5g08690)497810.80172429.371634,8010,4425,8276,3111K.IGLFGGAGVGKTVLIMELINNVAK.AOxidation: 16CID227 - 250
0611AT5G08670.1beta subunit (Isoforms: At5g08670, At5g08680, At5g08690)499897.13812687.36883380,515,8525,8981,4111K.NLQDIIAILGMDELSEDDKLTVAR.AOxidation: 11CID460 - 483
0611AT5G08670.1beta subunit (Isoforms: At5g08670, At5g08680, At5g08690)504891.80622671.37383382,498,8926,0138,7111K.NLQDIIAILGMDELSEDDKLTVAR.ACID460 - 483
0611AT5G08670.1beta subunit (Isoforms: At5g08670, At5g08680, At5g08690)509932.98251863.936727,388,9826,1938,9110R.DAEGQDVLLFIDNIFR.FCID322 - 337
0612ATMG01190.1alpha-1 subunit348500.3451499.337011,686,2820,4727,02210R.ALALI.-CID503 - 507
0612ATMG01190.1alpha-1 subunit140755.4433754.433713,035,9013,3344,8210K.APGILER.KCID135 - 141
0612ATMG01190.1alpha-1 subunit283430.7557859.495022,194,9518,0663,3510R.QMSLLLR.RCID283 - 289
0612ATMG01190.1alpha-1 subunit202438.7539875.489923,845,1215,3067,8110R.QMSLLLR.ROxidation: 2CID283 - 289
0612ATMG01190.1alpha-1 subunit206446.7499891.481424,295,4715,4158,3210K.LELAQYR.ECID395 - 401
0612ATMG01190.1alpha-1 subunit312491.7528981.484127,0411,2919,0642,9110K.MELDAFLK.EOxidation: 1CID493 - 500
0612ATMG01190.1alpha-1 subunit2506.74461011.473421,2613,008,7860,8210K.GALSDHEQR.RCID121 - 129
0612ATMG01190.1alpha-1 subunit264513.80331025.586924,975,8217,4853,7510K.AVDSLVPIGR.GCID154 - 163
0612ATMG01190.1alpha-1 subunit166522.29351042.565926,294,3014,1789,8610R.TGSIVDVPAGK.ACID93 - 103
0612ATMG01190.1alpha-1 subunit316547.79981093.584220,807,2519,1776,0211R.KMELDAFLK.ECID492 - 500
0612ATMG01190.1alpha-1 subunit129600.34151198.667021,228,9212,9548,9311K.RTGSIVDVPAGK.ACID92 - 103
0612ATMG01190.1alpha-1 subunit245600.82061199.622023,863,2616,8190,6210R.VVDAMGVPIDGK.GCID109 - 120
0612ATMG01190.1alpha-1 subunit169608.81791215.616923,553,2514,2776,9310R.VVDAMGVPIDGK.GOxidation: 5CID109 - 120
0612ATMG01190.1alpha-1 subunit105613.81561225.612523,373,9712,2063,0610K.SVHEPMQTGLK.ACID143 - 153
0612ATMG01190.1alpha-1 subunit47621.81201241.607421,639,5810,3651,7410K.SVHEPMQTGLK.AOxidation: 6CID143 - 153
0612ATMG01190.1alpha-1 subunit336625.82791249.630328,775,0520,0090,5310R.AAELTNLFESR.ICID7 - 17
0612ATMG01190.1alpha-1 subunit246642.35621282.692124,446,4816,8275,4210K.QPQYAPLPIEK.QCID433 - 443
0612ATMG01190.1alpha-1 subunit345665.88591329.750425,163,9720,3894,0510K.TTIAIDTILNQK.QCID178 - 189
0612ATMG01190.1alpha-1 subunit52452.24371353.707531,3310,9710,5365,1411R.KSVHEPMQTGLK.ACID142 - 153
0612ATMG01190.1alpha-1 subunit179737.37022209.079734,094,7414,56103,2611R.VVDAMGVPIDGKGALSDHEQR.ROxidation: 5CID109 - 129
0612ATMG01190.1alpha-1 subunit231549.28022193.084843,135,0916,3496,8111R.VVDAMGVPIDGKGALSDHEQR.RCID109 - 129
0612ATMG01190.1alpha-1 subunit244719.93101437.841624,065,9916,7466,6311R.GIRPAINVGLSVSR.VCID363 - 376
0612ATMG01190.1alpha-1 subunit277832.94531663.871622,688,7817,8740,2111K.QVCGSLKLELAQYR.ECarbamidomethyl: 3CID388 - 401
0612ATMG01190.1alpha-1 subunit287656.38291966.113936,584,7518,2279,2511R.LTEVLKQPQYAPLPIEK.QCID427 - 443
0612ATMG01190.1alpha-1 subunit300582.33331743.973132,874,3118,6947,2211R.QTGKTTIAIDTILNQK.QCID174 - 189
0612ATMG01190.1alpha-1 subunit323574.28091719.813834,115,4619,3762,3210R.DNGMHALIIYDDLSK.QOxidation: 4CID262 - 276
0612ATMG01190.1alpha-1 subunit332614.65171840.922036,103,4619,7555,9111R.IRNFYANFQVDEIGR.VCID18 - 32
0612ATMG01190.1alpha-1 subunit334769.37901536.736124,765,5019,8381,7210R.EAFPGDVFYLHSR.LCID295 - 307
0612ATMG01190.1alpha-1 subunit352546.34071635.992334,843,4820,5870,1511K.AILNSVKPELLQALK.GCID470 - 484
0612ATMG01190.1alpha-1 subunit363786.88001571.736925,465,1921,0473,8310R.NFYANFQVDEIGR.VCID20 - 32
