132 | 726.329 | 1450.615 | 2 | 19.341 | 16.584 | 15.4 | 87.36 | 136 | 1 | 202 - 213 | K.DDENVNSQPFMR.W | | Tair10_plus_Mascot_2012-09-18 09:20:29 | ATCG00490.1 | CID | RbcL, ribulose-bisphosphate carboxylases, large ch | calvin cycle | II) carbon fixation | plastid |
132 | 570.301 | 1707.869 | 3 | 6.905 | 16.501 | 13 | 33.4 | 66 | 1 | 147 - 161 | K.TFQGPPHGIQVERDK.L | | Tair10_plus_Mascot_2012-09-18 09:20:29 | ATCG00490.1 | CID | RbcL, ribulose-bisphosphate carboxylases, large ch | calvin cycle | II) carbon fixation | plastid |
132 | 558.801 | 1115.576 | 2 | 10.200 | 14.554 | 13.8 | 78.54 | 87 | 1 | 422 - 431 | R.VALEACVQAR.N | Carbamidomethyl: 6; | Tair10_plus_Mascot_2012-09-18 09:20:29 | ATCG00490.1 | CID | RbcL, ribulose-bisphosphate carboxylases, large ch | calvin cycle | II) carbon fixation | plastid |
132 | 511.276 | 1020.524 | 2 | 12.398 | 9.645 | 20.8 | 52.46 | 252 | 1 | 33 - 41 | K.DTDILAAFR.V | | Tair10_plus_Mascot_2012-09-18 09:20:29 | ATCG00490.1 | CID | RbcL, ribulose-bisphosphate carboxylases, large ch | calvin cycle | II) carbon fixation | plastid |
132 | 614.837 | 1227.646 | 2 | 11.817 | 11.987 | 17.4 | 60.64 | 189 | 1 | 436 - 446 | R.DLAVEGNEIIR.E | | Tair10_plus_Mascot_2012-09-18 09:20:29 | ATCG00490.1 | CID | RbcL, ribulose-bisphosphate carboxylases, large ch | calvin cycle | II) carbon fixation | plastid |
132 | 631.327 | 1260.621 | 2 | 14.546 | 9.436 | 20.7 | 53.96 | 249 | 1 | 218 - 227 | R.FLFCAEAIYK.S | Carbamidomethyl: 4; | Tair10_plus_Mascot_2012-09-18 09:20:29 | ATCG00490.1 | CID | RbcL, ribulose-bisphosphate carboxylases, large ch | calvin cycle | II) carbon fixation | plastid |
132 | 1285.652 | 3853.865 | 3 | 17.965 | 15.565 | 24.6 | 33.69 | 272 | 1 | 42 - 79 | R.VTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDR.Y | | Tair10_plus_Mascot_2012-09-18 09:20:29 | ATCG00490.1 | CID | RbcL, ribulose-bisphosphate carboxylases, large ch | calvin cycle | II) carbon fixation | plastid |
132 | 724.010 | 2168.980 | 3 | 12.895 | 18.739 | 18 | 38.41 | 205 | 1 | 195 - 213 | R.GGLDFTKDDENVNSQPFMR.W | | Tair10_plus_Mascot_2012-09-18 09:20:29 | ATCG00490.1 | CID | RbcL, ribulose-bisphosphate carboxylases, large ch | calvin cycle | II) carbon fixation | plastid |
132 | 455.731 | 909.438 | 2 | 9.863 | 13.124 | 13.4 | 41.15 | 77 | 1 | 188 - 194 | R.AVYECLR.G | Carbamidomethyl: 5; | Tair10_plus_Mascot_2012-09-18 09:20:29 | ATCG00490.1 | CID | RbcL, ribulose-bisphosphate carboxylases, large ch | calvin cycle | II) carbon fixation | plastid |
132 | 489.260 | 1464.747 | 3 | 8.203 | 11.540 | 14 | 63.06 | 94 | 1 | 147 - 159 | K.TFQGPPHGIQVER.D | | Tair10_plus_Mascot_2012-09-18 09:20:29 | ATCG00490.1 | CID | RbcL, ribulose-bisphosphate carboxylases, large ch | calvin cycle | II) carbon fixation | plastid |
132 | 773.884 | 1545.729 | 2 | 15.860 | 15.071 | 20.6 | 56.62 | 247 | 1 | 451 - 463 | K.WSPELAAACEVWK.E | Carbamidomethyl: 9; | Tair10_plus_Mascot_2012-09-18 09:20:29 | ATCG00490.1 | CID | RbcL, ribulose-bisphosphate carboxylases, large ch | calvin cycle | II) carbon fixation | plastid |