0612ATMG01190.1alpha-1 subunit369852.92001703.818923,8610,2421,23105,2510R.DNGMHALIIYDDLSK.QCID262 - 276
0612ATMG01190.1alpha-1 subunit443869.95601737.887225,876,4023,8785,9210K.QILVIYAAVNGFCDR.MCarbamidomethyl: 13CID444 - 458
0612ATMG01190.1alpha-1 subunit5031026.87803076.59033331,816,5026,00106,8110R.VVSVGDGIAQVYGLNEIQAGEMVLFANGVK.GCID33 - 62
0612ATMG01190.1alpha-1 subunit505770.06152307.149535,694,3326,08154,2410R.EVAAFAQFGSDLDAATQALLNR.GCID402 - 423
0613AT2G07698.1alpha-2 subunit348500.3451499.337011,686,2820,4727,02210R.ALALI.-CID773 - 777
0613AT2G07698.1alpha-2 subunit140755.4433754.433713,035,9013,3344,8210K.APGILER.KCID405 - 411
0613AT2G07698.1alpha-2 subunit205815.4671814.454916,084,2015,4042,9210R.ELLIGDR.QCID437 - 443
0613AT2G07698.1alpha-2 subunit283430.7557859.495022,194,9518,0663,3510R.QMSLLLR.RCID553 - 559
0613AT2G07698.1alpha-2 subunit202438.7539875.489923,845,1215,3067,8110R.QMSLLLR.ROxidation: 2CID553 - 559
0613AT2G07698.1alpha-2 subunit206446.7499891.481424,295,4715,4158,3210K.LELAQYR.ECID665 - 671
0613AT2G07698.1alpha-2 subunit2506.74461011.473421,2613,008,7860,8210K.GALSDHEQR.RCID391 - 399
0613AT2G07698.1alpha-2 subunit264513.80331025.586924,975,8217,4853,7510K.AVDSLVPIGR.GCID424 - 433
0613AT2G07698.1alpha-2 subunit166522.29351042.565926,294,3014,1789,8610R.TGSIVDVPAGK.ACID363 - 373
0613AT2G07698.1alpha-2 subunit129600.34151198.667021,228,9212,9548,9311K.RTGSIVDVPAGK.ACID362 - 373
0613AT2G07698.1alpha-2 subunit245600.82061199.622023,863,2616,8190,6210R.VVDAMGVPIDGK.GCID379 - 390
0613AT2G07698.1alpha-2 subunit169608.81791215.616923,553,2514,2776,9310R.VVDAMGVPIDGK.GOxidation: 5CID379 - 390
0613AT2G07698.1alpha-2 subunit105613.81561225.612523,373,9712,2063,0610K.SVHEPMQTGLK.ACID413 - 423
0613AT2G07698.1alpha-2 subunit143615.34731228.677622,033,2913,4280,4311R.ELLIGDRQTGK.TCID437 - 447
0613AT2G07698.1alpha-2 subunit47621.81201241.607421,639,5810,3651,7310K.SVHEPMQTGLK.AOxidation: 6CID413 - 423
0613AT2G07698.1alpha-2 subunit336625.82791249.630328,775,0520,0090,5310R.AAELTNLFESR.ICID277 - 287
0613AT2G07698.1alpha-2 subunit246642.35621282.692124,446,4816,8275,4210K.QPQYAPLPIEK.QCID703 - 713
0613AT2G07698.1alpha-2 subunit345665.88591329.750425,163,9720,3894,0510K.TTIAIDTILNQK.QCID448 - 459
0613AT2G07698.1alpha-2 subunit52452.24371353.707531,3310,9710,5365,1411R.KSVHEPMQTGLK.ACID412 - 423
0613AT2G07698.1alpha-2 subunit179737.37022209.079734,094,7414,56103,2611R.VVDAMGVPIDGKGALSDHEQR.ROxidation: 5CID379 - 399
0613AT2G07698.1alpha-2 subunit231549.28022193.084843,135,0916,3496,8111R.VVDAMGVPIDGKGALSDHEQR.RCID379 - 399
0613AT2G07698.1alpha-2 subunit244719.93101437.841624,065,9916,7466,6311R.GIRPAINVGLSVSR.VCID633 - 646
0613AT2G07698.1alpha-2 subunit300582.33331743.973132,874,3118,6947,2211R.QTGKTTIAIDTILNQK.QCID444 - 459
0613AT2G07698.1alpha-2 subunit323574.28091719.813834,115,4619,3762,3210R.DNGMHALIIYDDLSK.QOxidation: 4CID532 - 546
0613AT2G07698.1alpha-2 subunit332614.65171840.922036,103,4619,7555,9111R.IRNFYANFQVDEIGR.VCID288 - 302
0613AT2G07698.1alpha-2 subunit334769.37901536.736124,765,5019,8381,7210R.EAFPGDVFYLHSR.LCID565 - 577
0613AT2G07698.1alpha-2 subunit363786.88001571.736925,465,1921,0473,8310R.NFYANFQVDEIGR.VCID290 - 302
0613AT2G07698.1alpha-2 subunit369852.92001703.818923,8610,2421,23105,2510R.DNGMHALIIYDDLSK.QCID532 - 546
0613AT2G07698.1alpha-2 subunit443869.95601737.887225,876,4023,8785,9210K.QILVIYAAVNGFCDR.MCarbamidomethyl: 13CID714 - 728
0613AT2G07698.1alpha-2 subunit5031026.87803076.59033331,816,5026,00106,8110R.VVSVGDGIAQVYGLNEIQAGEMVLFANGVK.GCID303 - 332
0613AT2G07698.1alpha-2 subunit505770.06152307.149535,694,3326,08154,2410R.EVAAFAQFGSDLDAATQALLNR.GCID672 - 693