132 | 447.755 | 1786.980 | 4 | 5.851 | 17.220 | 12.8 | 31.67 | 62 | 1 | 317 - 334 | K.ALRLSGGDHIHAGTVVGK.L | | Tair10_plus_Mascot_2012-09-18 09:20:29 | ATCG00490.1 | CID | RbcL, ribulose-bisphosphate carboxylases, large ch | calvin cycle | II) carbon fixation | plastid |
132 | 729.342 | 2184.975 | 3 | 13.612 | 8.408 | 16.7 | 26.34 | 172 | 1 | 195 - 213 | R.GGLDFTKDDENVNSQPFMR.W | Oxidation: 18; | Tair10_plus_Mascot_2012-09-18 09:20:29 | ATCG00490.1 | CID | RbcL, ribulose-bisphosphate carboxylases, large ch | calvin cycle | II) carbon fixation | plastid |
132 | 472.603 | 1414.782 | 3 | 4.144 | 14.093 | 16.2 | 21.12 | 163 | 1 | 135 - 146 | R.LEDLRIPPAYTK.T | | Tair10_plus_Mascot_2012-09-18 09:20:29 | ATCG00490.1 | CID | RbcL, ribulose-bisphosphate carboxylases, large ch | calvin cycle | II) carbon fixation | plastid |
132 | 483.263 | 1446.758 | 3 | 6.377 | 10.552 | 11 | 32.18 | 27 | 1 | 320 - 334 | R.LSGGDHIHAGTVVGK.L | | Tair10_plus_Mascot_2012-09-18 09:20:29 | ATCG00490.1 | CID | RbcL, ribulose-bisphosphate carboxylases, large ch | calvin cycle | II) carbon fixation | plastid |
132 | 594.342 | 1186.657 | 2 | 10.413 | 12.890 | 15.4 | 60.08 | 138 | 1 | 286 - 295 | R.DNGLLLHIHR.A | | Tair10_plus_Mascot_2012-09-18 09:20:29 | ATCG00490.1 | CID | RbcL, ribulose-bisphosphate carboxylases, large ch | calvin cycle | II) carbon fixation | plastid |
132 | 562.300 | 1683.854 | 3 | 14.624 | 15.241 | 15.6 | 66.15 | 145 | 1 | 432 - 446 | R.NEGRDLAVEGNEIIR.E | | Tair10_plus_Mascot_2012-09-18 09:20:29 | ATCG00490.1 | CID | RbcL, ribulose-bisphosphate carboxylases, large ch | calvin cycle | II) carbon fixation | plastid |
132 | 704.350 | 1406.661 | 2 | 17.424 | 12.703 | 15.8 | 48.07 | 149 | 1 | 22 - 32 | K.LTYYTPEYETK.D | | Tair10_plus_Mascot_2012-09-18 09:20:29 | ATCG00490.1 | CID | RbcL, ribulose-bisphosphate carboxylases, large ch | calvin cycle | II) carbon fixation | plastid |
132 | 588.376 | 587.364 | 1 | 7.771 | 10.344 | 11.2 | 25.03 | 35 | 1 | 178 - 183 | K.LGLSAK.N | | Tair10_plus_Mascot_2012-09-18 09:20:29 | ATCG00490.1 | CID | RbcL, ribulose-bisphosphate carboxylases, large ch | calvin cycle | II) carbon fixation | plastid |
132 | 456.742 | 911.465 | 2 | 5.371 | 14.904 | 10.6 | 49.41 | 25 | 1 | 296 - 303 | R.AMHAVIDR.Q | | Tair10_plus_Mascot_2012-09-18 09:20:29 | ATCG00490.1 | CID | RbcL, ribulose-bisphosphate carboxylases, large ch | calvin cycle | II) carbon fixation | plastid |
132 | 933.975 | 1865.905 | 2 | 16.595 | 13.575 | 22.4 | 30.37 | 268 | 1 | 464 - 479 | K.EITFNFPTIDKLDGQE.- | | Tair10_plus_Mascot_2012-09-18 09:20:29 | ATCG00490.1 | CID | RbcL, ribulose-bisphosphate carboxylases, large ch | calvin cycle | II) carbon fixation | plastid |
132 | 468.254 | 934.487 | 2 | 7.471 | 12.089 | 15.7 | 57.97 | 147 | 1 | 156 - 163 | R.IIGFDNTR.Q | | Tair10_plus_Mascot_2012-09-18 09:20:29 | AT1G67090.1 | CID | RbcS, ribulose-bisphosphate carboxylase small chai | calvin cycle | II) carbon fixation | plastid |
132 | 505.270 | 1008.503 | 2 | 22.886 | 11.191 | 16.6 | 19.85 | 170 | 1 | 148 - 155 | K.EYPNAFIR.I | | Tair10_plus_Mascot_2012-09-18 09:20:29 | AT1G67090.1 | CID | RbcS, ribulose-bisphosphate carboxylase small chai | calvin cycle | II) carbon fixation | plastid |
132 | 475.291 | 474.280 | 1 | 7.271 | 18.823 | 11.3 | 22.91 | 36 | 1 | 68 - 72 | R.GISAK.G | | Tair10_plus_Mascot_2012-09-18 09:20:29 | AT1G20620.1 | CID | CAT3, SEN2, ATCAT3, catalase 3 | antioxidants | VI) other metabolic pathways | peroxisome |
132 | 494.288 | 986.555 | 2 | 5.595 | 9.748 | 12.2 | 17.07 | 46 | 1 | 180 - 187 | R.RPYIPVDK.Y | | Tair10_plus_Mascot_2012-09-18 09:20:29 | AT4G04640.1 | CID | F1 part, gamma subunit (AtpC1) | d) atp-synthase | I) photophosphorylation | plastid |
132 | 732.434 | 1462.840 | 2 | 8.941 | 13.505 | 18.4 | 64.91 | 217 | 1 | 159 - 172 | K.GLGLEYTVISVGKK.G | | Tair10_plus_Mascot_2012-09-18 09:20:29 | AT4G04640.1 | CID | F1 part, gamma subunit (AtpC1) | d) atp-synthase | I) photophosphorylation | plastid |
132 | 485.251 | 968.475 | 2 | 11.990 | 9.066 | 14.7 | 34.65 | 117 | 1 | 345 - 352 | K.SLSMVYNR.K | | Tair10_plus_Mascot_2012-09-18 09:20:29 | AT4G04640.1 | CID | F1 part, gamma subunit (AtpC1) | d) atp-synthase | I) photophosphorylation | plastid |
132 | 668.388 | 1334.745 | 2 | 11.894 | 13.398 | 19.9 | 65.01 | 235 | 1 | 159 - 171 | K.GLGLEYTVISVGK.K | | Tair10_plus_Mascot_2012-09-18 09:20:29 | AT4G04640.1 | CID | F1 part, gamma subunit (AtpC1) | d) atp-synthase | I) photophosphorylation | plastid |
132 | 679.876 | 1357.720 | 2 | 13.035 | 10.484 | 18.2 | 90.19 | 211 | 1 | 316 - 328 | R.ALQESLASELAAR.M | | Tair10_plus_Mascot_2012-09-18 09:20:29 | AT4G04640.1 | CID | F1 part, gamma subunit (AtpC1) | d) atp-synthase | I) photophosphorylation | plastid |
132 | 548.258 | 1641.734 | 3 | 11.576 | 12.204 | 12.1 | 100.46 | 43 | 1 | 329 - 344 | R.MSAMSSASDNASDLKK.S | | Tair10_plus_Mascot_2012-09-18 09:20:29 | AT4G04640.1 | CID | F1 part, gamma subunit (AtpC1) | d) atp-synthase | I) photophosphorylation | plastid |
132 | 553.590 | 1657.729 | 3 | 11.829 | 16.215 | 10.2 | 86.99 | 21 | 1 | 329 - 344 | R.MSAMSSASDNASDLKK.S | Oxidation: 4; | Tair10_plus_Mascot_2012-09-18 09:20:29 | AT4G04640.1 | CID | F1 part, gamma subunit (AtpC1) | d) atp-synthase | I) photophosphorylation | plastid |
132 | 558.921 | 1673.724 | 3 | 11.290 | 13.225 | 9.2 | 89.43 | 9 | 1 | 329 - 344 | R.MSAMSSASDNASDLKK.S | Oxidation: 1; Oxidation: 4; | Tair10_plus_Mascot_2012-09-18 09:20:29 | AT4G04640.1 | CID | F1 part, gamma subunit (AtpC1) | d) atp-synthase | I) photophosphorylation | plastid |
132 | 493.253 | 984.470 | 2 | 21.005 | 13.405 | 12.5 | 31.65 | 53 | 1 | 345 - 352 | K.SLSMVYNR.K | Oxidation: 4; | Tair10_plus_Mascot_2012-09-18 09:20:29 | AT4G04640.1 | CID | F1 part, gamma subunit (AtpC1) | d) atp-synthase | I) photophosphorylation | plastid |
132 | 765.957 | 1529.882 | 2 | 11.370 | 14.870 | 19 | 51.42 | 231 | 1 | 232 - 245 | K.SEPVIHTLLPLSPK.G | | Tair10_plus_Mascot_2012-09-18 09:20:29 | AT4G04640.1 | CID | F1 part, gamma subunit (AtpC1) | d) atp-synthase | I) photophosphorylation | plastid |
132 | 466.266 | 930.513 | 2 | 4.249 | 20.721 | 9.6 | 36.46 | 15 | 1 | 270 - 277 | K.EGKLTVER.E | | Tair10_plus_Mascot_2012-09-18 09:20:29 | AT4G04640.1 | CID | F1 part, gamma subunit (AtpC1) | d) atp-synthase | I) photophosphorylation | plastid |
132 | 553.589 | 1657.729 | 3 | 10.420 | 12.498 | 10.2 | 57.58 | 19 | 2 | 329 - 344 | R.MSAMSSASDNASDLKK.S | Oxidation: 1; | Tair10_plus_Mascot_2012-09-18 09:20:29 | AT4G04640.1 | CID | F1 part, gamma subunit (AtpC1) | d) atp-synthase | I) photophosphorylation | plastid |
132 | 670.355 | 1338.675 | 2 | 14.265 | 17.098 | 20.6 | 62.96 | 245 | 1 | 137 - 148 | R.GLCGGFNNFIIK.K | Carbamidomethyl: 3; | Tair10_plus_Mascot_2012-09-18 09:20:29 | AT4G04640.1 | CID | F1 part, gamma subunit (AtpC1) | d) atp-synthase | I) photophosphorylation | plastid |
132 | 692.440 | 691.427 | 1 | 8.812 | 14.150 | 15.2 | 19.97 | 132 | 1 | 226 - 231 | K.FVSLVK.S | | Tair10_plus_Mascot_2012-09-18 09:20:29 | AT4G04640.1 | CID | F1 part, gamma subunit (AtpC1) | d) atp-synthase | I) photophosphorylation | plastid |
132 | 631.366 | 1260.711 | 2 | 5.107 | 70.431 | 13.9 | 27.17 | 90 | 1 | 69 - 80 | K.ITEAMKLVAAAK.V | Oxidation: 5; | Tair10_plus_Mascot_2012-09-18 09:20:29 | AT4G04640.1 | CID | F1 part, gamma subunit (AtpC1) | d) atp-synthase | I) photophosphorylation | plastid |
132 | 514.811 | 1027.603 | 2 | 4.363 | 12.549 | 15.9 | 72.75 | 152 | 1 | 127 - 136 | K.VALVVVTGDR.G | | Tair10_plus_Mascot_2012-09-18 09:20:29 | AT4G04640.1 | CID | F1 part, gamma subunit (AtpC1) | d) atp-synthase | I) photophosphorylation | plastid |
132 | 582.326 | 1162.623 | 2 | 12.671 | 13.380 | 15 | 63.28 | 125 | 1 | 188 - 198 | K.YLEAGTLPTAK.E | | Tair10_plus_Mascot_2012-09-18 09:20:29 | AT4G04640.1 | CID | F1 part, gamma subunit (AtpC1) | d) atp-synthase | I) photophosphorylation | plastid |
132 | 575.821 | 1149.614 | 2 | 11.033 | 22.651 | 13.2 | 19.46 | 71 | 1 | 273 - 281 | K.LTVERETFR.T | | Tair10_plus_Mascot_2012-09-18 09:20:29 | AT4G04640.1 | CID | F1 part, gamma subunit (AtpC1) | d) atp-synthase | I) photophosphorylation | plastid |
132 | 589.313 | 1176.599 | 2 | 11.586 | 13.134 | 10.3 | 64.99 | 23 | 1 | 155 - 165 | K.TVTDVAQQTSK.A | | Tair10_plus_Mascot_2012-09-18 09:20:29 | AT5G23060.1 | CID | CaS, calcium sensing receptor | unassigned proteins | VII) proteins (so far) not assigned to a functiona | plastid |
132 | 526.990 | 1577.939 | 3 | 4.944 | 12.071 | 18.8 | 29.31 | 225 | 1 | 262 - 275 | R.VISIPLEELPNKVK.G | | Tair10_plus_Mascot_2012-09-18 09:20:29 | AT5G23060.1 | CID | CaS, calcium sensing receptor | unassigned proteins | VII) proteins (so far) not assigned to a functiona | plastid |